F473873

General Info

Members Datasets Scaffolds Average Seq Length
667 363 1334 117

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0572534|Ga0501045_0572534_420_827
Length 135
Sequence MLCSSTLLGEFFVIGFAGLVAMKDPGLSVGTVWTVSGIAMVLCLLLCGVLTRPGGVQLGWALQLALIASGFFVPTMFFMGAVFTALWWASVHYGRKIDEAKARFAALHAEQGGQSQGSGPTSVLRDPFPEGPCTL

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
30 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
31 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
32 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
50 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
51 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
65 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
72 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
73 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
74 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
75 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
76 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
77 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
78 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
79 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
80 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
81 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
84 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
85 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
86 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
87 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
88 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
89 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
90 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
91 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
92 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
93 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
94 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
95 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
96 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
97 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
98 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
99 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
100 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
101 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
102 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
212 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
239 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
240 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
241 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
259 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
260 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
261 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
262 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
263 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
264 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
265 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
266 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
267 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
268 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
269 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
270 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
271 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
272 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
273 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
274 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
275 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
278 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
285 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
286 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
287 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
288 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
289 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
290 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
291 2643221548 Streptomyces sp. Root55 Isolate Unclassified
292 2643221578 Streptomyces sp. Root63 Isolate Unclassified
293 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
294 2643221647 Streptomyces sp. Root369 Isolate Unclassified
295 2643221670 Streptomyces sp. Root431 Isolate Unclassified
296 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
297 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
298 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
299 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
300 2643221714 Streptomyces sp. Root264 Isolate Unclassified
301 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
302 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
303 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
304 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
305 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
306 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
307 2808606448 Streptomyces sp. 193411 Isolate Unclassified
308 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
309 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
310 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
311 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
312 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
313 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
314 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
315 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
316 2862574272 Streptomyces sp. AcE210 Isolate Nodule
317 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
318 2867369537 Streptomyces sp. Z26 Isolate Unclassified
319 2867428634 Streptomyces sp. RP5T Isolate Unclassified
320 2867475112 Streptomyces sp. TM32 Isolate Unclassified
321 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
322 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
323 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
324 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
325 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
326 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
327 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
328 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
329 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
330 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
331 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
332 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
333 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
334 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
335 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
336 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
337 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
338 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
339 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
340 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
341 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
342 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
343 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
344 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
345 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
346 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
347 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
348 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
349 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
350 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
351 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
352 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
353 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
354 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
355 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
356 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
357 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
358 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
359 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
360 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
361 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
362 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
363 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.86
Metatranscriptomes 0.3
Isolates 11.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.65
Nodule 0.6
Rhizoplane 1.35
Rhizosphere 78.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0572534 3300049824 Bacteria 837
2 rootH1_10040352 3300003316 Bacteria 2203
3 rootH2_10140750 3300003320 Bacteria 3068
4 rootH1_10077226 3300003323 Bacteria 1606
5 JGI25160J50197_1076198 3300003354 Bacteria 631
6 Ga0070683_101868215 3300005329 Bacteria 577
7 Ga0070669_101632326 3300005353 Bacteria 561
8 Ga0068855_100618990 3300005563 Bacteria 1166
9 Ga0068856_100526217 3300005614 Bacteria 1203
10 Ga0081455_10429099 3300005937 Bacteria 909
11 Ga0081539_10216870 3300005985 Bacteria 873
12 Ga0075365_10121595 3300006038 Bacteria 1801
13 Ga0075368_10021512 3300006042 Bacteria 2451
14 Ga0075363_100009215 3300006048 Bacteria 4636
15 Ga0075367_10000916 3300006178 Bacteria 11912
16 Ga0075370_10203652 3300006353 Bacteria 1168
17 Ga0099826_10025908 3300006948 Bacteria 4337
18 Ga0105251_10012982 3300009011 Bacteria 4681
19 Ga0105250_10088460 3300009092 Bacteria 1258
20 Ga0105245_10442267 3300009098 Bacteria 1307
21 Ga0105243_10421384 3300009148 Bacteria 1245
22 Ga0105243_10630719 3300009148 Bacteria 1036
23 Ga0105248_10100267 3300009177 Bacteria 3263
24 Ga0105238_10139983 3300009551 Bacteria 2397
25 Ga0105239_12378065 3300010375 Bacteria 617
26 Ga0105246_10033634 3300011119 Bacteria 3410
27 Ga0105246_10306020 3300011119 Bacteria 1285
28 Ga0105246_11869542 3300011119 Bacteria 576
29 Ga0157372_10062310 3300013307 Bacteria 4179
30 Ga0157372_12548254 3300013307 Bacteria 587
31 Ga0157375_12259018 3300013308 Bacteria 648
32 Ga0182008_10002208 3300014497 Bacteria 12349
33 Ga0182007_10001114 3300015262 Bacteria 14564
34 Ga0182005_1023955 3300015265 Bacteria 1668
35 Ga0183367_1006 3300015688 Bacteria 648044
36 Ga0206356_11499632 3300020070 Bacteria 976
37 Ga0209758_1010626 3300025297 Bacteria 5478
38 Ga0207426_1020717 3300025302 Bacteria 2282
39 Ga0207426_1025425 3300025302 Bacteria 1994
40 Ga0207426_1055944 3300025302 Bacteria 1153
41 Ga0207713_1046761 3300025735 Bacteria 1757
42 Ga0207647_10008338 3300025904 Bacteria 7431
43 Ga0207681_11455559 3300025923 Bacteria 575
44 Ga0207694_10298631 3300025924 Bacteria 1326
45 Ga0207644_11125322 3300025931 Bacteria 660
46 Ga0207711_10205850 3300025941 Bacteria 1797
47 Ga0207661_10927459 3300025944 Bacteria 802
48 Ga0207712_10339644 3300025961 Bacteria 1245
49 Ga0207639_10049607 3300026041 Bacteria 3184
50 Ga0207683_11498155 3300026121 Bacteria 623
51 Ga0209371_1014196 3300027312 Bacteria 2194
52 Ga0209813_10051672 3300027866 Bacteria 1286
53 Ga0307517_10022864 3300028786 Bacteria 7809
54 Ga0307517_10036451 3300028786 Bacteria 5531
55 Ga0307515_10002026 3300028794 Bacteria 44830
56 Ga0307515_10130815 3300028794 Bacteria 2766
57 Ga0307515_10275634 3300028794 Bacteria 1396
58 Ga0307515_10914092 3300028794 Bacteria 510
59 Ga0268256_1014535 3300030500 Bacteria 2331
60 Ga0307511_10174919 3300030521 Bacteria 1170
61 Ga0307512_10032318 3300030522 Bacteria 4520
62 Ga0307512_10336518 3300030522 Bacteria 675
63 Ga0307513_10003236 3300031456 Bacteria 22206
64 Ga0307509_10032168 3300031507 Bacteria 5783
65 Ga0307509_10052292 3300031507 Bacteria 4361
66 Ga0307509_10120841 3300031507 Bacteria 2597
67 Ga0307509_10226415 3300031507 Bacteria 1677
68 Ga0307509_10743853 3300031507 Bacteria 646
69 Ga0307408_100524209 3300031548 Bacteria 1041
70 Ga0307408_101659202 3300031548 Bacteria 608
71 Ga0307508_10004836 3300031616 Bacteria 12982
72 Ga0307508_10042678 3300031616 Bacteria 4067
73 Ga0307508_10067929 3300031616 Bacteria 3134
74 Ga0307508_10236566 3300031616 Bacteria 1424
75 Ga0307514_10007453 3300031649 Bacteria 9428
76 Ga0307514_10061112 3300031649 Bacteria 2871
77 Ga0307514_10066459 3300031649 Bacteria 2727
78 Ga0307514_10206962 3300031649 Bacteria 1224
79 Ga0307514_10271312 3300031649 Bacteria 981
80 Ga0307514_10351105 3300031649 Bacteria 786
81 Ga0307514_10510872 3300031649 Bacteria 567
82 Ga0307516_10013958 3300031730 Bacteria 8526
83 Ga0307516_10206428 3300031730 Bacteria 1681
84 Ga0307413_10042068 3300031824 Bacteria 2682
85 Ga0307518_10089973 3300031838 Bacteria 2209
86 Ga0307518_10106336 3300031838 Bacteria 2003
87 Ga0307412_11197805 3300031911 Bacteria 680
88 Ga0307409_100169279 3300031995 Bacteria 1921
89 Ga0307416_102833000 3300032002 Bacteria 580
90 Ga0307411_10124330 3300032005 Bacteria 1873
91 Ga0307507_10018449 3300033179 Bacteria 7930
92 Ga0307507_10336317 3300033179 Bacteria 898
93 Ga0307510_10084802 3300033180 Bacteria 3048
94 Ga0307510_10102649 3300033180 Bacteria 2641
95 Ga0307510_10148611 3300033180 Bacteria 1968
96 Ga0307510_10155561 3300033180 Bacteria 1893
97 Ga0307510_10164108 3300033180 Bacteria 1813
98 Ga0395899_0607197 3300037312 Bacteria 696
99 Ga0395900_0115279 3300037418 Bacteria 2757
100 Ga0395900_0144968 3300037418 Bacteria 2429
101 Ga0395900_1761069 3300037418 Bacteria 530
102 Ga0395898_0004019 3300037466 Bacteria 16164
103 Ga0395898_0004910 3300037466 Bacteria 14516
104 Ga0395905_0465114 3300037471 Bacteria 1163
105 Ga0395901_0048352 3300038443 Bacteria 4417
106 Ga0439436_0004002 3300041404 Bacteria 4514
107 Ga0439436_0011691 3300041404 Bacteria 2666
108 Ga0439439_0048007 3300041406 Bacteria 1116
109 Ga0439453_0121173 3300041408 Bacteria 600
110 Ga0439466_0045731 3300041411 Bacteria 1447
111 Ga0451791_0642688 3300041451 Bacteria 997
112 Ga0451802_0610306 3300041460 Bacteria 1309
113 Ga0451807_2058517 3300041486 Bacteria 539
114 Ga0451837_0679658 3300041494 Bacteria 4299
115 Ga0451841_0992308 3300041498 Bacteria 1435
116 Ga0451843_1332349 3300041509 Bacteria 830
117 Ga0451855_1924627 3300041511 Bacteria 728
118 Ga0451853_1771758 3300041512 Bacteria 1381
119 Ga0451853_2515503 3300041512 Bacteria 1938
120 Ga0451853_2542224 3300041512 Bacteria 5131
121 Ga0451853_3438644 3300041512 Bacteria 525
122 Ga0439431_0092509 3300041997 Bacteria 825
123 Ga0439433_0000822 3300041999 Bacteria 6152
124 Ga0439442_019996 3300042002 Bacteria 1387
125 Ga0439448_0090126 3300042005 Bacteria 1035
126 Ga0439449_0026380 3300042007 Bacteria 2169
127 Ga0439449_0115250 3300042007 Bacteria 996
128 Ga0439450_003844 3300042008 Bacteria 2520
129 Ga0439450_026791 3300042008 Bacteria 1273
130 Ga0439454_023521 3300042011 Bacteria 925
131 Ga0439455_0003535 3300042012 Bacteria 3000
132 Ga0439455_0036570 3300042012 Bacteria 1243
133 Ga0439457_000074 3300042014 Bacteria 22043
134 Ga0439457_000457 3300042014 Bacteria 11754
135 Ga0439462_0019140 3300042015 Bacteria 1781
136 Ga0439462_0041979 3300042015 Bacteria 1222
137 Ga0450894_000102 3300042131 Bacteria 14302
138 Ga0450896_000974 3300042133 Bacteria 3327
139 Ga0450898_001627 3300042134 Bacteria 3010
140 Ga0450899_000098 3300042135 Bacteria 7563
141 Ga0450900_008169 3300042136 Bacteria 1303
142 Ga0450900_012990 3300042136 Bacteria 1096
143 Ga0450903_000064 3300042138 Bacteria 21230
144 Ga0450903_057366 3300042138 Bacteria 566
145 Ga0450906_001062 3300042145 Bacteria 6050
146 Ga0450907_055693 3300042146 Bacteria 681
147 Ga0439458_0001014 3300042157 Bacteria 7187
148 Ga0439459_0074234 3300042438 Bacteria 792
149 Ga0466969_0029587 3300044656 Bacteria 2796
150 Ga0466972_0004247 3300044658 Bacteria 7161
151 Ga0466972_0026571 3300044658 Bacteria 2869
152 Ga0466972_0096982 3300044658 Bacteria 1396
153 Ga0466972_0389650 3300044658 Bacteria 653
154 Ga0466965_0008408 3300044683 Bacteria 4775
155 Ga0466965_0030139 3300044683 Bacteria 2642
156 Ga0466965_0089033 3300044683 Bacteria 1568
157 Ga0466965_0185838 3300044683 Bacteria 1098
158 Ga0466966_0003602 3300044684 Bacteria 10217
159 Ga0466966_0006216 3300044684 Bacteria 7894
160 Ga0466966_0080203 3300044684 Bacteria 2033
161 Ga0466961_0001173 3300044693 Bacteria 16122
162 Ga0466961_0014077 3300044693 Bacteria 5130
163 Ga0466961_0014443 3300044693 Bacteria 5070
164 Ga0466961_0070851 3300044693 Bacteria 2213
165 Ga0466961_0227915 3300044693 Bacteria 1147
166 Ga0466963_0002051 3300044694 Bacteria 11102
167 Ga0466963_0160482 3300044694 Bacteria 1564
168 Ga0466963_0227936 3300044694 Bacteria 1305
169 Ga0466964_0041744 3300044706 Bacteria 1856
170 Ga0466971_0000496 3300044719 Bacteria 15458
171 Ga0466971_0029346 3300044719 Bacteria 2460
172 Ga0466971_0031109 3300044719 Bacteria 2389
173 Ga0466968_0152762 3300044735 Bacteria 1062
174 Ga0466968_0339960 3300044735 Bacteria 728
175 Ga0466970_0000648 3300044765 Bacteria 17136
176 Ga0466970_0034807 3300044765 Bacteria 2667
177 Ga0466970_0326436 3300044765 Bacteria 868
178 Ga0466970_0471122 3300044765 Bacteria 721
179 Ga0466970_0614386 3300044765 Bacteria 631
180 Ga0466957_0000456 3300044842 Bacteria 20238
181 Ga0466957_0031247 3300044842 Bacteria 3181
182 Ga0466957_0679847 3300044842 Bacteria 725
183 Ga0466960_0006140 3300044901 Bacteria 4806
184 Ga0466960_0490117 3300044901 Bacteria 719
185 Ga0466960_0567240 3300044901 Bacteria 671
186 Ga0466959_0024756 3300045049 Bacteria 4446
187 Ga0466959_0072186 3300045049 Bacteria 2498
188 Ga0466959_0400989 3300045049 Bacteria 932
189 Ga0466959_0951405 3300045049 Bacteria 572
190 Ga0466958_0000159 3300045836 Bacteria 23828
191 Ga0466958_0529088 3300045836 Bacteria 765
192 Ga0466967_0007231 3300045976 Bacteria 7980
193 Ga0466967_0030621 3300045976 Bacteria 4518
194 Ga0466967_0184311 3300045976 Bacteria 1970
195 Ga0466967_0667369 3300045976 Bacteria 1029
196 Ga0495617_004540 3300046452 Bacteria 5030
197 Ga0495617_189105 3300046452 Bacteria 646
198 Ga0495627_069030 3300046453 Bacteria 1035
199 Ga0495592_0012206 3300046454 Bacteria 6519
200 Ga0495592_0347664 3300046454 Bacteria 951
201 Ga0495603_0002324 3300046455 Bacteria 11163
202 Ga0495603_0003743 3300046455 Bacteria 9044
203 Ga0495603_0005800 3300046455 Bacteria 7389
204 Ga0495603_0017303 3300046455 Bacteria 4365
205 Ga0495603_0362496 3300046455 Bacteria 831
206 Ga0495603_0413966 3300046455 Bacteria 773
207 Ga0495590_0029430 3300046457 Bacteria 1926
208 Ga0495629_0001256 3300046459 Bacteria 19914
209 Ga0495629_0011004 3300046459 Bacteria 6570
210 Ga0495629_0050852 3300046459 Bacteria 2901
211 Ga0495629_0098935 3300046459 Bacteria 2035
212 Ga0495629_0136521 3300046459 Bacteria 1707
213 Ga0495629_0173412 3300046459 Bacteria 1496
214 Ga0495638_0034601 3300046460 Bacteria 3225
215 Ga0495638_0044911 3300046460 Bacteria 2782
216 Ga0495638_0046164 3300046460 Bacteria 2737
217 Ga0495638_0306485 3300046460 Bacteria 854
218 Ga0495638_0477992 3300046460 Bacteria 631
219 Ga0495641_0116829 3300046461 Bacteria 1190
220 Ga0495651_0122599 3300046462 Bacteria 1907
221 Ga0495653_0216856 3300046463 Bacteria 1289
222 Ga0495580_0032620 3300046472 Bacteria 3757
223 Ga0495582_0115476 3300046473 Bacteria 1509
224 Ga0495582_0154222 3300046473 Bacteria 1305
225 Ga0495605_0001675 3300046474 Bacteria 14245
226 Ga0495639_0020673 3300046475 Bacteria 2876
227 Ga0495662_0016771 3300046476 Bacteria 3546
228 Ga0495662_0050565 3300046476 Bacteria 2006
229 Ga0495662_0166078 3300046476 Bacteria 1087
230 Ga0495662_0249313 3300046476 Bacteria 874
231 Ga0495664_0020802 3300046477 Bacteria 3788
232 Ga0495664_0041296 3300046477 Bacteria 2729
233 Ga0495584_0150326 3300046491 Bacteria 1183
234 Ga0495584_0207027 3300046491 Bacteria 997
235 Ga0495585_0034560 3300046492 Bacteria 2858
236 Ga0495585_0094377 3300046492 Bacteria 1608
237 Ga0495585_0142316 3300046492 Bacteria 1255
238 Ga0495585_0493455 3300046492 Bacteria 582
239 Ga0495594_0003225 3300046499 Bacteria 8452
240 Ga0495594_0016542 3300046499 Bacteria 3887
241 Ga0495594_0088809 3300046499 Bacteria 1730
242 Ga0495594_0106493 3300046499 Bacteria 1579
243 Ga0495594_0188982 3300046499 Bacteria 1173
244 Ga0495596_0021213 3300046500 Bacteria 2653
245 Ga0495607_0040780 3300046501 Bacteria 2761
246 Ga0495607_0154229 3300046501 Bacteria 1173
247 Ga0495583_0019641 3300046506 Bacteria 3521
248 Ga0495583_0161704 3300046506 Bacteria 923
249 Ga0495606_0001850 3300046507 Bacteria 26642
250 Ga0495610_0014723 3300046512 Bacteria 4581
251 Ga0495616_0020486 3300046513 Bacteria 3595
252 Ga0495618_0077602 3300046514 Bacteria 2116
253 Ga0495618_0107411 3300046514 Bacteria 1787
254 Ga0495620_0007103 3300046515 Bacteria 6104
255 Ga0495620_0032448 3300046515 Bacteria 2379
256 Ga0495620_0062141 3300046515 Bacteria 1552
257 Ga0495620_0249879 3300046515 Bacteria 676
258 Ga0495628_0119303 3300046516 Bacteria 2024
259 Ga0495630_0176036 3300046517 Bacteria 1631
260 Ga0495630_1450340 3300046517 Bacteria 515
261 Ga0495631_0038599 3300046518 Bacteria 2122
262 Ga0495631_0442990 3300046518 Bacteria 553
263 Ga0495632_0081864 3300046519 Bacteria 1539
264 Ga0495632_0103939 3300046519 Bacteria 1337
265 Ga0495637_0077795 3300046520 Bacteria 1327
266 Ga0495643_0004147 3300046522 Bacteria 10296
267 Ga0495643_0015574 3300046522 Bacteria 4491
268 Ga0495643_0503425 3300046522 Bacteria 521
269 Ga0495648_0030063 3300046524 Bacteria 3598
270 Ga0495648_0100894 3300046524 Bacteria 1593
271 Ga0495648_0234103 3300046524 Bacteria 897
272 Ga0495666_0020838 3300046526 Bacteria 3246
273 Ga0495666_0187368 3300046526 Bacteria 954
274 Ga0495666_0249066 3300046526 Bacteria 809
275 Ga0495642_0052469 3300046528 Bacteria 1679
276 Ga0495652_0024094 3300046529 Bacteria 5390
277 Ga0495652_0455435 3300046529 Bacteria 895
278 Ga0495640_0076186 3300046533 Bacteria 2238
279 Ga0495640_0226756 3300046533 Bacteria 1176
280 Ga0495640_0255460 3300046533 Bacteria 1096
281 Ga0495586_0055602 3300046535 Bacteria 2145
282 Ga0495587_0000928 3300046536 Bacteria 19291
283 Ga0495609_0025810 3300046538 Bacteria 2691
284 Ga0495597_0032737 3300046542 Bacteria 2357
285 Ga0495597_0103781 3300046542 Bacteria 1196
286 Ga0495597_0308725 3300046542 Bacteria 613
287 Ga0495645_0060725 3300046543 Bacteria 2740
288 Ga0495645_0214482 3300046543 Bacteria 1298
289 Ga0495622_0002187 3300046557 Bacteria 9539
290 Ga0495622_0036650 3300046557 Bacteria 2286
291 Ga0495622_0151613 3300046557 Bacteria 1049
292 Ga0495622_0318686 3300046557 Bacteria 676
293 Ga0495633_0028243 3300046558 Bacteria 2736
294 Ga0495633_0372559 3300046558 Bacteria 646
295 Ga0495667_0083729 3300046559 Bacteria 2071
296 Ga0495667_0238747 3300046559 Bacteria 1158
297 Ga0495656_0023537 3300046615 Bacteria 2425
298 Ga0495656_0737047 3300046615 Bacteria 531
299 Ga0495668_0019419 3300046616 Bacteria 3918
300 Ga0495634_0048612 3300046642 Bacteria 2855
301 Ga0495634_0064213 3300046642 Bacteria 2434
302 Ga0495634_0517739 3300046642 Bacteria 698
303 Ga0495611_0230712 3300046648 Bacteria 860
304 Ga0495625_0004464 3300046660 Bacteria 13220
305 Ga0495625_0427380 3300046660 Bacteria 822
306 Ga0495635_0010587 3300046663 Bacteria 6455
307 Ga0495635_0064877 3300046663 Bacteria 2506
308 Ga0495635_0079566 3300046663 Bacteria 2243
309 Ga0495661_0043257 3300046665 Bacteria 2770
310 Ga0495661_0220522 3300046665 Bacteria 983
311 Ga0495588_0006656 3300046674 Bacteria 5218
312 Ga0495588_0042845 3300046674 Bacteria 2314
313 Ga0495588_0048980 3300046674 Bacteria 2171
314 Ga0495588_0089378 3300046674 Bacteria 1613
315 Ga0495588_0374057 3300046674 Bacteria 748
316 Ga0495657_0011786 3300046675 Bacteria 6517
317 Ga0495657_0031768 3300046675 Bacteria 3687
318 Ga0495657_0279846 3300046675 Bacteria 998
319 Ga0495657_0529436 3300046675 Bacteria 685
320 Ga0495599_0135430 3300046678 Bacteria 1529
321 Ga0495623_0011838 3300046679 Bacteria 5652
322 Ga0495646_0009464 3300046680 Bacteria 6184
323 Ga0495658_0106294 3300046683 Bacteria 1682
324 Ga0495613_0000533 3300046689 Bacteria 31681
325 Ga0495613_0083756 3300046689 Bacteria 2316
326 Ga0495613_0124725 3300046689 Bacteria 1847
327 Ga0495613_0159282 3300046689 Bacteria 1606
328 Ga0495613_0167104 3300046689 Bacteria 1562
329 Ga0495613_0315838 3300046689 Bacteria 1079
330 Ga0495613_0325965 3300046689 Bacteria 1059
331 Ga0495624_0039146 3300046690 Bacteria 3040
332 Ga0495624_0142365 3300046690 Bacteria 1468
333 Ga0495624_0151773 3300046690 Bacteria 1417
334 Ga0495670_0001523 3300046691 Bacteria 11318
335 Ga0495670_0087347 3300046691 Bacteria 1593
336 Ga0495670_0328312 3300046691 Bacteria 822
337 Ga0495670_0363973 3300046691 Bacteria 779
338 Ga0495671_0022075 3300046692 Bacteria 3337
339 Ga0495671_0192293 3300046692 Bacteria 991
340 Ga0495671_0375660 3300046692 Bacteria 681
341 Ga0495649_0013303 3300046694 Bacteria 4752
342 Ga0495649_0083679 3300046694 Bacteria 1704
343 Ga0495649_0220749 3300046694 Bacteria 980
344 Ga0495649_0286015 3300046694 Bacteria 842
345 Ga0495589_0005801 3300046794 Bacteria 6512
346 Ga0495589_0040571 3300046794 Bacteria 2324
347 Ga0495589_0055326 3300046794 Bacteria 1955
348 Ga0495589_0079733 3300046794 Bacteria 1593
349 Ga0495589_0098793 3300046794 Bacteria 1413
350 Ga0495589_0117801 3300046794 Bacteria 1279
351 Ga0495589_0197360 3300046794 Bacteria 950
352 Ga0495589_0263940 3300046794 Bacteria 802
353 Ga0495589_0305155 3300046794 Bacteria 737
354 Ga0495600_0025230 3300046809 Bacteria 3830
355 Ga0495600_0120766 3300046809 Bacteria 1704
356 Ga0495600_0158520 3300046809 Bacteria 1463
357 Ga0495660_0075690 3300046810 Bacteria 1775
358 Ga0495660_0119508 3300046810 Bacteria 1334
359 Ga0495660_0375636 3300046810 Bacteria 627
360 Ga0495581_0158019 3300047315 Bacteria 1325
361 Ga0495581_0253915 3300047315 Bacteria 1028
362 Ga0495581_0414851 3300047315 Bacteria 785
363 Ga0495581_0685672 3300047315 Bacteria 591
364 Ga0495581_0706653 3300047315 Bacteria 581
365 Ga0495604_0003396 3300047317 Bacteria 12695
366 Ga0495604_0003582 3300047317 Bacteria 12377
367 Ga0495604_0007982 3300047317 Bacteria 8383
368 Ga0495604_0088694 3300047317 Bacteria 2300
369 Ga0495604_0470665 3300047317 Bacteria 818
370 Ga0495636_0001739 3300047318 Bacteria 8304
371 Ga0495636_0002676 3300047318 Bacteria 6879
372 Ga0495636_0010777 3300047318 Bacteria 3615
373 Ga0495636_0015411 3300047318 Bacteria 3047
374 Ga0495636_0028177 3300047318 Bacteria 2289
375 Ga0495636_0044420 3300047318 Bacteria 1850
376 Ga0495636_0054547 3300047318 Bacteria 1680
377 Ga0495636_0301725 3300047318 Bacteria 749
378 Ga0495636_0648555 3300047318 Bacteria 518
379 Ga0495674_0146353 3300047319 Bacteria 1983
380 Ga0495674_0179925 3300047319 Bacteria 1761
381 Ga0495676_0004789 3300047321 Bacteria 12393
382 Ga0495676_0009563 3300047321 Bacteria 8822
383 Ga0495676_0028130 3300047321 Bacteria 4808
384 Ga0495676_0089845 3300047321 Bacteria 2300
385 Ga0495676_0402079 3300047321 Bacteria 908
386 Ga0495676_0755358 3300047321 Bacteria 627
387 Ga0495676_0785828 3300047321 Bacteria 613
388 Ga0495680_0027030 3300047322 Bacteria 4721
389 Ga0495680_0435319 3300047322 Bacteria 900
390 Ga0495683_0110329 3300047323 Bacteria 1314
391 Ga0495687_004656 3300047443 Bacteria 9156
392 Ga0495687_048529 3300047443 Bacteria 1820
393 Ga0495687_058865 3300047443 Bacteria 1592
394 Ga0495687_069504 3300047443 Bacteria 1417
395 Ga0495687_085140 3300047443 Bacteria 1226
396 Ga0495687_092784 3300047443 Bacteria 1152
397 Ga0495687_120958 3300047443 Bacteria 945
398 Ga0495675_0002803 3300047444 Bacteria 10459
399 Ga0495675_0009082 3300047444 Bacteria 6178
400 Ga0495675_0067171 3300047444 Bacteria 2266
401 Ga0495677_0116208 3300047445 Bacteria 1019
402 Ga0495685_000208 3300047447 Bacteria 19755
403 Ga0495685_008408 3300047447 Bacteria 3427
404 Ga0495685_022706 3300047447 Bacteria 2159
405 Ga0495685_024224 3300047447 Bacteria 2088
406 Ga0495685_041619 3300047447 Bacteria 1569
407 Ga0495685_097718 3300047447 Bacteria 970
408 Ga0495685_166977 3300047447 Bacteria 711
409 Ga0495673_0094165 3300047469 Bacteria 1220
410 Ga0495681_0005276 3300047470 Bacteria 8675
411 Ga0495681_0007099 3300047470 Bacteria 7224
412 Ga0495681_0064733 3300047470 Bacteria 1673
413 Ga0495684_0183114 3300047471 Bacteria 1552
414 Ga0495686_0050640 3300047472 Bacteria 2609
415 Ga0495686_0074172 3300047472 Bacteria 2088
416 Ga0495686_0083017 3300047472 Bacteria 1955
417 Ga0495686_0384265 3300047472 Bacteria 757
418 Ga0495593_0004563 3300047673 Bacteria 8230
419 Ga0495593_0063271 3300047673 Bacteria 1933
420 Ga0495593_0177675 3300047673 Bacteria 1072
421 Ga0495593_0447123 3300047673 Bacteria 647
422 Ga0495602_0106542 3300048088 Bacteria 2288
423 Ga0495614_0010523 3300048089 Bacteria 4079
424 Ga0495614_0027544 3300048089 Bacteria 2450
425 Ga0495614_0031986 3300048089 Bacteria 2264
426 Ga0495614_0127717 3300048089 Bacteria 1123
427 Ga0495614_0184845 3300048089 Bacteria 938
428 Ga0495614_0574484 3300048089 Bacteria 540
429 Ga0495626_0006904 3300048091 Bacteria 6395
430 Ga0496100_0591866 3300048903 Bacteria 861
431 Ga0496108_0040588 3300048911 Bacteria 3881
432 Ga0496111_0198440 3300048914 Bacteria 1492
433 Ga0496112_0754219 3300048915 Bacteria 899
434 Ga0496113_0151168 3300048916 Bacteria 1832
435 Ga0496123_0326356 3300048926 Bacteria 722
436 Ga0495678_036544 3300049459 Bacteria 2003
437 Ga0495682_0209275 3300049460 Bacteria 691
438 Ga0501318_051232 3300049534 Bacteria 614
439 Ga0501031_0000642 3300049568 Bacteria 20719
440 Ga0501031_0049075 3300049568 Bacteria 2750
441 Ga0501031_0120228 3300049568 Bacteria 1716
442 Ga0501031_0122324 3300049568 Bacteria 1700
443 Ga0501032_0002633 3300049569 Bacteria 14011
444 Ga0501032_0038747 3300049569 Bacteria 3244
445 Ga0501032_0073353 3300049569 Bacteria 2280
446 Ga0501033_0009561 3300049570 Bacteria 7461
447 Ga0501033_0023996 3300049570 Bacteria 4601
448 Ga0501033_0027307 3300049570 Bacteria 4291
449 Ga0501033_0140135 3300049570 Bacteria 1748
450 Ga0501033_0222107 3300049570 Bacteria 1344
451 Ga0501033_0578068 3300049570 Bacteria 772
452 Ga0501034_0019611 3300049571 Bacteria 6915
453 Ga0501034_0066348 3300049571 Bacteria 3622
454 Ga0501034_0080140 3300049571 Bacteria 3268
455 Ga0501034_0088873 3300049571 Bacteria 3087
456 Ga0501036_0000809 3300049572 Bacteria 23223
457 Ga0501036_0001287 3300049572 Bacteria 19221
458 Ga0501036_0083066 3300049572 Bacteria 2707
459 Ga0501036_0163344 3300049572 Bacteria 1877
460 Ga0501037_0000644 3300049573 Bacteria 26982
461 Ga0501037_0117290 3300049573 Bacteria 1915
462 Ga0501037_0643319 3300049573 Bacteria 709
463 Ga0501038_0004611 3300049574 Bacteria 12820
464 Ga0501038_0006060 3300049574 Bacteria 11186
465 Ga0501038_0159507 3300049574 Bacteria 1834
466 Ga0501038_0720215 3300049574 Bacteria 746
467 Ga0501038_0883587 3300049574 Bacteria 660
468 Ga0501039_0004334 3300049575 Bacteria 10698
469 Ga0501039_0005182 3300049575 Bacteria 9869
470 Ga0501039_0091611 3300049575 Bacteria 2369
471 Ga0501040_0032634 3300049576 Bacteria 3524
472 Ga0501041_0005422 3300049577 Bacteria 7472
473 Ga0501042_0048132 3300049578 Bacteria 3040
474 Ga0501043_0003346 3300049579 Bacteria 13205
475 Ga0501043_0028514 3300049579 Bacteria 4383
476 Ga0501043_0070442 3300049579 Bacteria 2746
477 Ga0501043_0099605 3300049579 Bacteria 2284
478 Ga0501043_0340414 3300049579 Bacteria 1141
479 Ga0501043_0620360 3300049579 Bacteria 797
480 Ga0501046_0003711 3300049580 Bacteria 13975
481 Ga0501046_0253614 3300049580 Bacteria 1294
482 Ga0501046_0431897 3300049580 Bacteria 948
483 Ga0501046_1083667 3300049580 Bacteria 554
484 Ga0501047_0001101 3300049581 Bacteria 26872
485 Ga0501047_0067630 3300049581 Bacteria 3442
486 Ga0501047_0073599 3300049581 Bacteria 3289
487 Ga0501047_0081135 3300049581 Bacteria 3118
488 Ga0501047_0185640 3300049581 Bacteria 1945
489 Ga0501047_0304535 3300049581 Bacteria 1435
490 Ga0501047_0542547 3300049581 Bacteria 987
491 Ga0501047_0689714 3300049581 Bacteria 839
492 Ga0501048_0080241 3300049582 Bacteria 2302
493 Ga0501048_0256199 3300049582 Bacteria 1243
494 Ga0501048_0280123 3300049582 Bacteria 1186
495 Ga0501048_0438830 3300049582 Bacteria 934
496 Ga0501048_1302746 3300049582 Bacteria 522
497 Ga0501067_0001967 3300049583 Bacteria 11317
498 Ga0501068_0000363 3300049584 Bacteria 22760
499 Ga0501069_0123276 3300049585 Bacteria 1481
500 Ga0501069_0139489 3300049585 Bacteria 1390
501 Ga0501070_0006770 3300049586 Bacteria 9755
502 Ga0501070_0086837 3300049586 Bacteria 2589
503 Ga0501070_0644694 3300049586 Bacteria 841
504 Ga0501070_0984647 3300049586 Bacteria 654
505 Ga0501071_0000362 3300049587 Bacteria 22312
506 Ga0501072_0000272 3300049588 Bacteria 37385
507 Ga0501073_0006685 3300049589 Bacteria 8586
508 Ga0501074_0103273 3300049590 Bacteria 2040
509 Ga0501074_0194799 3300049590 Bacteria 1444
510 Ga0501074_0324785 3300049590 Bacteria 1093
511 Ga0501076_0010815 3300049592 Bacteria 6784
512 Ga0501077_0077029 3300049593 Bacteria 2112
513 Ga0501217_101544 3300049661 Bacteria 818
514 Ga0501235_244648 3300049669 Bacteria 500
515 Ga0501250_015622 3300049680 Bacteria 935
516 Ga0501257_072274 3300049686 Bacteria 882
517 Ga0501079_0012287 3300049741 Bacteria 6533
518 Ga0501080_0005642 3300049742 Bacteria 11183
519 Ga0501080_0133471 3300049742 Bacteria 2298
520 Ga0501080_1077966 3300049742 Bacteria 694
521 Ga0501083_0000911 3300049744 Bacteria 19621
522 Ga0501035_0003482 3300049822 Bacteria 15060
523 Ga0501035_0006265 3300049822 Bacteria 11187
524 Ga0501035_0037335 3300049822 Bacteria 4399
525 Ga0501035_0038700 3300049822 Bacteria 4317
526 Ga0501035_0045387 3300049822 Bacteria 3954
527 Ga0501035_0065944 3300049822 Bacteria 3213
528 Ga0501035_0145896 3300049822 Bacteria 2055
529 Ga0501035_0397855 3300049822 Bacteria 1146
530 Ga0501035_1463329 3300049822 Bacteria 522
531 Ga0501044_0004754 3300049823 Bacteria 15188
532 Ga0501044_0054536 3300049823 Bacteria 4108
533 Ga0501044_0071477 3300049823 Bacteria 3528
534 Ga0501044_0082247 3300049823 Bacteria 3258
535 Ga0501044_0181328 3300049823 Bacteria 2072
536 Ga0501044_0193474 3300049823 Bacteria 1995
537 Ga0501044_0220424 3300049823 Bacteria 1847
538 Ga0501044_0322583 3300049823 Bacteria 1468
539 Ga0501045_1044937 3300049824 Bacteria 598
540 nmdc:mga03n38_1940_c1 3300050490 Bacteria 6197
541 nmdc:mga03n38_266294_c1 3300050490 Bacteria 910
542 nmdc:mga0yw44_34212_c1 3300050492 Bacteria 2976
543 nmdc:mga06z11_2921_c1 3300050494 Bacteria 6578
544 nmdc:mga04h51_83672_c1 3300050495 Bacteria 1137
545 nmdc:mga07m45_72496_c1 3300050496 Bacteria 1960
546 Ga0495655_0161985 3300053083 Bacteria 710
547 Ga0495619_0094610 3300053085 Bacteria 2027
548 Ga0500578_0042979 3300053086 Bacteria 2900
549 Ga0500578_0173119 3300053086 Bacteria 1334
550 Ga0500644_0011660 3300053088 Bacteria 2409
551 Ga0500646_0123440 3300053090 Bacteria 835
552 Ga0500651_0401665 3300053093 Bacteria 770
553 Ga0500566_0019750 3300053094 Bacteria 3957
554 Ga0500566_0256172 3300053094 Bacteria 848
555 Ga0500640_070011 3300053095 Bacteria 1506
556 Ga0500641_0046110 3300053096 Bacteria 1777
557 Ga0500660_025707 3300053100 Bacteria 3107
558 Ga0500553_081174 3300053101 Bacteria 1458
559 Ga0500558_054162 3300053106 Bacteria 1687
560 Ga0500560_002857 3300053107 Bacteria 3397
561 Ga0500560_012121 3300053107 Bacteria 2223
562 Ga0500569_001534 3300053109 Bacteria 4381
563 Ga0500608_143837 3300053122 Bacteria 1054
564 Ga0500614_098957 3300053123 Bacteria 838
565 Ga0500621_052594 3300053126 Bacteria 1648
566 Ga0500628_001867 3300053129 Bacteria 3557
567 Ga0500652_000767 3300053131 Bacteria 10845
568 Ga0500652_246404 3300053131 Bacteria 709
569 Ga0500658_0003671 3300053134 Bacteria 5788
570 Ga0500561_0007086 3300053137 Bacteria 2168
571 Ga0500573_0214844 3300053140 Bacteria 1012
572 Ga0500600_0015344 3300053149 Bacteria 4649
573 Ga0500600_0194719 3300053149 Bacteria 961
574 Ga0500600_0252967 3300053149 Bacteria 788
575 Ga0500600_0326764 3300053149 Bacteria 643
576 Ga0500603_197140 3300053150 Bacteria 638
577 Ga0500627_0274230 3300053158 Bacteria 742
578 Ga0500633_0012738 3300053160 Bacteria 2333
579 Ga0500634_0008375 3300053161 Bacteria 5169
580 Ga0500636_0472257 3300053177 Bacteria 561
581 Ga0500656_001183 3300053732 Bacteria 2195
582 Ga0501084_0001078 3300054114 Bacteria 21240
583 Ga0501082_0001405 3300060353 Bacteria 21188
584 Ga0466962_0002034 3300061719 Bacteria 9555
585 Ga0466962_0036159 3300061719 Bacteria 2363
586 Ga0466962_0178727 3300061719 Bacteria 1034
587 Ga0466962_0193144 3300061719 Bacteria 993
588 Ga0530510_0018015 3300061734 Bacteria 5005
589 2547406846 2547132111 Bacteria 8013147
590 2554258575 2554235005 Bacteria 6457341
591 2585301913 2582581312 Bacteria 7308206
592 2585304827 2582581313 Bacteria 10042643
593 2585319459 2582581314 Bacteria 11452267
594 2616700741 2616644814 Bacteria 11555299
595 2643759764 2643221548 Bacteria 8053412
596 2643897889 2643221578 Bacteria 9213798
597 2643944675 2643221587 Bacteria 7586415
598 2644269264 2643221647 Bacteria 10741251
599 2644385398 2643221670 Bacteria 6497041
600 2644409034 2643221673 Bacteria 9196637
601 2644431573 2643221677 Bacteria 7584031
602 2644436392 2643221678 Bacteria 9540101
603 2644462817 2643221682 Bacteria 6743283
604 2644625756 2643221714 Bacteria 9015452
605 2784587873 2784132148 Bacteria 8627943
606 2785368596 2784746768 Bacteria 10036182
607 2786669700 2786546132 Bacteria 10419719
608 2793976142 2791355406 Bacteria 11364898
609 2808841280 2808606359 Bacteria 9866990
610 2808919788 2808606375 Bacteria 9466072
611 2809231460 2808606448 Bacteria 8656184
612 2812358978 2811994879 Bacteria 9313447
613 2812481225 2811994917 Bacteria 7761064
614 2819693666 2818991463 Bacteria 7948711
615 2852642218 2852635781 Bacteria 8251373
616 2862184891 2862178590 Bacteria 8583590
617 2862288141 2862281513 Bacteria 9621493
618 2862392578 2862382967 Bacteria 10317375
619 2862509496 2862507626 Bacteria 9425308
620 2862579995 2862574272 Bacteria 10567477
621 2863405526 2863404153 Bacteria 9672205
622 2867371102 2867369537 Bacteria 6501581
623 2867431087 2867428634 Bacteria 9590268
624 2867479674 2867475112 Bacteria 6909112
625 2873156555 2873151551 Bacteria 8625867
626 2875393800 2875391855 Bacteria 7600475
627 2877681932 2877676314 Bacteria 9512378
628 2912720900 2912715099 Bacteria 9460473
629 2912725013 2912723979 Bacteria 8557534
630 2912759935 2912757875 Bacteria 7940295
631 2918503829 2918501144 Bacteria 8668083
632 2919468680 2919468124 Bacteria 9133025
633 2946050853 2946045630 Bacteria 8527308
634 2946066899 2946064051 Bacteria 8957905
635 2946075227 2946072368 Bacteria 8999607
636 2947230335 2947224130 Bacteria 9938529
637 2954003646 2954002825 Bacteria 9173742
638 2954387055 2954380949 Bacteria 10050426
639 2954676108 2954673503 Bacteria 9685905
640 2954697891 2954691527 Bacteria 10720516
641 2954704325 2954701450 Bacteria 10834262
642 2954717002 2954711539 Bacteria 10867210
643 2954726953 2954721474 Bacteria 10456478
644 2954734844 2954731030 Bacteria 10243860
645 2954745874 2954740390 Bacteria 10229294
646 2954753716 2954749733 Bacteria 10366972
647 2954764847 2954759201 Bacteria 9358192
648 2990093394 2990088156 Bacteria 6657676
649 2997456555 2997451912 Bacteria 8492419
650 3006399648 3006393351 Bacteria 6615579
651 3006427307 3006425503 Bacteria 6491253
652 3006488641 3006486233 Bacteria 8157040
653 3006501779 3006493962 Bacteria 8825450
654 8008559547 8008558824 Bacteria 10610750
655 8008579605 8008574985 Bacteria 7815457
656 8023629278 8023623736 Bacteria 8593882
657 8025419326 8025413630 Bacteria 7014048
658 8025480691 8025478263 Bacteria 8209203
659 8025536990 8025530807 Bacteria 8495698
660 8047898943 8047893842 Bacteria 11723082
661 8048127694 8048127548 Bacteria 11053136
662 8048359976 8048356638 Bacteria 11044339
663 8048375901 8048369669 Bacteria 11666822
664 8048382306 8048379754 Bacteria 11877923
665 8056452412 8056447290 Bacteria 7680491
666 8056673169 8056667051 Bacteria 6953971
667 8056833912 8056829672 Bacteria 9045328
668 Ga0501045_0572534
669 rootH1_10040352
670 rootH2_10140750
671 rootH1_10077226
672 JGI25160J50197_1076198
673 Ga0070683_101868215
674 Ga0070669_101632326
675 Ga0068855_100618990
676 Ga0068856_100526217
677 Ga0081455_10429099
678 Ga0081539_10216870
679 Ga0075365_10121595
680 Ga0075368_10021512
681 Ga0075363_100009215
682 Ga0075367_10000916
683 Ga0075370_10203652
684 Ga0099826_10025908
685 Ga0105251_10012982
686 Ga0105250_10088460
687 Ga0105245_10442267
688 Ga0105243_10421384
689 Ga0105243_10630719
690 Ga0105248_10100267
691 Ga0105238_10139983
692 Ga0105239_12378065
693 Ga0105246_10033634
694 Ga0105246_10306020
695 Ga0105246_11869542
696 Ga0157372_10062310
697 Ga0157372_12548254
698 Ga0157375_12259018
699 Ga0182008_10002208
700 Ga0182007_10001114
701 Ga0182005_1023955
702 Ga0183367_1006
703 Ga0206356_11499632
704 Ga0209758_1010626
705 Ga0207426_1020717
706 Ga0207426_1025425
707 Ga0207426_1055944
708 Ga0207713_1046761
709 Ga0207647_10008338
710 Ga0207681_11455559
711 Ga0207694_10298631
712 Ga0207644_11125322
713 Ga0207711_10205850
714 Ga0207661_10927459
715 Ga0207712_10339644
716 Ga0207639_10049607
717 Ga0207683_11498155
718 Ga0209371_1014196
719 Ga0209813_10051672
720 Ga0307517_10022864
721 Ga0307517_10036451
722 Ga0307515_10002026
723 Ga0307515_10130815
724 Ga0307515_10275634
725 Ga0307515_10914092
726 Ga0268256_1014535
727 Ga0307511_10174919
728 Ga0307512_10032318
729 Ga0307512_10336518
730 Ga0307513_10003236
731 Ga0307509_10032168
732 Ga0307509_10052292
733 Ga0307509_10120841
734 Ga0307509_10226415
735 Ga0307509_10743853
736 Ga0307408_100524209
737 Ga0307408_101659202
738 Ga0307508_10004836
739 Ga0307508_10042678
740 Ga0307508_10067929
741 Ga0307508_10236566
742 Ga0307514_10007453
743 Ga0307514_10061112
744 Ga0307514_10066459
745 Ga0307514_10206962
746 Ga0307514_10271312
747 Ga0307514_10351105
748 Ga0307514_10510872
749 Ga0307516_10013958
750 Ga0307516_10206428
751 Ga0307413_10042068
752 Ga0307518_10089973
753 Ga0307518_10106336
754 Ga0307412_11197805
755 Ga0307409_100169279
756 Ga0307416_102833000
757 Ga0307411_10124330
758 Ga0307507_10018449
759 Ga0307507_10336317
760 Ga0307510_10084802
761 Ga0307510_10102649
762 Ga0307510_10148611
763 Ga0307510_10155561
764 Ga0307510_10164108
765 Ga0395899_0607197
766 Ga0395900_0115279
767 Ga0395900_0144968
768 Ga0395900_1761069
769 Ga0395898_0004019
770 Ga0395898_0004910
771 Ga0395905_0465114
772 Ga0395901_0048352
773 Ga0439436_0004002
774 Ga0439436_0011691
775 Ga0439439_0048007
776 Ga0439453_0121173
777 Ga0439466_0045731
778 Ga0451791_0642688
779 Ga0451802_0610306
780 Ga0451807_2058517
781 Ga0451837_0679658
782 Ga0451841_0992308
783 Ga0451843_1332349
784 Ga0451855_1924627
785 Ga0451853_1771758
786 Ga0451853_2515503
787 Ga0451853_2542224
788 Ga0451853_3438644
789 Ga0439431_0092509
790 Ga0439433_0000822
791 Ga0439442_019996
792 Ga0439448_0090126
793 Ga0439449_0026380
794 Ga0439449_0115250
795 Ga0439450_003844
796 Ga0439450_026791
797 Ga0439454_023521
798 Ga0439455_0003535
799 Ga0439455_0036570
800 Ga0439457_000074
801 Ga0439457_000457
802 Ga0439462_0019140
803 Ga0439462_0041979
804 Ga0450894_000102
805 Ga0450896_000974
806 Ga0450898_001627
807 Ga0450899_000098
808 Ga0450900_008169
809 Ga0450900_012990
810 Ga0450903_000064
811 Ga0450903_057366
812 Ga0450906_001062
813 Ga0450907_055693
814 Ga0439458_0001014
815 Ga0439459_0074234
816 Ga0466969_0029587
817 Ga0466972_0004247
818 Ga0466972_0026571
819 Ga0466972_0096982
820 Ga0466972_0389650
821 Ga0466965_0008408
822 Ga0466965_0030139
823 Ga0466965_0089033
824 Ga0466965_0185838
825 Ga0466966_0003602
826 Ga0466966_0006216
827 Ga0466966_0080203
828 Ga0466961_0001173
829 Ga0466961_0014077
830 Ga0466961_0014443
831 Ga0466961_0070851
832 Ga0466961_0227915
833 Ga0466963_0002051
834 Ga0466963_0160482
835 Ga0466963_0227936
836 Ga0466964_0041744
837 Ga0466971_0000496
838 Ga0466971_0029346
839 Ga0466971_0031109
840 Ga0466968_0152762
841 Ga0466968_0339960
842 Ga0466970_0000648
843 Ga0466970_0034807
844 Ga0466970_0326436
845 Ga0466970_0471122
846 Ga0466970_0614386
847 Ga0466957_0000456
848 Ga0466957_0031247
849 Ga0466957_0679847
850 Ga0466960_0006140
851 Ga0466960_0490117
852 Ga0466960_0567240
853 Ga0466959_0024756
854 Ga0466959_0072186
855 Ga0466959_0400989
856 Ga0466959_0951405
857 Ga0466958_0000159
858 Ga0466958_0529088
859 Ga0466967_0007231
860 Ga0466967_0030621
861 Ga0466967_0184311
862 Ga0466967_0667369
863 Ga0495617_004540
864 Ga0495617_189105
865 Ga0495627_069030
866 Ga0495592_0012206
867 Ga0495592_0347664
868 Ga0495603_0002324
869 Ga0495603_0003743
870 Ga0495603_0005800
871 Ga0495603_0017303
872 Ga0495603_0362496
873 Ga0495603_0413966
874 Ga0495590_0029430
875 Ga0495629_0001256
876 Ga0495629_0011004
877 Ga0495629_0050852
878 Ga0495629_0098935
879 Ga0495629_0136521
880 Ga0495629_0173412
881 Ga0495638_0034601
882 Ga0495638_0044911
883 Ga0495638_0046164
884 Ga0495638_0306485
885 Ga0495638_0477992
886 Ga0495641_0116829
887 Ga0495651_0122599
888 Ga0495653_0216856
889 Ga0495580_0032620
890 Ga0495582_0115476
891 Ga0495582_0154222
892 Ga0495605_0001675
893 Ga0495639_0020673
894 Ga0495662_0016771
895 Ga0495662_0050565
896 Ga0495662_0166078
897 Ga0495662_0249313
898 Ga0495664_0020802
899 Ga0495664_0041296
900 Ga0495584_0150326
901 Ga0495584_0207027
902 Ga0495585_0034560
903 Ga0495585_0094377
904 Ga0495585_0142316
905 Ga0495585_0493455
906 Ga0495594_0003225
907 Ga0495594_0016542
908 Ga0495594_0088809
909 Ga0495594_0106493
910 Ga0495594_0188982
911 Ga0495596_0021213
912 Ga0495607_0040780
913 Ga0495607_0154229
914 Ga0495583_0019641
915 Ga0495583_0161704
916 Ga0495606_0001850
917 Ga0495610_0014723
918 Ga0495616_0020486
919 Ga0495618_0077602
920 Ga0495618_0107411
921 Ga0495620_0007103
922 Ga0495620_0032448
923 Ga0495620_0062141
924 Ga0495620_0249879
925 Ga0495628_0119303
926 Ga0495630_0176036
927 Ga0495630_1450340
928 Ga0495631_0038599
929 Ga0495631_0442990
930 Ga0495632_0081864
931 Ga0495632_0103939
932 Ga0495637_0077795
933 Ga0495643_0004147
934 Ga0495643_0015574
935 Ga0495643_0503425
936 Ga0495648_0030063
937 Ga0495648_0100894
938 Ga0495648_0234103
939 Ga0495666_0020838
940 Ga0495666_0187368
941 Ga0495666_0249066
942 Ga0495642_0052469
943 Ga0495652_0024094
944 Ga0495652_0455435
945 Ga0495640_0076186
946 Ga0495640_0226756
947 Ga0495640_0255460
948 Ga0495586_0055602
949 Ga0495587_0000928
950 Ga0495609_0025810
951 Ga0495597_0032737
952 Ga0495597_0103781
953 Ga0495597_0308725
954 Ga0495645_0060725
955 Ga0495645_0214482
956 Ga0495622_0002187
957 Ga0495622_0036650
958 Ga0495622_0151613
959 Ga0495622_0318686
960 Ga0495633_0028243
961 Ga0495633_0372559
962 Ga0495667_0083729
963 Ga0495667_0238747
964 Ga0495656_0023537
965 Ga0495656_0737047
966 Ga0495668_0019419
967 Ga0495634_0048612
968 Ga0495634_0064213
969 Ga0495634_0517739
970 Ga0495611_0230712
971 Ga0495625_0004464
972 Ga0495625_0427380
973 Ga0495635_0010587
974 Ga0495635_0064877
975 Ga0495635_0079566
976 Ga0495661_0043257
977 Ga0495661_0220522
978 Ga0495588_0006656
979 Ga0495588_0042845
980 Ga0495588_0048980
981 Ga0495588_0089378
982 Ga0495588_0374057
983 Ga0495657_0011786
984 Ga0495657_0031768
985 Ga0495657_0279846
986 Ga0495657_0529436
987 Ga0495599_0135430
988 Ga0495623_0011838
989 Ga0495646_0009464
990 Ga0495658_0106294
991 Ga0495613_0000533
992 Ga0495613_0083756
993 Ga0495613_0124725
994 Ga0495613_0159282
995 Ga0495613_0167104
996 Ga0495613_0315838
997 Ga0495613_0325965
998 Ga0495624_0039146
999 Ga0495624_0142365
1000 Ga0495624_0151773
1001 Ga0495670_0001523
1002 Ga0495670_0087347
1003 Ga0495670_0328312
1004 Ga0495670_0363973
1005 Ga0495671_0022075
1006 Ga0495671_0192293
1007 Ga0495671_0375660
1008 Ga0495649_0013303
1009 Ga0495649_0083679
1010 Ga0495649_0220749
1011 Ga0495649_0286015
1012 Ga0495589_0005801
1013 Ga0495589_0040571
1014 Ga0495589_0055326
1015 Ga0495589_0079733
1016 Ga0495589_0098793
1017 Ga0495589_0117801
1018 Ga0495589_0197360
1019 Ga0495589_0263940
1020 Ga0495589_0305155
1021 Ga0495600_0025230
1022 Ga0495600_0120766
1023 Ga0495600_0158520
1024 Ga0495660_0075690
1025 Ga0495660_0119508
1026 Ga0495660_0375636
1027 Ga0495581_0158019
1028 Ga0495581_0253915
1029 Ga0495581_0414851
1030 Ga0495581_0685672
1031 Ga0495581_0706653
1032 Ga0495604_0003396
1033 Ga0495604_0003582
1034 Ga0495604_0007982
1035 Ga0495604_0088694
1036 Ga0495604_0470665
1037 Ga0495636_0001739
1038 Ga0495636_0002676
1039 Ga0495636_0010777
1040 Ga0495636_0015411
1041 Ga0495636_0028177
1042 Ga0495636_0044420
1043 Ga0495636_0054547
1044 Ga0495636_0301725
1045 Ga0495636_0648555
1046 Ga0495674_0146353
1047 Ga0495674_0179925
1048 Ga0495676_0004789
1049 Ga0495676_0009563
1050 Ga0495676_0028130
1051 Ga0495676_0089845
1052 Ga0495676_0402079
1053 Ga0495676_0755358
1054 Ga0495676_0785828
1055 Ga0495680_0027030
1056 Ga0495680_0435319
1057 Ga0495683_0110329
1058 Ga0495687_004656
1059 Ga0495687_048529
1060 Ga0495687_058865
1061 Ga0495687_069504
1062 Ga0495687_085140
1063 Ga0495687_092784
1064 Ga0495687_120958
1065 Ga0495675_0002803
1066 Ga0495675_0009082
1067 Ga0495675_0067171
1068 Ga0495677_0116208
1069 Ga0495685_000208
1070 Ga0495685_008408
1071 Ga0495685_022706
1072 Ga0495685_024224
1073 Ga0495685_041619
1074 Ga0495685_097718
1075 Ga0495685_166977
1076 Ga0495673_0094165
1077 Ga0495681_0005276
1078 Ga0495681_0007099
1079 Ga0495681_0064733
1080 Ga0495684_0183114
1081 Ga0495686_0050640
1082 Ga0495686_0074172
1083 Ga0495686_0083017
1084 Ga0495686_0384265
1085 Ga0495593_0004563
1086 Ga0495593_0063271
1087 Ga0495593_0177675
1088 Ga0495593_0447123
1089 Ga0495602_0106542
1090 Ga0495614_0010523
1091 Ga0495614_0027544
1092 Ga0495614_0031986
1093 Ga0495614_0127717
1094 Ga0495614_0184845
1095 Ga0495614_0574484
1096 Ga0495626_0006904
1097 Ga0496100_0591866
1098 Ga0496108_0040588
1099 Ga0496111_0198440
1100 Ga0496112_0754219
1101 Ga0496113_0151168
1102 Ga0496123_0326356
1103 Ga0495678_036544
1104 Ga0495682_0209275
1105 Ga0501318_051232
1106 Ga0501031_0000642
1107 Ga0501031_0049075
1108 Ga0501031_0120228
1109 Ga0501031_0122324
1110 Ga0501032_0002633
1111 Ga0501032_0038747
1112 Ga0501032_0073353
1113 Ga0501033_0009561
1114 Ga0501033_0023996
1115 Ga0501033_0027307
1116 Ga0501033_0140135
1117 Ga0501033_0222107
1118 Ga0501033_0578068
1119 Ga0501034_0019611
1120 Ga0501034_0066348
1121 Ga0501034_0080140
1122 Ga0501034_0088873
1123 Ga0501036_0000809
1124 Ga0501036_0001287
1125 Ga0501036_0083066
1126 Ga0501036_0163344
1127 Ga0501037_0000644
1128 Ga0501037_0117290
1129 Ga0501037_0643319
1130 Ga0501038_0004611
1131 Ga0501038_0006060
1132 Ga0501038_0159507
1133 Ga0501038_0720215
1134 Ga0501038_0883587
1135 Ga0501039_0004334
1136 Ga0501039_0005182
1137 Ga0501039_0091611
1138 Ga0501040_0032634
1139 Ga0501041_0005422
1140 Ga0501042_0048132
1141 Ga0501043_0003346
1142 Ga0501043_0028514
1143 Ga0501043_0070442
1144 Ga0501043_0099605
1145 Ga0501043_0340414
1146 Ga0501043_0620360
1147 Ga0501046_0003711
1148 Ga0501046_0253614
1149 Ga0501046_0431897
1150 Ga0501046_1083667
1151 Ga0501047_0001101
1152 Ga0501047_0067630
1153 Ga0501047_0073599
1154 Ga0501047_0081135
1155 Ga0501047_0185640
1156 Ga0501047_0304535
1157 Ga0501047_0542547
1158 Ga0501047_0689714
1159 Ga0501048_0080241
1160 Ga0501048_0256199
1161 Ga0501048_0280123
1162 Ga0501048_0438830
1163 Ga0501048_1302746
1164 Ga0501067_0001967
1165 Ga0501068_0000363
1166 Ga0501069_0123276
1167 Ga0501069_0139489
1168 Ga0501070_0006770
1169 Ga0501070_0086837
1170 Ga0501070_0644694
1171 Ga0501070_0984647
1172 Ga0501071_0000362
1173 Ga0501072_0000272
1174 Ga0501073_0006685
1175 Ga0501074_0103273
1176 Ga0501074_0194799
1177 Ga0501074_0324785
1178 Ga0501076_0010815
1179 Ga0501077_0077029
1180 Ga0501217_101544
1181 Ga0501235_244648
1182 Ga0501250_015622
1183 Ga0501257_072274
1184 Ga0501079_0012287
1185 Ga0501080_0005642
1186 Ga0501080_0133471
1187 Ga0501080_1077966
1188 Ga0501083_0000911
1189 Ga0501035_0003482
1190 Ga0501035_0006265
1191 Ga0501035_0037335
1192 Ga0501035_0038700
1193 Ga0501035_0045387
1194 Ga0501035_0065944
1195 Ga0501035_0145896
1196 Ga0501035_0397855
1197 Ga0501035_1463329
1198 Ga0501044_0004754
1199 Ga0501044_0054536
1200 Ga0501044_0071477
1201 Ga0501044_0082247
1202 Ga0501044_0181328
1203 Ga0501044_0193474
1204 Ga0501044_0220424
1205 Ga0501044_0322583
1206 Ga0501045_1044937
1207 nmdc:mga03n38_1940_c1
1208 nmdc:mga03n38_266294_c1
1209 nmdc:mga0yw44_34212_c1
1210 nmdc:mga06z11_2921_c1
1211 nmdc:mga04h51_83672_c1
1212 nmdc:mga07m45_72496_c1
1213 Ga0495655_0161985
1214 Ga0495619_0094610
1215 Ga0500578_0042979
1216 Ga0500578_0173119
1217 Ga0500644_0011660
1218 Ga0500646_0123440
1219 Ga0500651_0401665
1220 Ga0500566_0019750
1221 Ga0500566_0256172
1222 Ga0500640_070011
1223 Ga0500641_0046110
1224 Ga0500660_025707
1225 Ga0500553_081174
1226 Ga0500558_054162
1227 Ga0500560_002857
1228 Ga0500560_012121
1229 Ga0500569_001534
1230 Ga0500608_143837
1231 Ga0500614_098957
1232 Ga0500621_052594
1233 Ga0500628_001867
1234 Ga0500652_000767
1235 Ga0500652_246404
1236 Ga0500658_0003671
1237 Ga0500561_0007086
1238 Ga0500573_0214844
1239 Ga0500600_0015344
1240 Ga0500600_0194719
1241 Ga0500600_0252967
1242 Ga0500600_0326764
1243 Ga0500603_197140
1244 Ga0500627_0274230
1245 Ga0500633_0012738
1246 Ga0500634_0008375
1247 Ga0500636_0472257
1248 Ga0500656_001183
1249 Ga0501084_0001078
1250 Ga0501082_0001405
1251 Ga0466962_0002034
1252 Ga0466962_0036159
1253 Ga0466962_0178727
1254 Ga0466962_0193144
1255 Ga0530510_0018015
1256 2547406846
1257 2554258575
1258 2585301913
1259 2585304827
1260 2585319459
1261 2616700741
1262 2643759764
1263 2643897889
1264 2643944675
1265 2644269264
1266 2644385398
1267 2644409034
1268 2644431573
1269 2644436392
1270 2644462817
1271 2644625756
1272 2784587873
1273 2785368596
1274 2786669700
1275 2793976142
1276 2808841280
1277 2808919788
1278 2809231460
1279 2812358978
1280 2812481225
1281 2819693666
1282 2852642218
1283 2862184891
1284 2862288141
1285 2862392578
1286 2862509496
1287 2862579995
1288 2863405526
1289 2867371102
1290 2867431087
1291 2867479674
1292 2873156555
1293 2875393800
1294 2877681932
1295 2912720900
1296 2912725013
1297 2912759935
1298 2918503829
1299 2919468680
1300 2946050853
1301 2946066899
1302 2946075227
1303 2947230335
1304 2954003646
1305 2954387055
1306 2954676108
1307 2954697891
1308 2954704325
1309 2954717002
1310 2954726953
1311 2954734844
1312 2954745874
1313 2954753716
1314 2954764847
1315 2990093394
1316 2997456555
1317 3006399648
1318 3006427307
1319 3006488641
1320 3006501779
1321 8008559547
1322 8008579605
1323 8023629278
1324 8025419326
1325 8025480691
1326 8025536990
1327 8047898943
1328 8048127694
1329 8048359976
1330 8048375901
1331 8048382306
1332 8056452412
1333 8056673169
1334 8056833912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14017

DUF4233

Protein of unknown function (DUF4233)

1

103

0.92

Map