F473829

General Info

Members Datasets Scaffolds Average Seq Length
667 479 1334 324

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100004713|Ga0068860_10000471319
Length 393
Sequence MPGADGPAKNFCTGSVLGIVATAIGYQEIPYFAAIRRALVSSALSRSRQRPARRRSEIWYVVQITLNARDIGMTKGALAILVHGGTDNWSPGRWQARFDDVCRDRRVIVLPDPKAEPADVHYAAVWKPAPGELAAFPNLRVIFNLGAGVDALMADRSLPQVPLVRVAVDDLTGRMTGYVVLHVLMHHRQELYLRQSQRDRRWQPRSQWAAAAISVGIMGLGTLGANAADVLSRIGFRVSGWSRTPRQVNGVTSFHGAAQLDAFLGGADILVCLLPLTSDTQHILDRDLFRKLNRTSPLGAPVLINAGRGGLQNEADILACLDDGTLGAASLDVFAQEPLPLDSPFWTHPKVVLTPHNAADTDPDAISRYVADQIARFEAGGVLENVVDRNRGY

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
75 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
76 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
77 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
119 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
120 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
121 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
264 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
265 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
266 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
267 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
268 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
269 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
274 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
275 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
276 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
277 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
278 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
281 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
282 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
283 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
284 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
285 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
286 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
287 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
288 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
289 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
290 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
291 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
292 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
293 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
294 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
295 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
296 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
297 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
298 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
299 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
300 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
301 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
302 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
303 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
304 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
305 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
306 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
307 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
308 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
309 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
310 2791355199
311 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
312 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
313 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
314 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
315 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
316 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
317 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
318 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
319 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
320 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
321 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
322 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
323 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
324 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
325 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
326 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
327 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
328 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
329 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
330 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
331 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
332 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
333 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
334 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
335 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
336 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
337 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
338 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
339 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
340 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
341 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
342 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
343 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
344 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
345 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
346 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
347 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
348 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
349 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
350 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
351 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
352 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
353 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
354 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
355 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
356 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
357 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
358 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
359 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
360 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
361 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
362 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
363 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
364 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
365 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
366 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
367 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
368 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
369 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
370 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
371 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
372 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
373 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
374 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
375 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
376 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
377 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
378 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
379 2922368715
380 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
381 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
382 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
383 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
384 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
385 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
386 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
387 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
388 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
389 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
390 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
391 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
392 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
393 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
394 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
395 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
396 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
397 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
398 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
399 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
400 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
401 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
402 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
403 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
404 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
405 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
406 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
407 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
408 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
409 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
410 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
411 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
412 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
413 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
414 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
415 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
416 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
417 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
418 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
419 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
420 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
421 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
422 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
423 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
424 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
425 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
426 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
427 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
428 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
429 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
430 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
431 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
432 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
433 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
434 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
435 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
436 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
437 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
438 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
439 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
440 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
441 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
442 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
443 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
444 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
445 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
446 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
447 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
448 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
449 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
450 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
451 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
452 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
453 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
454 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
455 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
456 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
457 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
458 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
459 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
460 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
461 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
462 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
463 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
464 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
465 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
466 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
467 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
468 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
469 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
470 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
471 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
472 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
473 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
474 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
475 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
476 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
477 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
478 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
479 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.98
Metatranscriptomes 0
Isolates 29.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.94
Nodule 23.84
Rhizoplane 3.15
Rhizosphere 46.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100004713 3300005843 Bacteria 13912
2 JGI25153J46596_10002355 3300003215 Bacteria 10944
3 JGI25153J46596_10002507 3300003215 Bacteria 10538
4 JGI25153J46596_10002543 3300003215 Bacteria 10454
5 JGI25153J46596_10011315 3300003215 Bacteria 3951
6 rootH1_10043864 3300003323 Bacteria 2797
7 JGI25160J50197_1001353 3300003354 Bacteria 12340
8 JGI25160J50197_1001493 3300003354 Bacteria 11619
9 Ga0055542_1010939 3300003762 Bacteria 1634
10 Ga0055529_1005512 3300003763 Bacteria 1822
11 Ga0055531_10001939 3300003794 Bacteria 14453
12 Ga0055543_1008827 3300004625 Bacteria 2205
13 Ga0065165_1001416 3300005262 Bacteria 26111
14 Ga0065165_1001641 3300005262 Bacteria 22770
15 Ga0070683_100320783 3300005329 Bacteria 1474
16 Ga0068869_100065632 3300005334 Bacteria 2672
17 Ga0070680_100374605 3300005336 Bacteria 1212
18 Ga0070668_100026228 3300005347 Bacteria 4420
19 Ga0070668_100034508 3300005347 Bacteria 3855
20 Ga0070671_100080856 3300005355 Bacteria 2717
21 Ga0070671_100218583 3300005355 Bacteria 1617
22 Ga0070674_100175504 3300005356 Bacteria 1637
23 Ga0070673_100130635 3300005364 Bacteria 2107
24 Ga0070667_100020165 3300005367 Bacteria 5535
25 Ga0070667_100050250 3300005367 Bacteria 3513
26 Ga0070667_100149474 3300005367 Bacteria 2051
27 Ga0070709_10001211 3300005434 Bacteria 14149
28 Ga0070709_10006354 3300005434 Bacteria 6434
29 Ga0070714_100013779 3300005435 Bacteria 6482
30 Ga0070713_100271344 3300005436 Bacteria 1553
31 Ga0070710_10003695 3300005437 Bacteria 7235
32 Ga0070710_10005274 3300005437 Bacteria 6128
33 Ga0070711_100006816 3300005439 Bacteria 6917
34 Ga0070711_100084054 3300005439 Bacteria 2276
35 Ga0070700_100283729 3300005441 Bacteria 1202
36 Ga0070663_100063028 3300005455 Bacteria 2675
37 Ga0070663_100083967 3300005455 Bacteria 2346
38 Ga0070663_100357757 3300005455 Bacteria 1183
39 Ga0070662_100056485 3300005457 Bacteria 2850
40 Ga0070662_100093087 3300005457 Bacteria 2267
41 Ga0070681_10025372 3300005458 Bacteria 5962
42 Ga0070681_10279945 3300005458 Bacteria 1579
43 Ga0070706_100140483 3300005467 Bacteria 2255
44 Ga0070707_100110085 3300005468 Bacteria 2671
45 Ga0070679_100206784 3300005530 Bacteria 1927
46 Ga0070693_100048089 3300005547 Bacteria 2428
47 Ga0070665_100016387 3300005548 Bacteria 7432
48 Ga0070665_100042336 3300005548 Bacteria 4577
49 Ga0070665_100070614 3300005548 Bacteria 3499
50 Ga0070665_100261832 3300005548 Bacteria 1731
51 Ga0068855_100083277 3300005563 Bacteria 3706
52 Ga0068855_100230219 3300005563 Bacteria 2075
53 Ga0070664_100602078 3300005564 Bacteria 1019
54 Ga0068854_100040688 3300005578 Bacteria 3281
55 Ga0068856_100000055 3300005614 Bacteria 104152
56 Ga0068856_100091030 3300005614 Bacteria 3035
57 Ga0068852_100065867 3300005616 Bacteria 3162
58 Ga0068852_100099742 3300005616 Bacteria 2618
59 Ga0068859_100247773 3300005617 Bacteria 1871
60 Ga0068864_100085444 3300005618 Bacteria 2774
61 Ga0068864_100231334 3300005618 Bacteria 1709
62 Ga0068851_10074574 3300005834 Bacteria 1761
63 Ga0068863_100190908 3300005841 Bacteria 1968
64 Ga0068858_100022658 3300005842 Bacteria 5858
65 Ga0068858_100152500 3300005842 Bacteria 2173
66 Ga0068862_100096895 3300005844 Bacteria 2575
67 Ga0081455_10024620 3300005937 Bacteria 5569
68 Ga0081455_10120311 3300005937 Bacteria 2070
69 Ga0081540_1013865 3300005983 Bacteria 5210
70 Ga0081540_1018786 3300005983 Bacteria 4226
71 Ga0081539_10000848 3300005985 Bacteria 58499
72 Ga0081539_10028283 3300005985 Bacteria 3528
73 Ga0081539_10055657 3300005985 Bacteria 2199
74 Ga0075365_10020149 3300006038 Bacteria 4130
75 Ga0075365_10026633 3300006038 Bacteria 3672
76 Ga0075365_10242640 3300006038 Bacteria 1265
77 Ga0075368_10013120 3300006042 Bacteria 3040
78 Ga0075368_10051595 3300006042 Bacteria 1635
79 Ga0075363_100006217 3300006048 Bacteria 5400
80 Ga0075363_100007607 3300006048 Bacteria 4991
81 Ga0070715_10141567 3300006163 Bacteria 1169
82 Ga0070712_100161663 3300006175 Bacteria 1730
83 Ga0075362_10149692 3300006177 Bacteria 1119
84 Ga0075367_10011526 3300006178 Bacteria 4682
85 Ga0075367_10178608 3300006178 Bacteria 1323
86 Ga0075369_10011150 3300006186 Bacteria 3529
87 Ga0075369_10159890 3300006186 Bacteria 1032
88 Ga0075366_10020048 3300006195 Bacteria 3877
89 Ga0075370_10007551 3300006353 Bacteria 5543
90 Ga0075428_100184050 3300006844 Bacteria 2260
91 Ga0097620_100247769 3300006931 Bacteria 1871
92 Ga0099824_1012218 3300006942 Bacteria 9445
93 Ga0099794_10071794 3300007265 Bacteria 1696
94 Ga0105240_10003773 3300009093 Bacteria 23404
95 Ga0105247_10048581 3300009101 Bacteria 2606
96 Ga0105241_10097672 3300009174 Bacteria 2329
97 Ga0105237_10003690 3300009545 Bacteria 18050
98 Ga0105237_10139389 3300009545 Bacteria 2419
99 Ga0105237_10220167 3300009545 Bacteria 1898
100 Ga0105237_10236525 3300009545 Bacteria 1828
101 Ga0105238_10113763 3300009551 Bacteria 2686
102 Ga0105239_10119188 3300010375 Bacteria 2929
103 Ga0105239_10149845 3300010375 Bacteria 2603
104 Ga0105239_10183160 3300010375 Bacteria 2343
105 Ga0105239_10201714 3300010375 Bacteria 2229
106 Ga0105246_10069586 3300011119 Bacteria 2472
107 Ga0157369_10017917 3300013105 Bacteria 7950
108 Ga0157369_10079251 3300013105 Bacteria 3518
109 Ga0157374_10096723 3300013296 Bacteria 2824
110 Ga0157378_10333716 3300013297 Bacteria 1476
111 Ga0163162_10299816 3300013306 Bacteria 1739
112 Ga0157375_10181853 3300013308 Bacteria 2254
113 Ga0157375_10481210 3300013308 Bacteria 1406
114 Ga0163163_10186148 3300014325 Bacteria 2124
115 Ga0163161_10129794 3300017792 Bacteria 1900
116 Ga0214544_1000005 3300021320 Bacteria 387675
117 Ga0214542_1000004 3300021321 Bacteria 415597
118 Ga0214542_1028796 3300021321 Bacteria 2352
119 Ga0214545_1000005 3300021324 Bacteria 415590
120 Ga0214545_1030102 3300021324 Bacteria 2352
121 Ga0214543_1000111 3300021327 Bacteria 106517
122 Ga0214543_1029464 3300021327 Bacteria 2448
123 Ga0209677_101932 3300025253 Bacteria 8283
124 Ga0209677_103281 3300025253 Bacteria 5366
125 Ga0209148_1000235 3300025254 Bacteria 90398
126 Ga0209455_1000637 3300025272 Bacteria 21523
127 Ga0209455_1001771 3300025272 Bacteria 9150
128 Ga0209455_1002109 3300025272 Bacteria 7927
129 Ga0209564_1009581 3300025295 Bacteria 4586
130 Ga0209564_1014705 3300025295 Bacteria 3234
131 Ga0209758_1000102 3300025297 Bacteria 224851
132 Ga0209758_1000680 3300025297 Bacteria 50663
133 Ga0209758_1001707 3300025297 Bacteria 24626
134 Ga0209758_1003592 3300025297 Bacteria 13874
135 Ga0209758_1003725 3300025297 Bacteria 13511
136 Ga0209758_1015828 3300025297 Bacteria 3875
137 Ga0207426_1000532 3300025302 Bacteria 54755
138 Ga0207426_1002013 3300025302 Bacteria 14342
139 Ga0207426_1018846 3300025302 Bacteria 2424
140 Ga0209051_1038755 3300025303 Bacteria 1730
141 Ga0209257_1003378 3300025304 Bacteria 13780
142 Ga0209257_1031771 3300025304 Bacteria 1684
143 Ga0207656_10136434 3300025321 Bacteria 1153
144 Ga0207692_10001892 3300025898 Bacteria 7957
145 Ga0207642_10070289 3300025899 Bacteria 1663
146 Ga0207699_10000886 3300025906 Bacteria 14295
147 Ga0207684_10101712 3300025910 Bacteria 2457
148 Ga0207654_10092322 3300025911 Bacteria 1848
149 Ga0207707_10009506 3300025912 Bacteria 8434
150 Ga0207707_10182391 3300025912 Bacteria 1832
151 Ga0207695_10000006 3300025913 Bacteria 1135309
152 Ga0207671_10060576 3300025914 Bacteria 2808
153 Ga0207693_10044029 3300025915 Bacteria 3508
154 Ga0207693_10064641 3300025915 Bacteria 2866
155 Ga0207663_10002659 3300025916 Bacteria 8602
156 Ga0207663_10012467 3300025916 Bacteria 4597
157 Ga0207660_10008941 3300025917 Bacteria 6481
158 Ga0207662_10087323 3300025918 Bacteria 1913
159 Ga0207646_10219393 3300025922 Bacteria 1718
160 Ga0207664_10008367 3300025929 Bacteria 7210
161 Ga0207644_10209519 3300025931 Bacteria 1540
162 Ga0207706_10120081 3300025933 Bacteria 2311
163 Ga0207670_10120738 3300025936 Bacteria 1904
164 Ga0207669_10471311 3300025937 Bacteria 999
165 Ga0207691_10028828 3300025940 Bacteria 5195
166 Ga0207711_10033289 3300025941 Bacteria 4359
167 Ga0207689_10049052 3300025942 Bacteria 3484
168 Ga0207661_10000421 3300025944 Bacteria 27342
169 Ga0207667_10249798 3300025949 Bacteria 1814
170 Ga0207667_10360576 3300025949 Bacteria 1482
171 Ga0207712_10074794 3300025961 Bacteria 2447
172 Ga0207668_10036096 3300025972 Bacteria 3297
173 Ga0207668_10058728 3300025972 Bacteria 2690
174 Ga0207703_10049448 3300026035 Bacteria 3399
175 Ga0207703_10126206 3300026035 Bacteria 2203
176 Ga0207639_10041265 3300026041 Bacteria 3451
177 Ga0207678_10120465 3300026067 Bacteria 2239
178 Ga0207678_10314595 3300026067 Bacteria 1346
179 Ga0207674_10156810 3300026116 Bacteria 2231
180 Ga0207675_100200501 3300026118 Bacteria 1916
181 Ga0207698_10057629 3300026142 Bacteria 3007
182 Ga0209389_1000021 3300027296 Bacteria 169506
183 Ga0209389_1000120 3300027296 Bacteria 70535
184 Ga0209589_1000027 3300027357 Bacteria 155295
185 Ga0209489_100023 3300027361 Bacteria 198829
186 Ga0209489_100742 3300027361 Bacteria 64218
187 Ga0209700_100134 3300027363 Bacteria 112846
188 Ga0268266_10008198 3300028379 Bacteria 9315
189 Ga0268266_10047778 3300028379 Bacteria 3667
190 Ga0268266_10075957 3300028379 Bacteria 2919
191 Ga0268266_10123409 3300028379 Bacteria 2307
192 Ga0268265_10225732 3300028380 Bacteria 1642
193 Ga0268264_10000185 3300028381 Bacteria 131374
194 Ga0268264_10292777 3300028381 Bacteria 1529
195 Ga0265334_10011660 3300028573 Bacteria 3696
196 Ga0265330_10050538 3300031235 Bacteria 1824
197 Ga0265340_10011584 3300031247 Bacteria 4682
198 Ga0265340_10032355 3300031247 Bacteria 2611
199 Ga0265339_10000906 3300031249 Bacteria 22779
200 Ga0307513_10058753 3300031456 Bacteria 4085
201 Ga0307408_100305308 3300031548 Bacteria 1335
202 Ga0307508_10000012 3300031616 Bacteria 243167
203 Ga0307508_10074867 3300031616 Bacteria 2963
204 Ga0307508_10092857 3300031616 Bacteria 2607
205 Ga0307516_10049306 3300031730 Bacteria 4139
206 Ga0307406_10124021 3300031901 Bacteria 1801
207 Ga0307416_100175588 3300032002 Bacteria 2001
208 Ga0307507_10042841 3300033179 Bacteria 4501
209 Ga0307510_10006841 3300033180 Bacteria 13602
210 Ga0373944_0018390 3300035089 Bacteria 1995
211 Ga0373923_0030181 3300035111 Bacteria 2179
212 Ga0373923_0072522 3300035111 Bacteria 1481
213 Ga0373936_0035034 3300035113 Bacteria 1997
214 Ga0373945_0053810 3300035116 Bacteria 1487
215 Ga0373954_0037980 3300035118 Bacteria 2238
216 Ga0373943_0073363 3300035170 Bacteria 1738
217 Ga0373955_0009517 3300035172 Bacteria 4555
218 Ga0373955_0031351 3300035172 Bacteria 2784
219 Ga0373924_0081651 3300035410 Bacteria 1375
220 Ga0373931_0071623 3300035691 Bacteria 1894
221 Ga0373935_0271487 3300035692 Bacteria 1192
222 Ga0373927_0000046 3300035695 Bacteria 88401
223 Ga0373927_0028404 3300035695 Bacteria 3648
224 Ga0373927_0127254 3300035695 Bacteria 1663
225 Ga0373933_0000026 3300035724 Bacteria 90309
226 Ga0373933_0046386 3300035724 Bacteria 2580
227 Ga0373933_0128762 3300035724 Bacteria 1590
228 Ga0373947_0001358 3300035725 Bacteria 15022
229 Ga0373947_0123090 3300035725 Bacteria 1649
230 Ga0373947_0154278 3300035725 Bacteria 1481
231 Ga0373937_0022976 3300036401 Bacteria 5608
232 Ga0373937_0068689 3300036401 Bacteria 3267
233 Ga0373937_0312461 3300036401 Bacteria 1486
234 Ga0373925_0003408 3300037068 Bacteria 12318
235 Ga0373925_0056484 3300037068 Bacteria 2940
236 Ga0373925_0166194 3300037068 Bacteria 1740
237 Ga0373925_0286425 3300037068 Bacteria 1328
238 Ga0395900_0438362 3300037418 Bacteria 1264
239 Ga0395898_0030023 3300037466 Bacteria 5442
240 Ga0395905_0075384 3300037471 Bacteria 3162
241 Ga0395905_0187642 3300037471 Bacteria 1940
242 Ga0395905_0282849 3300037471 Bacteria 1545
243 Ga0395901_0273061 3300038443 Bacteria 1758
244 Ga0436365_0921625 3300039437 Bacteria 24575
245 Ga0436365_1495385 3300039437 Bacteria 1402
246 Ga0436360_1263560 3300039438 Bacteria 6127
247 Ga0436363_0219045 3300039450 Bacteria 3887
248 Ga0436362_0291545 3300039453 Bacteria 1410
249 Ga0466972_0000126 3300044658 Bacteria 64766
250 Ga0466965_0020348 3300044683 Bacteria 3189
251 Ga0466966_0001157 3300044684 Bacteria 16957
252 Ga0466961_0000025 3300044693 Bacteria 96344
253 Ga0466968_0003979 3300044735 Bacteria 5488
254 Ga0466957_0038450 3300044842 Bacteria 2883
255 Ga0466960_0000429 3300044901 Bacteria 14361
256 Ga0466959_0000873 3300045049 Bacteria 17751
257 Ga0466967_0033543 3300045976 Bacteria 4347
258 Ga0466967_0426979 3300045976 Bacteria 1292
259 Ga0495592_0024044 3300046454 Bacteria 4633
260 Ga0495592_0068619 3300046454 Bacteria 2588
261 Ga0495592_0074869 3300046454 Bacteria 2459
262 Ga0495592_0195808 3300046454 Bacteria 1367
263 Ga0495603_0000051 3300046455 Bacteria 50402
264 Ga0495629_0000182 3300046459 Bacteria 56655
265 Ga0495629_0000750 3300046459 Bacteria 26239
266 Ga0495638_0005672 3300046460 Bacteria 9198
267 Ga0495641_0006785 3300046461 Bacteria 7338
268 Ga0495651_0014936 3300046462 Bacteria 6004
269 Ga0495651_0034385 3300046462 Bacteria 3949
270 Ga0495651_0060141 3300046462 Bacteria 2911
271 Ga0495653_0024767 3300046463 Bacteria 4830
272 Ga0495580_0089943 3300046472 Bacteria 2137
273 Ga0495582_0000137 3300046473 Bacteria 39425
274 Ga0495582_0060422 3300046473 Bacteria 2091
275 Ga0495639_0000047 3300046475 Bacteria 53940
276 Ga0495639_0050379 3300046475 Bacteria 1891
277 Ga0495662_0001496 3300046476 Bacteria 11578
278 Ga0495664_0001335 3300046477 Bacteria 12989
279 Ga0495664_0025566 3300046477 Bacteria 3438
280 Ga0495664_0145777 3300046477 Bacteria 1436
281 Ga0495585_0068438 3300046492 Bacteria 1940
282 Ga0495594_0000640 3300046499 Bacteria 18027
283 Ga0495606_0166027 3300046507 Bacteria 1284
284 Ga0495608_0008203 3300046511 Bacteria 7333
285 Ga0495608_0097274 3300046511 Bacteria 1900
286 Ga0495618_0032958 3300046514 Bacteria 3247
287 Ga0495628_0023677 3300046516 Bacteria 5037
288 Ga0495628_0052977 3300046516 Bacteria 3204
289 Ga0495630_0166713 3300046517 Bacteria 1677
290 Ga0495643_0014222 3300046522 Bacteria 4738
291 Ga0495643_0070139 3300046522 Bacteria 1841
292 Ga0495644_0033685 3300046523 Bacteria 1935
293 Ga0495648_0001119 3300046524 Bacteria 27174
294 Ga0495648_0025504 3300046524 Bacteria 4000
295 Ga0495666_0067117 3300046526 Bacteria 1709
296 Ga0495652_0001819 3300046529 Bacteria 22664
297 Ga0495652_0047572 3300046529 Bacteria 3678
298 Ga0495652_0076789 3300046529 Bacteria 2770
299 Ga0495652_0079273 3300046529 Bacteria 2716
300 Ga0495652_0118872 3300046529 Bacteria 2111
301 Ga0495665_0011658 3300046531 Bacteria 4763
302 Ga0495665_0032951 3300046531 Bacteria 2771
303 Ga0495640_0008467 3300046533 Bacteria 8065
304 Ga0495640_0032573 3300046533 Bacteria 3712
305 Ga0495640_0118109 3300046533 Bacteria 1726
306 Ga0495587_0022189 3300046536 Bacteria 3910
307 Ga0495597_0031761 3300046542 Bacteria 2400
308 Ga0495645_0006200 3300046543 Bacteria 8278
309 Ga0495645_0008457 3300046543 Bacteria 7189
310 Ga0495622_0013217 3300046557 Bacteria 3831
311 Ga0495622_0046791 3300046557 Bacteria 2010
312 Ga0495667_0022972 3300046559 Bacteria 4202
313 Ga0495667_0035514 3300046559 Bacteria 3331
314 Ga0495656_0049453 3300046615 Bacteria 1791
315 Ga0495668_0048244 3300046616 Bacteria 2363
316 Ga0495634_0002221 3300046642 Bacteria 16276
317 Ga0495634_0019049 3300046642 Bacteria 4879
318 Ga0495611_0030668 3300046648 Bacteria 2366
319 Ga0495611_0046878 3300046648 Bacteria 1939
320 Ga0495625_0044717 3300046660 Bacteria 3204
321 Ga0495635_0002383 3300046663 Bacteria 12797
322 Ga0495635_0029135 3300046663 Bacteria 3838
323 Ga0495635_0079666 3300046663 Bacteria 2242
324 Ga0495588_0002510 3300046674 Bacteria 7856
325 Ga0495588_0110337 3300046674 Bacteria 1449
326 Ga0495657_0006427 3300046675 Bacteria 9197
327 Ga0495657_0014633 3300046675 Bacteria 5758
328 Ga0495599_0167421 3300046678 Bacteria 1357
329 Ga0495646_0024640 3300046680 Bacteria 3788
330 Ga0495647_0000577 3300046681 Bacteria 10837
331 Ga0495658_0001786 3300046683 Bacteria 11096
332 Ga0495669_0001766 3300046684 Bacteria 8833
333 Ga0495669_0053205 3300046684 Bacteria 1820
334 Ga0495613_0036213 3300046689 Bacteria 3659
335 Ga0495613_0073604 3300046689 Bacteria 2489
336 Ga0495613_0131922 3300046689 Bacteria 1789
337 Ga0495624_0000898 3300046690 Bacteria 23624
338 Ga0495624_0079451 3300046690 Bacteria 2034
339 Ga0495600_0006983 3300046809 Bacteria 6891
340 Ga0495600_0087336 3300046809 Bacteria 2035
341 Ga0495600_0227529 3300046809 Bacteria 1191
342 Ga0495581_0001056 3300047315 Bacteria 14926
343 Ga0495604_0013184 3300047317 Bacteria 6581
344 Ga0495604_0036914 3300047317 Bacteria 3850
345 Ga0495604_0070106 3300047317 Bacteria 2655
346 Ga0495674_0014874 3300047319 Bacteria 7279
347 Ga0495674_0043713 3300047319 Bacteria 3986
348 Ga0495676_0093833 3300047321 Bacteria 2237
349 Ga0495676_0113955 3300047321 Bacteria 1979
350 Ga0495676_0275910 3300047321 Bacteria 1139
351 Ga0495676_0312045 3300047321 Bacteria 1058
352 Ga0495680_0000684 3300047322 Bacteria 37945
353 Ga0495680_0023096 3300047322 Bacteria 5174
354 Ga0495680_0097811 3300047322 Bacteria 2190
355 Ga0495680_0197190 3300047322 Bacteria 1446
356 Ga0495683_0032033 3300047323 Bacteria 2679
357 Ga0495687_006033 3300047443 Bacteria 7547
358 Ga0495675_0025462 3300047444 Bacteria 3772
359 Ga0495675_0058690 3300047444 Bacteria 2439
360 Ga0495675_0061182 3300047444 Bacteria 2386
361 Ga0495673_0014025 3300047469 Bacteria 4183
362 Ga0495673_0077092 3300047469 Bacteria 1389
363 Ga0495684_0000643 3300047471 Bacteria 28074
364 Ga0495684_0023316 3300047471 Bacteria 4759
365 Ga0495684_0148848 3300047471 Bacteria 1751
366 Ga0495684_0182479 3300047471 Bacteria 1555
367 Ga0495593_0002383 3300047673 Bacteria 11296
368 Ga0495593_0006202 3300047673 Bacteria 7030
369 Ga0495593_0029202 3300047673 Bacteria 3025
370 Ga0495602_0009739 3300048088 Bacteria 9983
371 Ga0495602_0101734 3300048088 Bacteria 2356
372 Ga0495602_0131497 3300048088 Bacteria 1995
373 Ga0496100_0086058 3300048903 Bacteria 2134
374 Ga0496100_0086252 3300048903 Bacteria 2132
375 Ga0496102_0084275 3300048905 Bacteria 2933
376 Ga0496102_0234256 3300048905 Bacteria 1731
377 Ga0496103_0012479 3300048906 Bacteria 5038
378 Ga0496104_0009748 3300048907 Bacteria 8562
379 Ga0496104_0187159 3300048907 Bacteria 1981
380 Ga0496105_0006291 3300048908 Bacteria 9117
381 Ga0496106_0004758 3300048909 Bacteria 10033
382 Ga0496106_0043678 3300048909 Bacteria 3363
383 Ga0496109_0041429 3300048912 Bacteria 4171
384 Ga0496109_0141147 3300048912 Bacteria 2252
385 Ga0496110_0078649 3300048913 Bacteria 2936
386 Ga0496110_0249352 3300048913 Bacteria 1616
387 Ga0496112_0008308 3300048915 Bacteria 9290
388 Ga0496112_0052641 3300048915 Bacteria 3996
389 Ga0496112_0146461 3300048915 Bacteria 2330
390 Ga0496112_0237346 3300048915 Bacteria 1777
391 Ga0496115_0104369 3300048918 Bacteria 2326
392 Ga0496115_0155201 3300048918 Bacteria 1891
393 Ga0496115_0332136 3300048918 Bacteria 1242
394 Ga0496117_0032451 3300048920 Bacteria 3967
395 Ga0496117_0059521 3300048920 Bacteria 2638
396 Ga0496118_0002570 3300048921 Bacteria 24239
397 Ga0496118_0036622 3300048921 Bacteria 3963
398 Ga0496118_0061721 3300048921 Bacteria 2773
399 Ga0496119_0043812 3300048922 Bacteria 2823
400 Ga0496120_0071612 3300048923 Bacteria 1902
401 Ga0496121_0000265 3300048924 Bacteria 109251
402 Ga0496121_0001125 3300048924 Bacteria 47001
403 Ga0496121_0011273 3300048924 Bacteria 9960
404 Ga0496121_0013326 3300048924 Bacteria 8849
405 Ga0496121_0053033 3300048924 Bacteria 3399
406 Ga0496121_0265380 3300048924 Bacteria 1183
407 Ga0496123_0102409 3300048926 Bacteria 1662
408 Ga0496124_0001146 3300048927 Bacteria 41561
409 Ga0496124_0086413 3300048927 Bacteria 2567
410 Ga0496124_0238049 3300048927 Bacteria 1356
411 Ga0496125_0014013 3300048928 Bacteria 7842
412 Ga0496125_0088010 3300048928 Bacteria 2343
413 Ga0496126_0006457 3300048929 Bacteria 13066
414 Ga0496126_0014833 3300048929 Bacteria 7861
415 Ga0496126_0036175 3300048929 Bacteria 4619
416 Ga0496126_0083371 3300048929 Bacteria 2822
417 Ga0495682_0018820 3300049460 Bacteria 2600
418 nmdc:mga03n38_46577_c1 3300050490 Bacteria 1915
419 nmdc:mga03n38_57036_c1 3300050490 Bacteria 1765
420 nmdc:mga0yw44_14998_c1 3300050492 Bacteria 4136
421 nmdc:mga0yw44_222678_c1 3300050492 Bacteria 1251
422 nmdc:mga0yw44_28367_c1 3300050492 Bacteria 3219
423 nmdc:mga0yw44_50969_c1 3300050492 Bacteria 2505
424 nmdc:mga0k408_35173_c1 3300050493 Bacteria 2872
425 nmdc:mga06z11_84116_c1 3300050494 Bacteria 1714
426 nmdc:mga07m45_12306_c1 3300050496 Bacteria 4519
427 nmdc:mga07m45_32773_c1 3300050496 Bacteria 2882
428 nmdc:mga07m45_42999_c1 3300050496 Bacteria 2533
429 nmdc:mga05p37_23088_c3 3300050507 Bacteria 2949
430 nmdc:mga0sz30_116551_c1 3300050516 Bacteria 1173
431 nmdc:mga0sz30_122578_c1 3300050516 Bacteria 1143
432 Ga0495612_0001273 3300053078 Bacteria 10398
433 Ga0500635_0010934 3300053080 Bacteria 2566
434 Ga0500635_0035313 3300053080 Bacteria 1643
435 Ga0495595_0042146 3300053084 Bacteria 2091
436 Ga0495619_0057640 3300053085 Bacteria 2577
437 Ga0495619_0075820 3300053085 Bacteria 2257
438 Ga0495619_0141494 3300053085 Bacteria 1657
439 Ga0495619_0227985 3300053085 Bacteria 1290
440 Ga0495619_0240750 3300053085 Bacteria 1254
441 Ga0500578_0100695 3300053086 Bacteria 1828
442 Ga0500643_000016 3300053087 Bacteria 309502
443 Ga0500647_0079490 3300053091 Bacteria 1573
444 Ga0500566_0000290 3300053094 Bacteria 26984
445 Ga0500566_0095986 3300053094 Bacteria 1632
446 Ga0500641_0000385 3300053096 Bacteria 16362
447 Ga0500556_0067904 3300053104 Bacteria 1327
448 Ga0500557_000011 3300053105 Bacteria 117471
449 Ga0500569_013281 3300053109 Bacteria 2013
450 Ga0500572_000533 3300053111 Bacteria 12931
451 Ga0500608_030756 3300053122 Bacteria 2545
452 Ga0500655_008342 3300053133 Bacteria 1865
453 Ga0500559_0002432 3300053136 Bacteria 9637
454 Ga0500559_0086672 3300053136 Bacteria 1429
455 Ga0500564_023121 3300053138 Bacteria 2847
456 Ga0500568_0019571 3300053139 Bacteria 2939
457 Ga0500590_015183 3300053148 Bacteria 3976
458 Ga0500603_009135 3300053150 Bacteria 2214
459 Ga0500604_0085266 3300053151 Bacteria 1026
460 Ga0500619_007535 3300053154 Bacteria 2586
461 Ga0500620_011172 3300053155 Bacteria 2397
462 Ga0500639_094248 3300053163 Bacteria 1486
463 Ga0500636_0000438 3300053177 Bacteria 22980
464 Ga0500636_0053343 3300053177 Bacteria 2373
465 Ga0500636_0174032 3300053177 Bacteria 1162
466 Ga0500637_0001926 3300053178 Bacteria 9032
467 Ga0500637_0047659 3300053178 Bacteria 2435
468 Ga0500576_043378 3300053725 Bacteria 2019
469 Ga0500611_009919 3300053727 Bacteria 1526
470 Ga0500625_041293 3300053729 Bacteria 2167
471 Ga0500552_004014 3300053733 Bacteria 1527
472 Ga0500601_000049 3300053737 Bacteria 24772
473 2507511480 2507262055 Bacteria 8048963
474 2508545288 2508501009 Bacteria 7784016
475 2508694119 2508501042 Bacteria 8719808
476 2508696632 2508501042 Bacteria 8719808
477 2509147807 2508501128 Bacteria 8613869
478 2511397265 2511231028 Bacteria 8046582
479 2513625485 2513237092 Bacteria 8341956
480 2513640992 2513237094 Bacteria 8789602
481 2513648404 2513237095 Bacteria 8976980
482 2513673304 2513237098 Bacteria 9902361
483 2513696118 2513237101 Bacteria 7952346
484 2513702267 2513237102 Bacteria 7703324
485 2513716360 2513237104 Bacteria 10034502
486 2513875085 2513237139 Bacteria 8737671
487 2513893115 2513237141 Bacteria 8496279
488 2514013841 2513237161 Bacteria 8871253
489 2515624946 2515154112 Bacteria 8294334
490 2517101247 2517093001 Bacteria 9002274
491 2524439811 2524023205 Bacteria 8918781
492 2528854521 2528768022 Bacteria 10457665
493 2617348351 2617270735 Bacteria 9163226
494 2617374894 2617270741 Bacteria 8201522
495 2723848856 2721755755 Bacteria 8322773
496 2745075909 2744054633 Bacteria 8678936
497 2793061377 2791355196 Bacteria 7323613
498 2793078853
499 2805916325 2802429603 Bacteria 8777136
500 2818239986 2816332527 Bacteria 8933356
501 2824607010 2824600985 Bacteria 8488197
502 2824614319 2824609381 Bacteria 8672835
503 2824622317 2824617872 Bacteria 8814715
504 2824631470 2824626560 Bacteria 8813858
505 2824637990 2824635225 Bacteria 8785348
506 2824649742 2824644064 Bacteria 8743947
507 2824656818 2824653114 Bacteria 8493680
508 2824674582 2824671348 Bacteria 8369588
509 2824685748 2824679649 Bacteria 8248951
510 2824690545 2824687955 Bacteria 8360029
511 2824714426 2824704595 Bacteria 9667483
512 2824719708 2824714736 Bacteria 8717648
513 2824726672 2824723954 Bacteria 8758240
514 2824736386 2824732956 Bacteria 7810675
515 2824752074 2824746037 Bacteria 7911610
516 2824760850 2824753945 Bacteria 9787441
517 2824770304 2824763712 Bacteria 9792355
518 2824776246 2824773399 Bacteria 8360218
519 2838130012 2838122688 Bacteria 8803140
520 2841947051 2841941048 Bacteria 8688029
521 2841955017 2841949485 Bacteria 8680857
522 2841964965 2841957949 Bacteria 8652217
523 2841969975 2841966195 Bacteria 8673214
524 2841977383 2841974524 Bacteria 8931498
525 2841990203 2841983080 Bacteria 8395090
526 2842042205 2842038055 Bacteria 8002051
527 2842050248 2842045827 Bacteria 8006841
528 2844316428 2844315083 Bacteria 8138177
529 2847939272 2847930680 Bacteria 9342022
530 2847943763 2847939898 Bacteria 8606328
531 2849082003 2849076700 Bacteria 7039503
532 2857513518 2857509624 Bacteria 7472071
533 2874594695 2874590934 Bacteria 8299676
534 2874606015 2874604998 Bacteria 7834745
535 2874615242 2874612657 Bacteria 8252029
536 2874622648 2874620515 Bacteria 8290088
537 2874633576 2874628541 Bacteria 8630250
538 2874647272 2874645413 Bacteria 8214782
539 2876765406 2876761206 Bacteria 10111113
540 2876773827 2876771140 Bacteria 8287509
541 2876811793 2876808645 Bacteria 8824342
542 2876819935 2876818435 Bacteria 8274608
543 2879076054 2879074833 Bacteria 8279565
544 2879086945 2879083081 Bacteria 8587928
545 2879104310 2879099564 Bacteria 10442239
546 2879116826 2879110137 Bacteria 8907982
547 2879129340 2879127579 Bacteria 8294491
548 2879144086 2879142872 Bacteria 8267021
549 2881369428 2881364244 Bacteria 7710352
550 2881668278 2881665667 Bacteria 8175609
551 2885373644 2885366525 Bacteria 8326213
552 2885412544 2885409591 Bacteria 9235467
553 2888387062 2888378607 Bacteria 9652610
554 2888389741 2888388044 Bacteria 7304136
555 2888421345 2888419890 Bacteria 7857137
556 2889034480 2889033259 Bacteria 9099371
557 2903728238 2903727486 Bacteria 8281579
558 2903753872 2903748898 Bacteria 9972761
559 2904671345 2904666416 Bacteria 8226587
560 2904719643 2904711408 Bacteria 9771557
561 2906606378 2906602504 Bacteria 8295279
562 2906626846 2906626472 Bacteria 8826946
563 2906649092 2906643746 Bacteria 8722424
564 2908745691 2908739725 Bacteria 8628932
565 2908777377 2908775508 Bacteria 8092255
566 2922366572 2922361189 Bacteria 7436256
567 2922377200
568 2922389520 2922386360 Bacteria 7017218
569 2922398342 2922393267 Bacteria 8285685
570 2929623598 2929615660 Bacteria 9193770
571 2929632699 2929624759 Bacteria 9339455
572 2932793041 2932784394 Bacteria 9704911
573 2932795850 2932794094 Bacteria 7915132
574 2932802088 2932801729 Bacteria 7987968
575 2932814688 2932809354 Bacteria 9135765
576 2932823545 2932818245 Bacteria 9955613
577 2932832982 2932828146 Bacteria 9745859
578 2933585502 2933577622 Bacteria 9116884
579 2935616329 2935608549 Bacteria 8203142
580 2935623713 2935616580 Bacteria 9032984
581 2935639483 2935638405 Bacteria 10015038
582 2935650724 2935648319 Bacteria 8801166
583 2935662104 2935656913 Bacteria 8965014
584 2935670428 2935665750 Bacteria 9571747
585 2935679858 2935675223 Bacteria 9928132
586 2935687428 2935684952 Bacteria 9590419
587 2935696600 2935694250 Bacteria 9291695
588 2935705418 2935703347 Bacteria 10242284
589 2935718887 2935713505 Bacteria 9608509
590 2935728539 2935722832 Bacteria 9608746
591 2935736864 2935732158 Bacteria 9706831
592 2935746133 2935741537 Bacteria 9707219
593 2935753394 2935750917 Bacteria 9590372
594 2935766213 2935760218 Bacteria 9817913
595 2935770382 2935769743 Bacteria 7878163
596 2935777587 2935777560 Bacteria 8077691
597 2935786565 2935785616 Bacteria 7962367
598 2935794620 2935793552 Bacteria 8012592
599 2935807161 2935801545 Bacteria 9301974
600 2935813925 2935810662 Bacteria 9401221
601 2935827126 2935819856 Bacteria 8261050
602 2935828966 2935827899 Bacteria 10038562
603 2935844139 2935837841 Bacteria 9454360
604 2935854307 2935847175 Bacteria 8228321
605 2935862062 2935855204 Bacteria 9035059
606 2935871626 2935864058 Bacteria 9784707
607 2935880263 2935873716 Bacteria 9632195
608 2935886276 2935883170 Bacteria 7964738
609 2935913599 2935908558 Bacteria 8568796
610 2935923498 2935916978 Bacteria 9113783
611 2935931084 2935926038 Bacteria 8601059
612 2935935366 2935934488 Bacteria 8602579
613 2935946932 2935942939 Bacteria 8599779
614 2935953973 2935951376 Bacteria 8602333
615 2935961391 2935959822 Bacteria 7869783
616 2935968999 2935967501 Bacteria 8603075
617 2935982353 2935975950 Bacteria 8347125
618 2935985810 2935984226 Bacteria 8302647
619 2935996929 2935992306 Bacteria 9802711
620 2936005964 2936002035 Bacteria 9362176
621 2936016314 2936011229 Bacteria 8801034
622 2936025038 2936019824 Bacteria 8804134
623 2936033619 2936028420 Bacteria 8965941
624 2936039481 2936037263 Bacteria 9446081
625 2936050949 2936046547 Bacteria 8903709
626 2936057698 2936055302 Bacteria 8785755
627 2940559307 2940556831 Bacteria 9590747
628 2941536904 2941531003 Bacteria 7653939
629 2941542002 2941538514 Bacteria 9402094
630 3005491229 3005483717 Bacteria 7877331
631 3005511074 3005506211 Bacteria 6943378
632 3005591922 3005587118 Bacteria 7794411
633 3005596044 3005594810 Bacteria 8716512
634 3005711998 3005710791 Bacteria 7622528
635 3005719235 3005718088 Bacteria 8283608
636 8006971100 8006964411 Bacteria 8966052
637 8006992973 8006984368 Bacteria 9651211
638 8006996814 8006994254 Bacteria 8309700
639 8016517069 8016511872 Bacteria 9921665
640 8016524610 8016522445 Bacteria 8156687
641 8016542451 8016539877 Bacteria 8155419
642 8016550823 8016548790 Bacteria 8155074
643 8016559237 8016557553 Bacteria 8154380
644 8016567839 8016566248 Bacteria 8158151
645 8016580527 8016575299 Bacteria 8154085
646 8016588502 8016583857 Bacteria 10421953
647 8016597187 8016595262 Bacteria 8149947
648 8016619931 8016613128 Bacteria 8794220
649 8016624152 8016622563 Bacteria 7999408
650 8016637544 8016630954 Bacteria 9217207
651 8017059513 8017057580 Bacteria 10023680
652 8019539473 8019538911 Bacteria 7872763
653 8019551173 8019547302 Bacteria 7996444
654 8019578976 8019576017 Bacteria 10049540
655 8019597022 8019586578 Bacteria 10212056
656 8019604661 8019597564 Bacteria 10041141
657 8019613869 8019608314 Bacteria 10042931
658 8019624449 8019619141 Bacteria 9218857
659 8019637594 8019629233 Bacteria 8687553
660 8019642020 8019638758 Bacteria 9062356
661 8019665523 8019659431 Bacteria 8577854
662 8019675067 8019668869 Bacteria 8791617
663 8019681031 8019678201 Bacteria 8863603
664 8019694692 8019687851 Bacteria 8712826
665 8055749759 8055742211 Bacteria 9226248
666 8056675357 8056673599 Bacteria 7871253
667 8056973969 8056967851 Bacteria 9038162
668 Ga0068860_100004713
669 JGI25153J46596_10002355
670 JGI25153J46596_10002507
671 JGI25153J46596_10002543
672 JGI25153J46596_10011315
673 rootH1_10043864
674 JGI25160J50197_1001353
675 JGI25160J50197_1001493
676 Ga0055542_1010939
677 Ga0055529_1005512
678 Ga0055531_10001939
679 Ga0055543_1008827
680 Ga0065165_1001416
681 Ga0065165_1001641
682 Ga0070683_100320783
683 Ga0068869_100065632
684 Ga0070680_100374605
685 Ga0070668_100026228
686 Ga0070668_100034508
687 Ga0070671_100080856
688 Ga0070671_100218583
689 Ga0070674_100175504
690 Ga0070673_100130635
691 Ga0070667_100020165
692 Ga0070667_100050250
693 Ga0070667_100149474
694 Ga0070709_10001211
695 Ga0070709_10006354
696 Ga0070714_100013779
697 Ga0070713_100271344
698 Ga0070710_10003695
699 Ga0070710_10005274
700 Ga0070711_100006816
701 Ga0070711_100084054
702 Ga0070700_100283729
703 Ga0070663_100063028
704 Ga0070663_100083967
705 Ga0070663_100357757
706 Ga0070662_100056485
707 Ga0070662_100093087
708 Ga0070681_10025372
709 Ga0070681_10279945
710 Ga0070706_100140483
711 Ga0070707_100110085
712 Ga0070679_100206784
713 Ga0070693_100048089
714 Ga0070665_100016387
715 Ga0070665_100042336
716 Ga0070665_100070614
717 Ga0070665_100261832
718 Ga0068855_100083277
719 Ga0068855_100230219
720 Ga0070664_100602078
721 Ga0068854_100040688
722 Ga0068856_100000055
723 Ga0068856_100091030
724 Ga0068852_100065867
725 Ga0068852_100099742
726 Ga0068859_100247773
727 Ga0068864_100085444
728 Ga0068864_100231334
729 Ga0068851_10074574
730 Ga0068863_100190908
731 Ga0068858_100022658
732 Ga0068858_100152500
733 Ga0068862_100096895
734 Ga0081455_10024620
735 Ga0081455_10120311
736 Ga0081540_1013865
737 Ga0081540_1018786
738 Ga0081539_10000848
739 Ga0081539_10028283
740 Ga0081539_10055657
741 Ga0075365_10020149
742 Ga0075365_10026633
743 Ga0075365_10242640
744 Ga0075368_10013120
745 Ga0075368_10051595
746 Ga0075363_100006217
747 Ga0075363_100007607
748 Ga0070715_10141567
749 Ga0070712_100161663
750 Ga0075362_10149692
751 Ga0075367_10011526
752 Ga0075367_10178608
753 Ga0075369_10011150
754 Ga0075369_10159890
755 Ga0075366_10020048
756 Ga0075370_10007551
757 Ga0075428_100184050
758 Ga0097620_100247769
759 Ga0099824_1012218
760 Ga0099794_10071794
761 Ga0105240_10003773
762 Ga0105247_10048581
763 Ga0105241_10097672
764 Ga0105237_10003690
765 Ga0105237_10139389
766 Ga0105237_10220167
767 Ga0105237_10236525
768 Ga0105238_10113763
769 Ga0105239_10119188
770 Ga0105239_10149845
771 Ga0105239_10183160
772 Ga0105239_10201714
773 Ga0105246_10069586
774 Ga0157369_10017917
775 Ga0157369_10079251
776 Ga0157374_10096723
777 Ga0157378_10333716
778 Ga0163162_10299816
779 Ga0157375_10181853
780 Ga0157375_10481210
781 Ga0163163_10186148
782 Ga0163161_10129794
783 Ga0214544_1000005
784 Ga0214542_1000004
785 Ga0214542_1028796
786 Ga0214545_1000005
787 Ga0214545_1030102
788 Ga0214543_1000111
789 Ga0214543_1029464
790 Ga0209677_101932
791 Ga0209677_103281
792 Ga0209148_1000235
793 Ga0209455_1000637
794 Ga0209455_1001771
795 Ga0209455_1002109
796 Ga0209564_1009581
797 Ga0209564_1014705
798 Ga0209758_1000102
799 Ga0209758_1000680
800 Ga0209758_1001707
801 Ga0209758_1003592
802 Ga0209758_1003725
803 Ga0209758_1015828
804 Ga0207426_1000532
805 Ga0207426_1002013
806 Ga0207426_1018846
807 Ga0209051_1038755
808 Ga0209257_1003378
809 Ga0209257_1031771
810 Ga0207656_10136434
811 Ga0207692_10001892
812 Ga0207642_10070289
813 Ga0207699_10000886
814 Ga0207684_10101712
815 Ga0207654_10092322
816 Ga0207707_10009506
817 Ga0207707_10182391
818 Ga0207695_10000006
819 Ga0207671_10060576
820 Ga0207693_10044029
821 Ga0207693_10064641
822 Ga0207663_10002659
823 Ga0207663_10012467
824 Ga0207660_10008941
825 Ga0207662_10087323
826 Ga0207646_10219393
827 Ga0207664_10008367
828 Ga0207644_10209519
829 Ga0207706_10120081
830 Ga0207670_10120738
831 Ga0207669_10471311
832 Ga0207691_10028828
833 Ga0207711_10033289
834 Ga0207689_10049052
835 Ga0207661_10000421
836 Ga0207667_10249798
837 Ga0207667_10360576
838 Ga0207712_10074794
839 Ga0207668_10036096
840 Ga0207668_10058728
841 Ga0207703_10049448
842 Ga0207703_10126206
843 Ga0207639_10041265
844 Ga0207678_10120465
845 Ga0207678_10314595
846 Ga0207674_10156810
847 Ga0207675_100200501
848 Ga0207698_10057629
849 Ga0209389_1000021
850 Ga0209389_1000120
851 Ga0209589_1000027
852 Ga0209489_100023
853 Ga0209489_100742
854 Ga0209700_100134
855 Ga0268266_10008198
856 Ga0268266_10047778
857 Ga0268266_10075957
858 Ga0268266_10123409
859 Ga0268265_10225732
860 Ga0268264_10000185
861 Ga0268264_10292777
862 Ga0265334_10011660
863 Ga0265330_10050538
864 Ga0265340_10011584
865 Ga0265340_10032355
866 Ga0265339_10000906
867 Ga0307513_10058753
868 Ga0307408_100305308
869 Ga0307508_10000012
870 Ga0307508_10074867
871 Ga0307508_10092857
872 Ga0307516_10049306
873 Ga0307406_10124021
874 Ga0307416_100175588
875 Ga0307507_10042841
876 Ga0307510_10006841
877 Ga0373944_0018390
878 Ga0373923_0030181
879 Ga0373923_0072522
880 Ga0373936_0035034
881 Ga0373945_0053810
882 Ga0373954_0037980
883 Ga0373943_0073363
884 Ga0373955_0009517
885 Ga0373955_0031351
886 Ga0373924_0081651
887 Ga0373931_0071623
888 Ga0373935_0271487
889 Ga0373927_0000046
890 Ga0373927_0028404
891 Ga0373927_0127254
892 Ga0373933_0000026
893 Ga0373933_0046386
894 Ga0373933_0128762
895 Ga0373947_0001358
896 Ga0373947_0123090
897 Ga0373947_0154278
898 Ga0373937_0022976
899 Ga0373937_0068689
900 Ga0373937_0312461
901 Ga0373925_0003408
902 Ga0373925_0056484
903 Ga0373925_0166194
904 Ga0373925_0286425
905 Ga0395900_0438362
906 Ga0395898_0030023
907 Ga0395905_0075384
908 Ga0395905_0187642
909 Ga0395905_0282849
910 Ga0395901_0273061
911 Ga0436365_0921625
912 Ga0436365_1495385
913 Ga0436360_1263560
914 Ga0436363_0219045
915 Ga0436362_0291545
916 Ga0466972_0000126
917 Ga0466965_0020348
918 Ga0466966_0001157
919 Ga0466961_0000025
920 Ga0466968_0003979
921 Ga0466957_0038450
922 Ga0466960_0000429
923 Ga0466959_0000873
924 Ga0466967_0033543
925 Ga0466967_0426979
926 Ga0495592_0024044
927 Ga0495592_0068619
928 Ga0495592_0074869
929 Ga0495592_0195808
930 Ga0495603_0000051
931 Ga0495629_0000182
932 Ga0495629_0000750
933 Ga0495638_0005672
934 Ga0495641_0006785
935 Ga0495651_0014936
936 Ga0495651_0034385
937 Ga0495651_0060141
938 Ga0495653_0024767
939 Ga0495580_0089943
940 Ga0495582_0000137
941 Ga0495582_0060422
942 Ga0495639_0000047
943 Ga0495639_0050379
944 Ga0495662_0001496
945 Ga0495664_0001335
946 Ga0495664_0025566
947 Ga0495664_0145777
948 Ga0495585_0068438
949 Ga0495594_0000640
950 Ga0495606_0166027
951 Ga0495608_0008203
952 Ga0495608_0097274
953 Ga0495618_0032958
954 Ga0495628_0023677
955 Ga0495628_0052977
956 Ga0495630_0166713
957 Ga0495643_0014222
958 Ga0495643_0070139
959 Ga0495644_0033685
960 Ga0495648_0001119
961 Ga0495648_0025504
962 Ga0495666_0067117
963 Ga0495652_0001819
964 Ga0495652_0047572
965 Ga0495652_0076789
966 Ga0495652_0079273
967 Ga0495652_0118872
968 Ga0495665_0011658
969 Ga0495665_0032951
970 Ga0495640_0008467
971 Ga0495640_0032573
972 Ga0495640_0118109
973 Ga0495587_0022189
974 Ga0495597_0031761
975 Ga0495645_0006200
976 Ga0495645_0008457
977 Ga0495622_0013217
978 Ga0495622_0046791
979 Ga0495667_0022972
980 Ga0495667_0035514
981 Ga0495656_0049453
982 Ga0495668_0048244
983 Ga0495634_0002221
984 Ga0495634_0019049
985 Ga0495611_0030668
986 Ga0495611_0046878
987 Ga0495625_0044717
988 Ga0495635_0002383
989 Ga0495635_0029135
990 Ga0495635_0079666
991 Ga0495588_0002510
992 Ga0495588_0110337
993 Ga0495657_0006427
994 Ga0495657_0014633
995 Ga0495599_0167421
996 Ga0495646_0024640
997 Ga0495647_0000577
998 Ga0495658_0001786
999 Ga0495669_0001766
1000 Ga0495669_0053205
1001 Ga0495613_0036213
1002 Ga0495613_0073604
1003 Ga0495613_0131922
1004 Ga0495624_0000898
1005 Ga0495624_0079451
1006 Ga0495600_0006983
1007 Ga0495600_0087336
1008 Ga0495600_0227529
1009 Ga0495581_0001056
1010 Ga0495604_0013184
1011 Ga0495604_0036914
1012 Ga0495604_0070106
1013 Ga0495674_0014874
1014 Ga0495674_0043713
1015 Ga0495676_0093833
1016 Ga0495676_0113955
1017 Ga0495676_0275910
1018 Ga0495676_0312045
1019 Ga0495680_0000684
1020 Ga0495680_0023096
1021 Ga0495680_0097811
1022 Ga0495680_0197190
1023 Ga0495683_0032033
1024 Ga0495687_006033
1025 Ga0495675_0025462
1026 Ga0495675_0058690
1027 Ga0495675_0061182
1028 Ga0495673_0014025
1029 Ga0495673_0077092
1030 Ga0495684_0000643
1031 Ga0495684_0023316
1032 Ga0495684_0148848
1033 Ga0495684_0182479
1034 Ga0495593_0002383
1035 Ga0495593_0006202
1036 Ga0495593_0029202
1037 Ga0495602_0009739
1038 Ga0495602_0101734
1039 Ga0495602_0131497
1040 Ga0496100_0086058
1041 Ga0496100_0086252
1042 Ga0496102_0084275
1043 Ga0496102_0234256
1044 Ga0496103_0012479
1045 Ga0496104_0009748
1046 Ga0496104_0187159
1047 Ga0496105_0006291
1048 Ga0496106_0004758
1049 Ga0496106_0043678
1050 Ga0496109_0041429
1051 Ga0496109_0141147
1052 Ga0496110_0078649
1053 Ga0496110_0249352
1054 Ga0496112_0008308
1055 Ga0496112_0052641
1056 Ga0496112_0146461
1057 Ga0496112_0237346
1058 Ga0496115_0104369
1059 Ga0496115_0155201
1060 Ga0496115_0332136
1061 Ga0496117_0032451
1062 Ga0496117_0059521
1063 Ga0496118_0002570
1064 Ga0496118_0036622
1065 Ga0496118_0061721
1066 Ga0496119_0043812
1067 Ga0496120_0071612
1068 Ga0496121_0000265
1069 Ga0496121_0001125
1070 Ga0496121_0011273
1071 Ga0496121_0013326
1072 Ga0496121_0053033
1073 Ga0496121_0265380
1074 Ga0496123_0102409
1075 Ga0496124_0001146
1076 Ga0496124_0086413
1077 Ga0496124_0238049
1078 Ga0496125_0014013
1079 Ga0496125_0088010
1080 Ga0496126_0006457
1081 Ga0496126_0014833
1082 Ga0496126_0036175
1083 Ga0496126_0083371
1084 Ga0495682_0018820
1085 nmdc:mga03n38_46577_c1
1086 nmdc:mga03n38_57036_c1
1087 nmdc:mga0yw44_14998_c1
1088 nmdc:mga0yw44_222678_c1
1089 nmdc:mga0yw44_28367_c1
1090 nmdc:mga0yw44_50969_c1
1091 nmdc:mga0k408_35173_c1
1092 nmdc:mga06z11_84116_c1
1093 nmdc:mga07m45_12306_c1
1094 nmdc:mga07m45_32773_c1
1095 nmdc:mga07m45_42999_c1
1096 nmdc:mga05p37_23088_c3
1097 nmdc:mga0sz30_116551_c1
1098 nmdc:mga0sz30_122578_c1
1099 Ga0495612_0001273
1100 Ga0500635_0010934
1101 Ga0500635_0035313
1102 Ga0495595_0042146
1103 Ga0495619_0057640
1104 Ga0495619_0075820
1105 Ga0495619_0141494
1106 Ga0495619_0227985
1107 Ga0495619_0240750
1108 Ga0500578_0100695
1109 Ga0500643_000016
1110 Ga0500647_0079490
1111 Ga0500566_0000290
1112 Ga0500566_0095986
1113 Ga0500641_0000385
1114 Ga0500556_0067904
1115 Ga0500557_000011
1116 Ga0500569_013281
1117 Ga0500572_000533
1118 Ga0500608_030756
1119 Ga0500655_008342
1120 Ga0500559_0002432
1121 Ga0500559_0086672
1122 Ga0500564_023121
1123 Ga0500568_0019571
1124 Ga0500590_015183
1125 Ga0500603_009135
1126 Ga0500604_0085266
1127 Ga0500619_007535
1128 Ga0500620_011172
1129 Ga0500639_094248
1130 Ga0500636_0000438
1131 Ga0500636_0053343
1132 Ga0500636_0174032
1133 Ga0500637_0001926
1134 Ga0500637_0047659
1135 Ga0500576_043378
1136 Ga0500611_009919
1137 Ga0500625_041293
1138 Ga0500552_004014
1139 Ga0500601_000049
1140 2507511480
1141 2508545288
1142 2508694119
1143 2508696632
1144 2509147807
1145 2511397265
1146 2513625485
1147 2513640992
1148 2513648404
1149 2513673304
1150 2513696118
1151 2513702267
1152 2513716360
1153 2513875085
1154 2513893115
1155 2514013841
1156 2515624946
1157 2517101247
1158 2524439811
1159 2528854521
1160 2617348351
1161 2617374894
1162 2723848856
1163 2745075909
1164 2793061377
1165 2793078853
1166 2805916325
1167 2818239986
1168 2824607010
1169 2824614319
1170 2824622317
1171 2824631470
1172 2824637990
1173 2824649742
1174 2824656818
1175 2824674582
1176 2824685748
1177 2824690545
1178 2824714426
1179 2824719708
1180 2824726672
1181 2824736386
1182 2824752074
1183 2824760850
1184 2824770304
1185 2824776246
1186 2838130012
1187 2841947051
1188 2841955017
1189 2841964965
1190 2841969975
1191 2841977383
1192 2841990203
1193 2842042205
1194 2842050248
1195 2844316428
1196 2847939272
1197 2847943763
1198 2849082003
1199 2857513518
1200 2874594695
1201 2874606015
1202 2874615242
1203 2874622648
1204 2874633576
1205 2874647272
1206 2876765406
1207 2876773827
1208 2876811793
1209 2876819935
1210 2879076054
1211 2879086945
1212 2879104310
1213 2879116826
1214 2879129340
1215 2879144086
1216 2881369428
1217 2881668278
1218 2885373644
1219 2885412544
1220 2888387062
1221 2888389741
1222 2888421345
1223 2889034480
1224 2903728238
1225 2903753872
1226 2904671345
1227 2904719643
1228 2906606378
1229 2906626846
1230 2906649092
1231 2908745691
1232 2908777377
1233 2922366572
1234 2922377200
1235 2922389520
1236 2922398342
1237 2929623598
1238 2929632699
1239 2932793041
1240 2932795850
1241 2932802088
1242 2932814688
1243 2932823545
1244 2932832982
1245 2933585502
1246 2935616329
1247 2935623713
1248 2935639483
1249 2935650724
1250 2935662104
1251 2935670428
1252 2935679858
1253 2935687428
1254 2935696600
1255 2935705418
1256 2935718887
1257 2935728539
1258 2935736864
1259 2935746133
1260 2935753394
1261 2935766213
1262 2935770382
1263 2935777587
1264 2935786565
1265 2935794620
1266 2935807161
1267 2935813925
1268 2935827126
1269 2935828966
1270 2935844139
1271 2935854307
1272 2935862062
1273 2935871626
1274 2935880263
1275 2935886276
1276 2935913599
1277 2935923498
1278 2935931084
1279 2935935366
1280 2935946932
1281 2935953973
1282 2935961391
1283 2935968999
1284 2935982353
1285 2935985810
1286 2935996929
1287 2936005964
1288 2936016314
1289 2936025038
1290 2936033619
1291 2936039481
1292 2936050949
1293 2936057698
1294 2940559307
1295 2941536904
1296 2941542002
1297 3005491229
1298 3005511074
1299 3005591922
1300 3005596044
1301 3005711998
1302 3005719235
1303 8006971100
1304 8006992973
1305 8006996814
1306 8016517069
1307 8016524610
1308 8016542451
1309 8016550823
1310 8016559237
1311 8016567839
1312 8016580527
1313 8016588502
1314 8016597187
1315 8016619931
1316 8016624152
1317 8016637544
1318 8017059513
1319 8019539473
1320 8019551173
1321 8019578976
1322 8019597022
1323 8019604661
1324 8019613869
1325 8019624449
1326 8019637594
1327 8019642020
1328 8019665523
1329 8019675067
1330 8019681031
1331 8019694692
1332 8055749759
1333 8056675357
1334 8056973969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

180

358

0.94

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

214

298

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x6r-assembly2.cif.gz_B crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.9376 142 174
5x6q-assembly1.cif.gz_A crystal structure of pseudomonas fluorescens kmo in complex with ro 61-8048 0.9293 142 173
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9279 141 173
5y7a-assembly1.cif.gz_A crystal structure of pseudomonas fluorescens kynurenine 3-monooxygenase in complex with l-kyn 0.9214 141 173
5unn-assembly1.cif.gz_B crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in apo form 0.9179 95 293
ID Description Score Start End Superfamily
3d1cA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9372 142 169 3.50.50.60
4weqA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9361 101 286 3.40.50.720
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9353 143 171 3.50.50.60
af_Q8WSW2_5_214_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9348 142 171 3.50.50.60
af_Q18006_4_263_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9327 143 171 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4S0XN60-F1-model_v4 deleted 0.9941 141 241
AF-A0A4S0XN60-F1-model_v4 deleted 0.9474 141 241
AF-A0A3S1L1A5-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9396 102 262 GO:0051287
AF-A0A377ZXH8-F1-model_v4 2-hydroxyacid dehydrogenase YcdW (EC 1.1.1.79) 0.9272 104 283 GO:0030267
GO:0051287
AF-A0A2X3H7M6-F1-model_v4 2-hydroxyacid dehydrogenase YcdW (EC 1.1.1.79) 0.9228 121 283 GO:0030267
GO:0051287

Map