F473777

General Info

Members Datasets Scaffolds Average Seq Length
666 295 1332 113

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10046641|Ga0105240_100466412
Length 127
Sequence MNKRRYVGFQHVGVFMRETKSDVLQGTLDLMILKTLQSMGPLHGYAIARRIEQVSSDSLSLNQGTIYPALLRLEQRRCIRSNWGTSDTGRKAKFYSLTRIGQKQVAQEEENWSRIVTTMARFLSPAE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
217 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
262 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
263 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
264 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
265 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 5.71
Rhizosphere 91.89
Stem 0
Stem Tuber 0
Unclassified 34.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10046641 3300009093 Bacteria 5490
2 MRS1b_contig_5195114 2162886011 Bacteria 977
3 MRS1b_contig_740034 2162886011 Unclassified 2120
4 JGI24751J29686_10003640 3300002459 Bacteria 3103
5 JGI25406J46586_10091420 3300003203 Unclassified 918
6 JGI25406J46586_10109353 3300003203 Bacteria 819
7 Ga0058863_11081517 3300004799 Unclassified 1071
8 Ga0065714_10293225 3300005288 Unclassified 705
9 Ga0065712_10071338 3300005290 Bacteria 5329
10 Ga0065715_10002039 3300005293 Bacteria 6949
11 Ga0065715_10018848 3300005293 Bacteria 2009
12 Ga0065715_10415544 3300005293 Unclassified 864
13 Ga0065715_10460764 3300005293 Unclassified 801
14 Ga0065707_10612148 3300005295 Bacteria 677
15 Ga0070676_10163202 3300005328 Bacteria 1436
16 Ga0070676_10458546 3300005328 Unclassified 898
17 Ga0070683_100213608 3300005329 Bacteria 1833
18 Ga0070690_100040738 3300005330 Bacteria 2939
19 Ga0070670_100020088 3300005331 Bacteria 5737
20 Ga0070670_100021417 3300005331 Bacteria 5561
21 Ga0070670_100041275 3300005331 Bacteria 3966
22 Ga0070670_100353014 3300005331 Bacteria 1292
23 Ga0070677_10001446 3300005333 Bacteria 7520
24 Ga0070677_10126706 3300005333 Bacteria 1160
25 Ga0068869_100573325 3300005334 Bacteria 951
26 Ga0068869_100609120 3300005334 Bacteria 923
27 Ga0070666_10279591 3300005335 Bacteria 1186
28 Ga0070666_11191642 3300005335 Bacteria 567
29 Ga0070680_100715344 3300005336 Bacteria 862
30 Ga0070682_102083586 3300005337 Unclassified 500
31 Ga0068868_100078229 3300005338 Bacteria 2647
32 Ga0068868_100170782 3300005338 Bacteria 1800
33 Ga0068868_100393974 3300005338 Bacteria 1194
34 Ga0068868_100424863 3300005338 Unclassified 1151
35 Ga0068868_101101557 3300005338 Unclassified 731
36 Ga0070689_101841780 3300005340 Bacteria 552
37 Ga0070687_100963637 3300005343 Unclassified 616
38 Ga0070661_100709951 3300005344 Bacteria 820
39 Ga0070661_101112658 3300005344 Unclassified 658
40 Ga0070692_10177449 3300005345 Bacteria 1232
41 Ga0070668_100164774 3300005347 Bacteria 1801
42 Ga0070668_101321968 3300005347 Bacteria 656
43 Ga0070669_100820956 3300005353 Unclassified 791
44 Ga0070669_101418887 3300005353 Unclassified 603
45 Ga0070675_100005217 3300005354 Bacteria 9914
46 Ga0070671_100160423 3300005355 Bacteria 1901
47 Ga0070674_100000307 3300005356 Bacteria 24081
48 Ga0070674_100654079 3300005356 Unclassified 894
49 Ga0070674_101105099 3300005356 Bacteria 700
50 Ga0070673_100283118 3300005364 Bacteria 1455
51 Ga0070673_100918187 3300005364 Unclassified 812
52 Ga0070688_100018900 3300005365 Bacteria 3984
53 Ga0070688_100022771 3300005365 Bacteria 3677
54 Ga0070688_101074615 3300005365 Unclassified 642
55 Ga0070659_100541214 3300005366 Bacteria 996
56 Ga0070703_10596503 3300005406 Bacteria 509
57 Ga0070713_100826684 3300005436 Unclassified 889
58 Ga0070713_101357621 3300005436 Bacteria 689
59 Ga0070710_10123209 3300005437 Bacteria 1571
60 Ga0070711_100029998 3300005439 Bacteria 3595
61 Ga0070711_100080902 3300005439 Bacteria 2314
62 Ga0070700_100764479 3300005441 Bacteria 774
63 Ga0070700_101750738 3300005441 Unclassified 534
64 Ga0070694_100016722 3300005444 Bacteria 4620
65 Ga0070708_100719806 3300005445 Unclassified 939
66 Ga0070663_100120235 3300005455 Bacteria 1983
67 Ga0070678_100307148 3300005456 Unclassified 1350
68 Ga0070678_100525556 3300005456 Bacteria 1047
69 Ga0070662_100851842 3300005457 Unclassified 776
70 Ga0070662_101105272 3300005457 Bacteria 680
71 Ga0070681_10410097 3300005458 Unclassified 1267
72 Ga0068867_100156641 3300005459 Unclassified 1793
73 Ga0068867_100171868 3300005459 Bacteria 1717
74 Ga0068867_100202440 3300005459 Bacteria 1590
75 Ga0068867_100450762 3300005459 Bacteria 1096
76 Ga0068867_100457076 3300005459 Unclassified 1089
77 Ga0070685_10334092 3300005466 Unclassified 1031
78 Ga0070685_10702247 3300005466 Unclassified 737
79 Ga0070706_101862115 3300005467 Unclassified 546
80 Ga0070707_100981218 3300005468 Unclassified 810
81 Ga0070698_101099260 3300005471 Unclassified 743
82 Ga0070684_100693252 3300005535 Unclassified 949
83 Ga0068853_100425400 3300005539 Bacteria 1246
84 Ga0070672_100020736 3300005543 Bacteria 4798
85 Ga0070672_100302653 3300005543 Bacteria 1355
86 Ga0070672_100390212 3300005543 Unclassified 1192
87 Ga0070672_101971643 3300005543 Unclassified 526
88 Ga0070695_100741603 3300005545 Unclassified 783
89 Ga0070696_100539513 3300005546 Unclassified 933
90 Ga0070696_101140699 3300005546 Unclassified 657
91 Ga0070665_100041496 3300005548 Bacteria 4626
92 Ga0070665_101195485 3300005548 Bacteria 771
93 Ga0070665_101282832 3300005548 Unclassified 742
94 Ga0070665_101522848 3300005548 Bacteria 677
95 Ga0070704_100265426 3300005549 Bacteria 1416
96 Ga0070704_100421039 3300005549 Bacteria 1144
97 Ga0068855_100010940 3300005563 Bacteria 10952
98 Ga0068855_100401009 3300005563 Unclassified 1503
99 Ga0068855_101397139 3300005563 Unclassified 722
100 Ga0070664_100557549 3300005564 Bacteria 1060
101 Ga0070664_100559760 3300005564 Bacteria 1058
102 Ga0070664_100747514 3300005564 Unclassified 913
103 Ga0068857_100446286 3300005577 Unclassified 1209
104 Ga0068854_100785270 3300005578 Bacteria 829
105 Ga0068856_100336073 3300005614 Bacteria 1529
106 Ga0068856_100488892 3300005614 Bacteria 1252
107 Ga0070702_100437715 3300005615 Bacteria 945
108 Ga0070702_101825646 3300005615 Bacteria 508
109 Ga0068852_100031260 3300005616 Bacteria 4391
110 Ga0068852_100958485 3300005616 Bacteria 874
111 Ga0068859_100008926 3300005617 Bacteria 10126
112 Ga0068859_100217051 3300005617 Bacteria 2000
113 Ga0068859_100464283 3300005617 Bacteria 1362
114 Ga0068859_100659865 3300005617 Bacteria 1138
115 Ga0068859_100933251 3300005617 Unclassified 952
116 Ga0068859_101213715 3300005617 Unclassified 831
117 Ga0068859_101247649 3300005617 Unclassified 819
118 Ga0068864_100036903 3300005618 Unclassified 4167
119 Ga0068864_100110508 3300005618 Unclassified 2448
120 Ga0068864_100955617 3300005618 Unclassified 848
121 Ga0068864_101006639 3300005618 Bacteria 827
122 Ga0068864_101459469 3300005618 Unclassified 687
123 Ga0068861_100010164 3300005719 Bacteria 6530
124 Ga0068861_100091237 3300005719 Bacteria 2405
125 Ga0068861_100165737 3300005719 Bacteria 1827
126 Ga0068861_100360493 3300005719 Unclassified 1278
127 Ga0068851_10353003 3300005834 Bacteria 856
128 Ga0068851_10556629 3300005834 Unclassified 693
129 Ga0068851_10631266 3300005834 Unclassified 654
130 Ga0068863_100062968 3300005841 Bacteria 3508
131 Ga0068863_100196237 3300005841 Bacteria 1940
132 Ga0068858_100063102 3300005842 Bacteria 3428
133 Ga0068858_100225273 3300005842 Bacteria 1777
134 Ga0068858_100307130 3300005842 Bacteria 1514
135 Ga0068858_100369762 3300005842 Bacteria 1375
136 Ga0068858_101225909 3300005842 Unclassified 738
137 Ga0068858_102174268 3300005842 Unclassified 549
138 Ga0068860_100281147 3300005843 Bacteria 1626
139 Ga0068860_101193486 3300005843 Unclassified 781
140 Ga0068860_101347068 3300005843 Bacteria 735
141 Ga0068860_101497526 3300005843 Bacteria 696
142 Ga0068860_101551407 3300005843 Unclassified 684
143 Ga0068860_101963539 3300005843 Bacteria 607
144 Ga0068862_100059679 3300005844 Bacteria 3276
145 Ga0068862_100100433 3300005844 Bacteria 2530
146 Ga0068862_100256496 3300005844 Bacteria 1595
147 Ga0081539_10011080 3300005985 Bacteria 7204
148 Ga0075432_10432598 3300006058 Unclassified 574
149 Ga0070716_100953341 3300006173 Bacteria 675
150 Ga0070712_100733517 3300006175 Bacteria 844
151 Ga0070712_100943341 3300006175 Bacteria 745
152 Ga0097621_100178905 3300006237 Bacteria 1832
153 Ga0097621_100976482 3300006237 Unclassified 791
154 Ga0075370_10755578 3300006353 Unclassified 592
155 Ga0068871_100002176 3300006358 Bacteria 13309
156 Ga0068871_100011672 3300006358 Bacteria 6451
157 Ga0068871_100074423 3300006358 Bacteria 2802
158 Ga0068871_100274090 3300006358 Bacteria 1474
159 Ga0068871_100625617 3300006358 Unclassified 981
160 Ga0068871_100730043 3300006358 Unclassified 909
161 Ga0075428_100368649 3300006844 Bacteria 1540
162 Ga0075428_100588904 3300006844 Unclassified 1188
163 Ga0075428_101889155 3300006844 Bacteria 620
164 Ga0075428_102164266 3300006844 Unclassified 574
165 Ga0075430_100123675 3300006846 Unclassified 2156
166 Ga0075430_100159052 3300006846 Bacteria 1881
167 Ga0075431_100003946 3300006847 Bacteria 14445
168 Ga0075431_100029426 3300006847 Bacteria 5655
169 Ga0075431_100049346 3300006847 Bacteria 4340
170 Ga0075431_100179005 3300006847 Bacteria 2176
171 Ga0075431_100241241 3300006847 Unclassified 1839
172 Ga0075431_100916373 3300006847 Unclassified 846
173 Ga0075433_10141168 3300006852 Bacteria 2141
174 Ga0075434_100771572 3300006871 Unclassified 978
175 Ga0075429_100198973 3300006880 Bacteria 1755
176 Ga0075429_100496737 3300006880 Bacteria 1069
177 Ga0068865_100013141 3300006881 Bacteria 5224
178 Ga0068865_100014070 3300006881 Bacteria 5076
179 Ga0068865_100270839 3300006881 Unclassified 1348
180 Ga0068865_100473492 3300006881 Unclassified 1039
181 Ga0068865_100561097 3300006881 Bacteria 960
182 Ga0097620_100008926 3300006931 Bacteria 10126
183 Ga0097620_100217047 3300006931 Bacteria 2000
184 Ga0097620_100464299 3300006931 Bacteria 1362
185 Ga0097620_100659792 3300006931 Bacteria 1138
186 Ga0097620_100933306 3300006931 Unclassified 952
187 Ga0097620_101213638 3300006931 Unclassified 831
188 Ga0097620_101247770 3300006931 Unclassified 819
189 Ga0075435_100121289 3300007076 Bacteria 2182
190 Ga0105240_10016160 3300009093 Bacteria 10115
191 Ga0105240_10092018 3300009093 Unclassified 3704
192 Ga0105240_10299134 3300009093 Unclassified 1841
193 Ga0105240_11390098 3300009093 Unclassified 738
194 Ga0111539_10005227 3300009094 Bacteria 16816
195 Ga0111539_10008058 3300009094 Bacteria 13427
196 Ga0111539_10009808 3300009094 Bacteria 12087
197 Ga0111539_10056198 3300009094 Bacteria 4679
198 Ga0111539_10290144 3300009094 Bacteria 1904
199 Ga0105245_10026920 3300009098 Bacteria 5063
200 Ga0105245_10123297 3300009098 Bacteria 2423
201 Ga0105245_10358521 3300009098 Bacteria 1447
202 Ga0105245_10943631 3300009098 Bacteria 905
203 Ga0105245_11058680 3300009098 Bacteria 857
204 Ga0105247_10002954 3300009101 Bacteria 11287
205 Ga0105247_11711773 3300009101 Unclassified 520
206 Ga0114129_10114708 3300009147 Bacteria 3714
207 Ga0114129_10519142 3300009147 Bacteria 1553
208 Ga0114129_10606557 3300009147 Unclassified 1418
209 Ga0114129_11268132 3300009147 Unclassified 915
210 Ga0105243_10280656 3300009148 Unclassified 1500
211 Ga0105243_11077758 3300009148 Unclassified 810
212 Ga0105243_11273098 3300009148 Unclassified 751
213 Ga0105241_10214339 3300009174 Bacteria 1615
214 Ga0105241_10420119 3300009174 Unclassified 1177
215 Ga0105241_10576632 3300009174 Bacteria 1013
216 Ga0105241_10868775 3300009174 Unclassified 835
217 Ga0105241_10949745 3300009174 Unclassified 801
218 Ga0105242_10046347 3300009176 Unclassified 3527
219 Ga0105242_10305874 3300009176 Bacteria 1453
220 Ga0105242_11087665 3300009176 Bacteria 813
221 Ga0105242_11239441 3300009176 Bacteria 767
222 Ga0105242_13071727 3300009176 Unclassified 517
223 Ga0105248_10087167 3300009177 Bacteria 3513
224 Ga0105248_10126008 3300009177 Bacteria 2889
225 Ga0105248_10133477 3300009177 Unclassified 2801
226 Ga0105248_10242314 3300009177 Bacteria 2030
227 Ga0105248_10575453 3300009177 Unclassified 1271
228 Ga0105248_12671635 3300009177 Unclassified 569
229 Ga0105237_10052267 3300009545 Bacteria 4102
230 Ga0105237_10173196 3300009545 Bacteria 2158
231 Ga0105238_10016400 3300009551 Bacteria 7498
232 Ga0105238_10547016 3300009551 Unclassified 1162
233 Ga0105238_11750782 3300009551 Unclassified 653
234 Ga0105238_11790512 3300009551 Unclassified 646
235 Ga0105249_10012139 3300009553 Bacteria 7584
236 Ga0105249_10426104 3300009553 Unclassified 1361
237 Ga0105249_12540994 3300009553 Unclassified 584
238 Ga0105249_12693408 3300009553 Unclassified 569
239 Ga0105239_10354911 3300010375 Bacteria 1655
240 Ga0105239_10372324 3300010375 Bacteria 1614
241 Ga0105239_11197310 3300010375 Bacteria 875
242 Ga0105246_10555640 3300011119 Bacteria 985
243 Ga0105246_11685339 3300011119 Bacteria 602
244 Ga0157341_1031947 3300012494 Bacteria 573
245 Ga0157373_10724397 3300013100 Unclassified 730
246 Ga0157370_10088108 3300013104 Unclassified 2915
247 Ga0157369_10016350 3300013105 Bacteria 8349
248 Ga0157369_11497403 3300013105 Unclassified 686
249 Ga0157374_10010014 3300013296 Bacteria 8136
250 Ga0157374_10396718 3300013296 Bacteria 1376
251 Ga0157374_10717125 3300013296 Unclassified 1014
252 Ga0157374_10737405 3300013296 Bacteria 999
253 Ga0157374_11152476 3300013296 Unclassified 796
254 Ga0157378_10101095 3300013297 Bacteria 2633
255 Ga0157378_10138307 3300013297 Bacteria 2260
256 Ga0157378_10814514 3300013297 Unclassified 960
257 Ga0157378_10847814 3300013297 Bacteria 942
258 Ga0157378_11982389 3300013297 Bacteria 632
259 Ga0157378_12022641 3300013297 Unclassified 626
260 Ga0163162_10138156 3300013306 Bacteria 2548
261 Ga0163162_10181071 3300013306 Bacteria 2233
262 Ga0163162_10227962 3300013306 Bacteria 1993
263 Ga0163162_10353191 3300013306 Unclassified 1603
264 Ga0163162_10473020 3300013306 Bacteria 1385
265 Ga0163162_11208910 3300013306 Bacteria 858
266 Ga0157372_10045023 3300013307 Bacteria 4892
267 Ga0157372_10739492 3300013307 Unclassified 1144
268 Ga0157375_10003346 3300013308 Bacteria 13889
269 Ga0157375_10219377 3300013308 Bacteria 2060
270 Ga0157375_10317730 3300013308 Bacteria 1722
271 Ga0157375_10638114 3300013308 Bacteria 1222
272 Ga0157375_10810529 3300013308 Bacteria 1084
273 Ga0157375_11095776 3300013308 Unclassified 932
274 Ga0163163_10023292 3300014325 Bacteria 5875
275 Ga0163163_10231639 3300014325 Bacteria 1896
276 Ga0163163_10992900 3300014325 Unclassified 903
277 Ga0163163_12525476 3300014325 Bacteria 572
278 Ga0157380_10003695 3300014326 Bacteria 10525
279 Ga0157380_10174576 3300014326 Bacteria 1881
280 Ga0157377_11319198 3300014745 Unclassified 565
281 Ga0157379_10015069 3300014968 Bacteria 6781
282 Ga0157379_10047025 3300014968 Bacteria 3849
283 Ga0157379_10051726 3300014968 Unclassified 3669
284 Ga0157379_10560289 3300014968 Unclassified 1064
285 Ga0157379_10571334 3300014968 Bacteria 1053
286 Ga0157376_10170445 3300014969 Unclassified 1982
287 Ga0157376_10364873 3300014969 Bacteria 1386
288 Ga0157376_10736798 3300014969 Unclassified 994
289 Ga0157376_10854841 3300014969 Unclassified 925
290 Ga0157376_11281595 3300014969 Bacteria 762
291 Ga0163161_10366143 3300017792 Bacteria 1149
292 Ga0207697_10096856 3300025315 Bacteria 1255
293 Ga0207682_10002516 3300025893 Bacteria 8191
294 Ga0207682_10045835 3300025893 Bacteria 1795
295 Ga0207710_10111086 3300025900 Bacteria 1301
296 Ga0207710_10227569 3300025900 Bacteria 927
297 Ga0207680_10363612 3300025903 Bacteria 1018
298 Ga0207645_10015544 3300025907 Bacteria 5054
299 Ga0207645_10030716 3300025907 Bacteria 3462
300 Ga0207705_10680443 3300025909 Unclassified 800
301 Ga0207684_11343831 3300025910 Unclassified 587
302 Ga0207654_10263514 3300025911 Bacteria 1160
303 Ga0207654_10463527 3300025911 Bacteria 890
304 Ga0207654_10982034 3300025911 Bacteria 614
305 Ga0207707_10302309 3300025912 Unclassified 1383
306 Ga0207695_10100639 3300025913 Bacteria 2886
307 Ga0207695_11190077 3300025913 Bacteria 642
308 Ga0207671_10527331 3300025914 Bacteria 942
309 Ga0207671_10849451 3300025914 Unclassified 723
310 Ga0207693_10040820 3300025915 Bacteria 3654
311 Ga0207660_10454930 3300025917 Bacteria 1035
312 Ga0207662_10255303 3300025918 Bacteria 1152
313 Ga0207649_10634296 3300025920 Bacteria 824
314 Ga0207681_10605187 3300025923 Bacteria 906
315 Ga0207681_10696688 3300025923 Unclassified 844
316 Ga0207694_11137316 3300025924 Unclassified 661
317 Ga0207650_10032248 3300025925 Bacteria 3790
318 Ga0207650_10456625 3300025925 Bacteria 1064
319 Ga0207659_10026321 3300025926 Unclassified 3923
320 Ga0207659_10843933 3300025926 Unclassified 787
321 Ga0207687_10381650 3300025927 Unclassified 1155
322 Ga0207687_11059643 3300025927 Unclassified 696
323 Ga0207687_11349798 3300025927 Unclassified 613
324 Ga0207687_11643864 3300025927 Bacteria 551
325 Ga0207700_10007045 3300025928 Bacteria 6839
326 Ga0207700_11020536 3300025928 Unclassified 740
327 Ga0207700_11047509 3300025928 Bacteria 730
328 Ga0207690_11046388 3300025932 Unclassified 680
329 Ga0207706_10109978 3300025933 Bacteria 2425
330 Ga0207706_10898088 3300025933 Bacteria 748
331 Ga0207686_10485752 3300025934 Bacteria 956
332 Ga0207686_11285621 3300025934 Unclassified 600
333 Ga0207686_11838697 3300025934 Bacteria 501
334 Ga0207709_11468181 3300025935 Unclassified 565
335 Ga0207670_10657325 3300025936 Unclassified 865
336 Ga0207670_10744680 3300025936 Bacteria 813
337 Ga0207670_10776756 3300025936 Bacteria 797
338 Ga0207670_11041324 3300025936 Bacteria 689
339 Ga0207669_10007886 3300025937 Bacteria 4962
340 Ga0207669_10352324 3300025937 Unclassified 1138
341 Ga0207669_10737879 3300025937 Unclassified 812
342 Ga0207704_10042269 3300025938 Bacteria 2682
343 Ga0207704_10088470 3300025938 Bacteria 2026
344 Ga0207704_10666140 3300025938 Unclassified 858
345 Ga0207704_10922193 3300025938 Bacteria 735
346 Ga0207665_10663527 3300025939 Unclassified 818
347 Ga0207691_10009082 3300025940 Bacteria 9542
348 Ga0207691_10117601 3300025940 Unclassified 2358
349 Ga0207691_10166042 3300025940 Bacteria 1934
350 Ga0207691_10567255 3300025940 Unclassified 962
351 Ga0207711_10034878 3300025941 Bacteria 4262
352 Ga0207711_10177234 3300025941 Unclassified 1937
353 Ga0207711_10219589 3300025941 Unclassified 1738
354 Ga0207711_10323457 3300025941 Unclassified 1425
355 Ga0207689_10100967 3300025942 Bacteria 2370
356 Ga0207689_10112530 3300025942 Bacteria 2237
357 Ga0207689_11229983 3300025942 Bacteria 630
358 Ga0207679_10268169 3300025945 Bacteria 1459
359 Ga0207679_10678691 3300025945 Bacteria 934
360 Ga0207667_10019273 3300025949 Bacteria 7623
361 Ga0207667_10100094 3300025949 Bacteria 2990
362 Ga0207667_11967340 3300025949 Unclassified 545
363 Ga0207712_10932078 3300025961 Unclassified 769
364 Ga0207712_11449547 3300025961 Unclassified 615
365 Ga0207668_10195244 3300025972 Unclassified 1608
366 Ga0207668_10250624 3300025972 Bacteria 1438
367 Ga0207668_10386602 3300025972 Bacteria 1179
368 Ga0207640_11130362 3300025981 Unclassified 694
369 Ga0207658_10305132 3300025986 Bacteria 1373
370 Ga0207658_10326483 3300025986 Bacteria 1330
371 Ga0207658_11798446 3300025986 Unclassified 559
372 Ga0207677_10060411 3300026023 Bacteria 2620
373 Ga0207677_10117751 3300026023 Bacteria 1992
374 Ga0207677_10233937 3300026023 Unclassified 1482
375 Ga0207703_10049086 3300026035 Bacteria 3411
376 Ga0207703_10085248 3300026035 Bacteria 2643
377 Ga0207703_10402982 3300026035 Bacteria 1270
378 Ga0207703_10865463 3300026035 Unclassified 865
379 Ga0207703_11256094 3300026035 Unclassified 712
380 Ga0207639_10082047 3300026041 Bacteria 2555
381 Ga0207639_10159600 3300026041 Bacteria 1899
382 Ga0207639_10282134 3300026041 Bacteria 1461
383 Ga0207678_10028247 3300026067 Bacteria 4898
384 Ga0207708_10080950 3300026075 Bacteria 2495
385 Ga0207708_10273390 3300026075 Bacteria 1367
386 Ga0207708_11554183 3300026075 Bacteria 581
387 Ga0207702_10185012 3300026078 Bacteria 1921
388 Ga0207702_11798683 3300026078 Unclassified 605
389 Ga0207641_10097254 3300026088 Bacteria 2587
390 Ga0207648_10151874 3300026089 Bacteria 2043
391 Ga0207648_10216392 3300026089 Bacteria 1701
392 Ga0207648_10234266 3300026089 Unclassified 1634
393 Ga0207648_10258169 3300026089 Unclassified 1554
394 Ga0207648_10473612 3300026089 Bacteria 1143
395 Ga0207648_10770338 3300026089 Bacteria 894
396 Ga0207676_10073559 3300026095 Bacteria 2751
397 Ga0207676_10361482 3300026095 Bacteria 1345
398 Ga0207676_11126609 3300026095 Unclassified 776
399 Ga0207676_11346851 3300026095 Unclassified 709
400 Ga0207674_10210913 3300026116 Unclassified 1891
401 Ga0207674_10429876 3300026116 Unclassified 1276
402 Ga0207674_11252003 3300026116 Bacteria 711
403 Ga0207675_100041027 3300026118 Bacteria 4323
404 Ga0207675_100251628 3300026118 Bacteria 1710
405 Ga0207675_100832153 3300026118 Unclassified 937
406 Ga0207683_10015712 3300026121 Bacteria 6443
407 Ga0207683_10018393 3300026121 Bacteria 5962
408 Ga0207683_10270160 3300026121 Unclassified 1553
409 Ga0207698_10460408 3300026142 Bacteria 1230
410 Ga0207698_10868075 3300026142 Unclassified 908
411 Ga0207698_11036509 3300026142 Bacteria 832
412 Ga0207698_11490967 3300026142 Bacteria 692
413 Ga0207698_11622382 3300026142 Bacteria 662
414 Ga0207698_11687626 3300026142 Bacteria 649
415 Ga0207698_11970148 3300026142 Unclassified 599
416 Ga0209966_1011553 3300027695 Bacteria 1612
417 Ga0209813_10352732 3300027866 Bacteria 583
418 Ga0207428_10000649 3300027907 Bacteria 40775
419 Ga0207428_10033847 3300027907 Bacteria 4191
420 Ga0207428_10120612 3300027907 Bacteria 2011
421 Ga0268266_10006975 3300028379 Bacteria 10270
422 Ga0268266_10848815 3300028379 Bacteria 883
423 Ga0268265_10005594 3300028380 Bacteria 8581
424 Ga0268265_10030611 3300028380 Bacteria 3879
425 Ga0268265_10337414 3300028380 Bacteria 1371
426 Ga0268264_10167898 3300028381 Bacteria 1982
427 Ga0268264_10590707 3300028381 Bacteria 1093
428 Ga0268264_11684164 3300028381 Bacteria 645
429 Ga0268264_11993166 3300028381 Unclassified 590
430 Ga0307511_10176887 3300030521 Bacteria 1159
431 Ga0265770_1088108 3300030878 Bacteria 616
432 Ga0307408_100102714 3300031548 Unclassified 2181
433 Ga0307408_100220781 3300031548 Bacteria 1546
434 Ga0307413_10188838 3300031824 Unclassified 1477
435 Ga0307413_11196461 3300031824 Unclassified 661
436 Ga0307410_11002143 3300031852 Bacteria 720
437 Ga0307406_10251729 3300031901 Bacteria 1331
438 Ga0307407_11234239 3300031903 Unclassified 585
439 Ga0307412_10021968 3300031911 Unclassified 3905
440 Ga0307412_10242507 3300031911 Bacteria 1395
441 Ga0307416_100053221 3300032002 Unclassified 3246
442 Ga0307416_102133806 3300032002 Bacteria 662
443 Ga0307411_10050857 3300032005 Bacteria 2701
444 Ga0307411_10363785 3300032005 Bacteria 1184
445 Ga0307415_100581424 3300032126 Unclassified 993
446 Ga0373936_0154340 3300035113 Bacteria 997
447 Ga0373936_0411551 3300035113 Unclassified 622
448 Ga0373943_0102940 3300035170 Bacteria 1496
449 Ga0373933_0051993 3300035724 Bacteria 2450
450 Ga0373937_0002319 3300036401 Bacteria 15903
451 Ga0373937_0166396 3300036401 Unclassified 2068
452 Ga0373925_0028264 3300037068 Bacteria 4108
453 Ga0395900_0615818 3300037418 Unclassified 1025
454 Ga0395898_0072061 3300037466 Bacteria 3338
455 Ga0436364_0258828 3300037853 Bacteria 898
456 Ga0436364_0682033 3300037853 Bacteria 852
457 Ga0436364_1184380 3300037853 Bacteria 1695
458 Ga0436364_1257404 3300037853 Unclassified 1773
459 Ga0436364_1354873 3300037853 Bacteria 2118
460 Ga0436365_0087518 3300039437 Unclassified 546
461 Ga0436365_1409158 3300039437 Unclassified 675
462 Ga0436362_0342569 3300039453 Unclassified 555
463 Ga0451791_0508529 3300041451 Bacteria 622
464 Ga0451853_0082413 3300041512 Unclassified 612
465 Ga0439446_0052210 3300042156 Unclassified 1223
466 Ga0439435_0020006 3300042436 Bacteria 1722
467 Ga0439435_0327777 3300042436 Bacteria 528
468 Ga0451577_0011100 3300042876 Bacteria 8549
469 Ga0439440_0079271 3300042993 Unclassified 866
470 Ga0453684_0489788 3300044712 Bacteria 1363
471 Ga0466971_0446233 3300044719 Unclassified 634
472 Ga0451576_0062376 3300045051 Unclassified 3886
473 Ga0451576_0102600 3300045051 Bacteria 2976
474 Ga0495629_0029624 3300046459 Unclassified 3881
475 Ga0495629_0072694 3300046459 Unclassified 2401
476 Ga0495582_0432379 3300046473 Unclassified 760
477 Ga0495662_0155289 3300046476 Bacteria 1127
478 Ga0495584_0396746 3300046491 Bacteria 701
479 Ga0495652_0681138 3300046529 Unclassified 693
480 Ga0495640_0099829 3300046533 Bacteria 1907
481 Ga0495586_0049976 3300046535 Unclassified 2262
482 Ga0495667_0134045 3300046559 Bacteria 1597
483 Ga0495667_0167737 3300046559 Unclassified 1411
484 Ga0495635_0075763 3300046663 Unclassified 2305
485 Ga0495635_0271631 3300046663 Bacteria 1140
486 Ga0495659_0039183 3300046664 Unclassified 1685
487 Ga0495613_0433857 3300046689 Unclassified 892
488 Ga0495613_0440530 3300046689 Bacteria 884
489 Ga0495589_0525320 3300046794 Bacteria 540
490 Ga0495600_0086389 3300046809 Unclassified 2047
491 Ga0495674_0201055 3300047319 Bacteria 1653
492 Ga0495672_0013882 3300047320 Bacteria 5538
493 Ga0495672_0078412 3300047320 Bacteria 1848
494 Ga0495672_0247962 3300047320 Bacteria 866
495 Ga0495677_0254877 3300047445 Bacteria 686
496 Ga0495685_273648 3300047447 Bacteria 533
497 Ga0495684_0229420 3300047471 Unclassified 1358
498 Ga0495684_0654714 3300047471 Unclassified 702
499 Ga0495684_0808107 3300047471 Unclassified 612
500 Ga0496100_0140867 3300048903 Bacteria 1709
501 Ga0496100_0260647 3300048903 Bacteria 1285
502 Ga0496101_0000225 3300048904 Bacteria 42158
503 Ga0496101_0151400 3300048904 Bacteria 1775
504 Ga0496101_0488582 3300048904 Unclassified 972
505 Ga0496101_1616524 3300048904 Unclassified 503
506 Ga0496102_0019241 3300048905 Bacteria 6015
507 Ga0496103_0080529 3300048906 Bacteria 2048
508 Ga0496103_0160495 3300048906 Bacteria 1442
509 Ga0496104_0001365 3300048907 Bacteria 21129
510 Ga0496104_0007114 3300048907 Bacteria 9866
511 Ga0496104_0196099 3300048907 Unclassified 1931
512 Ga0496104_1327278 3300048907 Unclassified 622
513 Ga0496105_0103324 3300048908 Bacteria 2353
514 Ga0496105_1191847 3300048908 Unclassified 561
515 Ga0496106_0020008 3300048909 Bacteria 4964
516 Ga0496106_0028228 3300048909 Bacteria 4180
517 Ga0496106_0033621 3300048909 Bacteria 3826
518 Ga0496106_1003340 3300048909 Unclassified 656
519 Ga0496107_0074129 3300048910 Bacteria 2476
520 Ga0496107_0097536 3300048910 Bacteria 2152
521 Ga0496107_0561111 3300048910 Bacteria 845
522 Ga0496108_0001370 3300048911 Bacteria 19169
523 Ga0496108_0857710 3300048911 Unclassified 781
524 Ga0496109_0381963 3300048912 Bacteria 1330
525 Ga0496109_0830476 3300048912 Bacteria 862
526 Ga0496110_0022267 3300048913 Bacteria 5378
527 Ga0496110_0377205 3300048913 Bacteria 1292
528 Ga0496110_0685436 3300048913 Bacteria 926
529 Ga0496111_0279764 3300048914 Bacteria 1237
530 Ga0496111_0800040 3300048914 Unclassified 682
531 Ga0496112_0024490 3300048915 Bacteria 5780
532 Ga0496113_0012517 3300048916 Bacteria 5705
533 Ga0496114_0001930 3300048917 Bacteria 15785
534 Ga0496114_0025758 3300048917 Unclassified 4810
535 Ga0496114_1284294 3300048917 Unclassified 619
536 Ga0496115_0071851 3300048918 Bacteria 2807
537 Ga0501299_072859 3300049522 Bacteria 749
538 Ga0501031_0372384 3300049568 Unclassified 924
539 Ga0501031_1108567 3300049568 Bacteria 505
540 Ga0501032_0032104 3300049569 Bacteria 3598
541 Ga0501033_0005243 3300049570 Bacteria 10290
542 Ga0501034_0090500 3300049571 Bacteria 3057
543 Ga0501036_0002198 3300049572 Bacteria 15243
544 Ga0501036_0133951 3300049572 Bacteria 2091
545 Ga0501036_0548823 3300049572 Unclassified 960
546 Ga0501036_0927803 3300049572 Bacteria 714
547 Ga0501037_0010285 3300049573 Bacteria 6867
548 Ga0501037_0081379 3300049573 Bacteria 2348
549 Ga0501038_0032850 3300049574 Bacteria 4573
550 Ga0501038_0236781 3300049574 Bacteria 1451
551 Ga0501038_0338174 3300049574 Bacteria 1174
552 Ga0501038_1083971 3300049574 Bacteria 585
553 Ga0501039_0008966 3300049575 Bacteria 7622
554 Ga0501039_0051775 3300049575 Bacteria 3177
555 Ga0501040_0104371 3300049576 Bacteria 1979
556 Ga0501040_0371464 3300049576 Bacteria 1026
557 Ga0501040_0834425 3300049576 Bacteria 667
558 Ga0501041_0004230 3300049577 Bacteria 8311
559 Ga0501042_0004487 3300049578 Bacteria 8905
560 Ga0501042_0072427 3300049578 Bacteria 2466
561 Ga0501043_0104058 3300049579 Bacteria 2230
562 Ga0501046_0065908 3300049580 Bacteria 2824
563 Ga0501046_0096386 3300049580 Bacteria 2272
564 Ga0501046_0280151 3300049580 Bacteria 1221
565 Ga0501047_0023715 3300049581 Bacteria 5890
566 Ga0501047_0963095 3300049581 Bacteria 666
567 Ga0501047_1096913 3300049581 Unclassified 609
568 Ga0501048_0011832 3300049582 Bacteria 6505
569 Ga0501048_0415507 3300049582 Bacteria 962
570 Ga0501067_0744289 3300049583 Bacteria 552
571 Ga0501068_0013957 3300049584 Bacteria 4582
572 Ga0501069_0028673 3300049585 Bacteria 3053
573 Ga0501070_0005098 3300049586 Bacteria 11197
574 Ga0501071_0053442 3300049587 Bacteria 2914
575 Ga0501071_0266514 3300049587 Unclassified 1294
576 Ga0501071_0313602 3300049587 Bacteria 1190
577 Ga0501071_0838044 3300049587 Bacteria 709
578 Ga0501071_1115938 3300049587 Bacteria 609
579 Ga0501072_0105236 3300049588 Bacteria 2244
580 Ga0501072_0622390 3300049588 Bacteria 850
581 Ga0501073_0477835 3300049589 Bacteria 862
582 Ga0501074_0126375 3300049590 Bacteria 1829
583 Ga0501075_0050971 3300049591 Bacteria 3112
584 Ga0501075_0112594 3300049591 Bacteria 2069
585 Ga0501076_0093818 3300049592 Bacteria 2416
586 Ga0501076_0161500 3300049592 Unclassified 1825
587 Ga0501076_0164977 3300049592 Bacteria 1805
588 Ga0501076_0539986 3300049592 Bacteria 961
589 Ga0501202_164995 3300049652 Bacteria 588
590 Ga0501210_032436 3300049657 Bacteria 547
591 Ga0501233_219750 3300049668 Bacteria 560
592 Ga0501235_084909 3300049669 Bacteria 760
593 Ga0501234_033730 3300049707 Bacteria 830
594 Ga0501079_0002818 3300049741 Bacteria 12678
595 Ga0501079_0193302 3300049741 Unclassified 1588
596 Ga0501079_0421337 3300049741 Bacteria 1048
597 Ga0501079_1146174 3300049741 Bacteria 613
598 Ga0501080_0132285 3300049742 Bacteria 2310
599 Ga0501080_0532119 3300049742 Bacteria 1048
600 Ga0501080_0773225 3300049742 Unclassified 843
601 Ga0501081_0348417 3300049743 Bacteria 1091
602 Ga0501083_0015233 3300049744 Bacteria 5383
603 Ga0501083_0271909 3300049744 Unclassified 1102
604 Ga0501270_087642 3300049767 Bacteria 630
605 Ga0501035_0068896 3300049822 Bacteria 3137
606 Ga0501035_0174746 3300049822 Bacteria 1853
607 Ga0501044_0048583 3300049823 Bacteria 4381
608 Ga0501044_0071915 3300049823 Bacteria 3517
609 Ga0501045_0010008 3300049824 Bacteria 6632
610 Ga0501045_0037247 3300049824 Bacteria 3535
611 Ga0501045_0423805 3300049824 Bacteria 990
612 nmdc:mga0k408_158217_c1 3300050493 Bacteria 1349
613 nmdc:mga06z11_157318_c1 3300050494 Unclassified 1296
614 nmdc:mga06z11_190421_c1 3300050494 Unclassified 1187
615 nmdc:mga06z11_403635_c1 3300050494 Bacteria 823
616 nmdc:mga04h51_163803_c1 3300050495 Bacteria 857
617 nmdc:mga05p37_1210617_c1 3300050507 Unclassified 779
618 nmdc:mga05p37_1389172_c1 3300050507 Unclassified 708
619 nmdc:mga05p37_168708_c1 3300050507 Unclassified 2670
620 nmdc:mga05p37_218570_c1 3300050507 Bacteria 2301
621 nmdc:mga05p37_368570_c1 3300050507 Bacteria 1686
622 nmdc:mga05p37_891926_c1 3300050507 Unclassified 960
623 nmdc:mga09592_471514_c1 3300050508 Bacteria 1082
624 nmdc:mga09592_566921_c1 3300050508 Bacteria 975
625 nmdc:mga09592_68207_c1 3300050508 Unclassified 3017
626 nmdc:mga09592_912276_c1 3300050508 Bacteria 738
627 nmdc:mga0qj67_10972_c1 3300050509 Bacteria 6781
628 nmdc:mga0qj67_1126434_c1 3300050509 Bacteria 612
629 nmdc:mga0qj67_199517_c1 3300050509 Bacteria 1626
630 nmdc:mga0qj67_251088_c1 3300050509 Unclassified 1435
631 nmdc:mga0qj67_343566_c1 3300050509 Unclassified 1207
632 nmdc:mga06r32_1236_c1 3300050510 Bacteria 22978
633 nmdc:mga06r32_144306_c1 3300050510 Bacteria 2358
634 nmdc:mga06r32_1841015_c1 3300050510 Unclassified 540
635 nmdc:mga06r32_224840_c1 3300050510 Bacteria 1865
636 nmdc:mga06r32_228408_c1 3300050510 Bacteria 1849
637 nmdc:mga06r32_307113_c1 3300050510 Bacteria 1572
638 nmdc:mga06r32_351289_c1 3300050510 Bacteria 1459
639 nmdc:mga06r32_5733_c1 3300050510 Bacteria 11180
640 nmdc:mga08y16_14182_c1 3300050511 Bacteria 8386
641 nmdc:mga08y16_44588_c1 3300050511 Bacteria 4646
642 nmdc:mga08y16_50228_c1 3300050511 Bacteria 4365
643 nmdc:mga08y16_74583_c1 3300050511 Unclassified 3535
644 nmdc:mga0n895_1754376_c1 3300050512 Bacteria 582
645 nmdc:mga0n895_1776560_c1 3300050512 Unclassified 578
646 nmdc:mga08x19_5550_c1 3300050514 Bacteria 7458
647 nmdc:mga0a205_261500_c1 3300050515 Bacteria 1608
648 nmdc:mga0a205_567093_c1 3300050515 Unclassified 990
649 Ga0495601_0052171 3300053077 Bacteria 2582
650 Ga0495601_0084047 3300053077 Unclassified 2045
651 Ga0495601_0126410 3300053077 Unclassified 1663
652 Ga0495619_0159600 3300053085 Bacteria 1557
653 Ga0495619_1146194 3300053085 Unclassified 516
654 Ga0501084_0006324 3300054114 Bacteria 9726
655 Ga0501084_0175911 3300054114 Bacteria 1807
656 Ga0501084_0467408 3300054114 Bacteria 1066
657 Ga0587066_002233 3300059490 Bacteria 2103
658 Ga0587073_0067117 3300059492 Unclassified 857
659 Ga0587082_010406 3300059504 Unclassified 1342
660 Ga0587062_100161 3300059639 Unclassified 563
661 Ga0587067_006844 3300059640 Unclassified 1607
662 Ga0587076_003686 3300059645 Bacteria 1850
663 Ga0501082_0027190 3300060353 Unclassified 4927
664 Ga0501082_0798921 3300060353 Unclassified 825
665 Ga0501082_1339055 3300060353 Bacteria 625
666 Ga0530510_0148656 3300061734 Unclassified 1729
667 Ga0105240_10046641
668 MRS1b_contig_5195114
669 MRS1b_contig_740034
670 JGI24751J29686_10003640
671 JGI25406J46586_10091420
672 JGI25406J46586_10109353
673 Ga0058863_11081517
674 Ga0065714_10293225
675 Ga0065712_10071338
676 Ga0065715_10002039
677 Ga0065715_10018848
678 Ga0065715_10415544
679 Ga0065715_10460764
680 Ga0065707_10612148
681 Ga0070676_10163202
682 Ga0070676_10458546
683 Ga0070683_100213608
684 Ga0070690_100040738
685 Ga0070670_100020088
686 Ga0070670_100021417
687 Ga0070670_100041275
688 Ga0070670_100353014
689 Ga0070677_10001446
690 Ga0070677_10126706
691 Ga0068869_100573325
692 Ga0068869_100609120
693 Ga0070666_10279591
694 Ga0070666_11191642
695 Ga0070680_100715344
696 Ga0070682_102083586
697 Ga0068868_100078229
698 Ga0068868_100170782
699 Ga0068868_100393974
700 Ga0068868_100424863
701 Ga0068868_101101557
702 Ga0070689_101841780
703 Ga0070687_100963637
704 Ga0070661_100709951
705 Ga0070661_101112658
706 Ga0070692_10177449
707 Ga0070668_100164774
708 Ga0070668_101321968
709 Ga0070669_100820956
710 Ga0070669_101418887
711 Ga0070675_100005217
712 Ga0070671_100160423
713 Ga0070674_100000307
714 Ga0070674_100654079
715 Ga0070674_101105099
716 Ga0070673_100283118
717 Ga0070673_100918187
718 Ga0070688_100018900
719 Ga0070688_100022771
720 Ga0070688_101074615
721 Ga0070659_100541214
722 Ga0070703_10596503
723 Ga0070713_100826684
724 Ga0070713_101357621
725 Ga0070710_10123209
726 Ga0070711_100029998
727 Ga0070711_100080902
728 Ga0070700_100764479
729 Ga0070700_101750738
730 Ga0070694_100016722
731 Ga0070708_100719806
732 Ga0070663_100120235
733 Ga0070678_100307148
734 Ga0070678_100525556
735 Ga0070662_100851842
736 Ga0070662_101105272
737 Ga0070681_10410097
738 Ga0068867_100156641
739 Ga0068867_100171868
740 Ga0068867_100202440
741 Ga0068867_100450762
742 Ga0068867_100457076
743 Ga0070685_10334092
744 Ga0070685_10702247
745 Ga0070706_101862115
746 Ga0070707_100981218
747 Ga0070698_101099260
748 Ga0070684_100693252
749 Ga0068853_100425400
750 Ga0070672_100020736
751 Ga0070672_100302653
752 Ga0070672_100390212
753 Ga0070672_101971643
754 Ga0070695_100741603
755 Ga0070696_100539513
756 Ga0070696_101140699
757 Ga0070665_100041496
758 Ga0070665_101195485
759 Ga0070665_101282832
760 Ga0070665_101522848
761 Ga0070704_100265426
762 Ga0070704_100421039
763 Ga0068855_100010940
764 Ga0068855_100401009
765 Ga0068855_101397139
766 Ga0070664_100557549
767 Ga0070664_100559760
768 Ga0070664_100747514
769 Ga0068857_100446286
770 Ga0068854_100785270
771 Ga0068856_100336073
772 Ga0068856_100488892
773 Ga0070702_100437715
774 Ga0070702_101825646
775 Ga0068852_100031260
776 Ga0068852_100958485
777 Ga0068859_100008926
778 Ga0068859_100217051
779 Ga0068859_100464283
780 Ga0068859_100659865
781 Ga0068859_100933251
782 Ga0068859_101213715
783 Ga0068859_101247649
784 Ga0068864_100036903
785 Ga0068864_100110508
786 Ga0068864_100955617
787 Ga0068864_101006639
788 Ga0068864_101459469
789 Ga0068861_100010164
790 Ga0068861_100091237
791 Ga0068861_100165737
792 Ga0068861_100360493
793 Ga0068851_10353003
794 Ga0068851_10556629
795 Ga0068851_10631266
796 Ga0068863_100062968
797 Ga0068863_100196237
798 Ga0068858_100063102
799 Ga0068858_100225273
800 Ga0068858_100307130
801 Ga0068858_100369762
802 Ga0068858_101225909
803 Ga0068858_102174268
804 Ga0068860_100281147
805 Ga0068860_101193486
806 Ga0068860_101347068
807 Ga0068860_101497526
808 Ga0068860_101551407
809 Ga0068860_101963539
810 Ga0068862_100059679
811 Ga0068862_100100433
812 Ga0068862_100256496
813 Ga0081539_10011080
814 Ga0075432_10432598
815 Ga0070716_100953341
816 Ga0070712_100733517
817 Ga0070712_100943341
818 Ga0097621_100178905
819 Ga0097621_100976482
820 Ga0075370_10755578
821 Ga0068871_100002176
822 Ga0068871_100011672
823 Ga0068871_100074423
824 Ga0068871_100274090
825 Ga0068871_100625617
826 Ga0068871_100730043
827 Ga0075428_100368649
828 Ga0075428_100588904
829 Ga0075428_101889155
830 Ga0075428_102164266
831 Ga0075430_100123675
832 Ga0075430_100159052
833 Ga0075431_100003946
834 Ga0075431_100029426
835 Ga0075431_100049346
836 Ga0075431_100179005
837 Ga0075431_100241241
838 Ga0075431_100916373
839 Ga0075433_10141168
840 Ga0075434_100771572
841 Ga0075429_100198973
842 Ga0075429_100496737
843 Ga0068865_100013141
844 Ga0068865_100014070
845 Ga0068865_100270839
846 Ga0068865_100473492
847 Ga0068865_100561097
848 Ga0097620_100008926
849 Ga0097620_100217047
850 Ga0097620_100464299
851 Ga0097620_100659792
852 Ga0097620_100933306
853 Ga0097620_101213638
854 Ga0097620_101247770
855 Ga0075435_100121289
856 Ga0105240_10016160
857 Ga0105240_10092018
858 Ga0105240_10299134
859 Ga0105240_11390098
860 Ga0111539_10005227
861 Ga0111539_10008058
862 Ga0111539_10009808
863 Ga0111539_10056198
864 Ga0111539_10290144
865 Ga0105245_10026920
866 Ga0105245_10123297
867 Ga0105245_10358521
868 Ga0105245_10943631
869 Ga0105245_11058680
870 Ga0105247_10002954
871 Ga0105247_11711773
872 Ga0114129_10114708
873 Ga0114129_10519142
874 Ga0114129_10606557
875 Ga0114129_11268132
876 Ga0105243_10280656
877 Ga0105243_11077758
878 Ga0105243_11273098
879 Ga0105241_10214339
880 Ga0105241_10420119
881 Ga0105241_10576632
882 Ga0105241_10868775
883 Ga0105241_10949745
884 Ga0105242_10046347
885 Ga0105242_10305874
886 Ga0105242_11087665
887 Ga0105242_11239441
888 Ga0105242_13071727
889 Ga0105248_10087167
890 Ga0105248_10126008
891 Ga0105248_10133477
892 Ga0105248_10242314
893 Ga0105248_10575453
894 Ga0105248_12671635
895 Ga0105237_10052267
896 Ga0105237_10173196
897 Ga0105238_10016400
898 Ga0105238_10547016
899 Ga0105238_11750782
900 Ga0105238_11790512
901 Ga0105249_10012139
902 Ga0105249_10426104
903 Ga0105249_12540994
904 Ga0105249_12693408
905 Ga0105239_10354911
906 Ga0105239_10372324
907 Ga0105239_11197310
908 Ga0105246_10555640
909 Ga0105246_11685339
910 Ga0157341_1031947
911 Ga0157373_10724397
912 Ga0157370_10088108
913 Ga0157369_10016350
914 Ga0157369_11497403
915 Ga0157374_10010014
916 Ga0157374_10396718
917 Ga0157374_10717125
918 Ga0157374_10737405
919 Ga0157374_11152476
920 Ga0157378_10101095
921 Ga0157378_10138307
922 Ga0157378_10814514
923 Ga0157378_10847814
924 Ga0157378_11982389
925 Ga0157378_12022641
926 Ga0163162_10138156
927 Ga0163162_10181071
928 Ga0163162_10227962
929 Ga0163162_10353191
930 Ga0163162_10473020
931 Ga0163162_11208910
932 Ga0157372_10045023
933 Ga0157372_10739492
934 Ga0157375_10003346
935 Ga0157375_10219377
936 Ga0157375_10317730
937 Ga0157375_10638114
938 Ga0157375_10810529
939 Ga0157375_11095776
940 Ga0163163_10023292
941 Ga0163163_10231639
942 Ga0163163_10992900
943 Ga0163163_12525476
944 Ga0157380_10003695
945 Ga0157380_10174576
946 Ga0157377_11319198
947 Ga0157379_10015069
948 Ga0157379_10047025
949 Ga0157379_10051726
950 Ga0157379_10560289
951 Ga0157379_10571334
952 Ga0157376_10170445
953 Ga0157376_10364873
954 Ga0157376_10736798
955 Ga0157376_10854841
956 Ga0157376_11281595
957 Ga0163161_10366143
958 Ga0207697_10096856
959 Ga0207682_10002516
960 Ga0207682_10045835
961 Ga0207710_10111086
962 Ga0207710_10227569
963 Ga0207680_10363612
964 Ga0207645_10015544
965 Ga0207645_10030716
966 Ga0207705_10680443
967 Ga0207684_11343831
968 Ga0207654_10263514
969 Ga0207654_10463527
970 Ga0207654_10982034
971 Ga0207707_10302309
972 Ga0207695_10100639
973 Ga0207695_11190077
974 Ga0207671_10527331
975 Ga0207671_10849451
976 Ga0207693_10040820
977 Ga0207660_10454930
978 Ga0207662_10255303
979 Ga0207649_10634296
980 Ga0207681_10605187
981 Ga0207681_10696688
982 Ga0207694_11137316
983 Ga0207650_10032248
984 Ga0207650_10456625
985 Ga0207659_10026321
986 Ga0207659_10843933
987 Ga0207687_10381650
988 Ga0207687_11059643
989 Ga0207687_11349798
990 Ga0207687_11643864
991 Ga0207700_10007045
992 Ga0207700_11020536
993 Ga0207700_11047509
994 Ga0207690_11046388
995 Ga0207706_10109978
996 Ga0207706_10898088
997 Ga0207686_10485752
998 Ga0207686_11285621
999 Ga0207686_11838697
1000 Ga0207709_11468181
1001 Ga0207670_10657325
1002 Ga0207670_10744680
1003 Ga0207670_10776756
1004 Ga0207670_11041324
1005 Ga0207669_10007886
1006 Ga0207669_10352324
1007 Ga0207669_10737879
1008 Ga0207704_10042269
1009 Ga0207704_10088470
1010 Ga0207704_10666140
1011 Ga0207704_10922193
1012 Ga0207665_10663527
1013 Ga0207691_10009082
1014 Ga0207691_10117601
1015 Ga0207691_10166042
1016 Ga0207691_10567255
1017 Ga0207711_10034878
1018 Ga0207711_10177234
1019 Ga0207711_10219589
1020 Ga0207711_10323457
1021 Ga0207689_10100967
1022 Ga0207689_10112530
1023 Ga0207689_11229983
1024 Ga0207679_10268169
1025 Ga0207679_10678691
1026 Ga0207667_10019273
1027 Ga0207667_10100094
1028 Ga0207667_11967340
1029 Ga0207712_10932078
1030 Ga0207712_11449547
1031 Ga0207668_10195244
1032 Ga0207668_10250624
1033 Ga0207668_10386602
1034 Ga0207640_11130362
1035 Ga0207658_10305132
1036 Ga0207658_10326483
1037 Ga0207658_11798446
1038 Ga0207677_10060411
1039 Ga0207677_10117751
1040 Ga0207677_10233937
1041 Ga0207703_10049086
1042 Ga0207703_10085248
1043 Ga0207703_10402982
1044 Ga0207703_10865463
1045 Ga0207703_11256094
1046 Ga0207639_10082047
1047 Ga0207639_10159600
1048 Ga0207639_10282134
1049 Ga0207678_10028247
1050 Ga0207708_10080950
1051 Ga0207708_10273390
1052 Ga0207708_11554183
1053 Ga0207702_10185012
1054 Ga0207702_11798683
1055 Ga0207641_10097254
1056 Ga0207648_10151874
1057 Ga0207648_10216392
1058 Ga0207648_10234266
1059 Ga0207648_10258169
1060 Ga0207648_10473612
1061 Ga0207648_10770338
1062 Ga0207676_10073559
1063 Ga0207676_10361482
1064 Ga0207676_11126609
1065 Ga0207676_11346851
1066 Ga0207674_10210913
1067 Ga0207674_10429876
1068 Ga0207674_11252003
1069 Ga0207675_100041027
1070 Ga0207675_100251628
1071 Ga0207675_100832153
1072 Ga0207683_10015712
1073 Ga0207683_10018393
1074 Ga0207683_10270160
1075 Ga0207698_10460408
1076 Ga0207698_10868075
1077 Ga0207698_11036509
1078 Ga0207698_11490967
1079 Ga0207698_11622382
1080 Ga0207698_11687626
1081 Ga0207698_11970148
1082 Ga0209966_1011553
1083 Ga0209813_10352732
1084 Ga0207428_10000649
1085 Ga0207428_10033847
1086 Ga0207428_10120612
1087 Ga0268266_10006975
1088 Ga0268266_10848815
1089 Ga0268265_10005594
1090 Ga0268265_10030611
1091 Ga0268265_10337414
1092 Ga0268264_10167898
1093 Ga0268264_10590707
1094 Ga0268264_11684164
1095 Ga0268264_11993166
1096 Ga0307511_10176887
1097 Ga0265770_1088108
1098 Ga0307408_100102714
1099 Ga0307408_100220781
1100 Ga0307413_10188838
1101 Ga0307413_11196461
1102 Ga0307410_11002143
1103 Ga0307406_10251729
1104 Ga0307407_11234239
1105 Ga0307412_10021968
1106 Ga0307412_10242507
1107 Ga0307416_100053221
1108 Ga0307416_102133806
1109 Ga0307411_10050857
1110 Ga0307411_10363785
1111 Ga0307415_100581424
1112 Ga0373936_0154340
1113 Ga0373936_0411551
1114 Ga0373943_0102940
1115 Ga0373933_0051993
1116 Ga0373937_0002319
1117 Ga0373937_0166396
1118 Ga0373925_0028264
1119 Ga0395900_0615818
1120 Ga0395898_0072061
1121 Ga0436364_0258828
1122 Ga0436364_0682033
1123 Ga0436364_1184380
1124 Ga0436364_1257404
1125 Ga0436364_1354873
1126 Ga0436365_0087518
1127 Ga0436365_1409158
1128 Ga0436362_0342569
1129 Ga0451791_0508529
1130 Ga0451853_0082413
1131 Ga0439446_0052210
1132 Ga0439435_0020006
1133 Ga0439435_0327777
1134 Ga0451577_0011100
1135 Ga0439440_0079271
1136 Ga0453684_0489788
1137 Ga0466971_0446233
1138 Ga0451576_0062376
1139 Ga0451576_0102600
1140 Ga0495629_0029624
1141 Ga0495629_0072694
1142 Ga0495582_0432379
1143 Ga0495662_0155289
1144 Ga0495584_0396746
1145 Ga0495652_0681138
1146 Ga0495640_0099829
1147 Ga0495586_0049976
1148 Ga0495667_0134045
1149 Ga0495667_0167737
1150 Ga0495635_0075763
1151 Ga0495635_0271631
1152 Ga0495659_0039183
1153 Ga0495613_0433857
1154 Ga0495613_0440530
1155 Ga0495589_0525320
1156 Ga0495600_0086389
1157 Ga0495674_0201055
1158 Ga0495672_0013882
1159 Ga0495672_0078412
1160 Ga0495672_0247962
1161 Ga0495677_0254877
1162 Ga0495685_273648
1163 Ga0495684_0229420
1164 Ga0495684_0654714
1165 Ga0495684_0808107
1166 Ga0496100_0140867
1167 Ga0496100_0260647
1168 Ga0496101_0000225
1169 Ga0496101_0151400
1170 Ga0496101_0488582
1171 Ga0496101_1616524
1172 Ga0496102_0019241
1173 Ga0496103_0080529
1174 Ga0496103_0160495
1175 Ga0496104_0001365
1176 Ga0496104_0007114
1177 Ga0496104_0196099
1178 Ga0496104_1327278
1179 Ga0496105_0103324
1180 Ga0496105_1191847
1181 Ga0496106_0020008
1182 Ga0496106_0028228
1183 Ga0496106_0033621
1184 Ga0496106_1003340
1185 Ga0496107_0074129
1186 Ga0496107_0097536
1187 Ga0496107_0561111
1188 Ga0496108_0001370
1189 Ga0496108_0857710
1190 Ga0496109_0381963
1191 Ga0496109_0830476
1192 Ga0496110_0022267
1193 Ga0496110_0377205
1194 Ga0496110_0685436
1195 Ga0496111_0279764
1196 Ga0496111_0800040
1197 Ga0496112_0024490
1198 Ga0496113_0012517
1199 Ga0496114_0001930
1200 Ga0496114_0025758
1201 Ga0496114_1284294
1202 Ga0496115_0071851
1203 Ga0501299_072859
1204 Ga0501031_0372384
1205 Ga0501031_1108567
1206 Ga0501032_0032104
1207 Ga0501033_0005243
1208 Ga0501034_0090500
1209 Ga0501036_0002198
1210 Ga0501036_0133951
1211 Ga0501036_0548823
1212 Ga0501036_0927803
1213 Ga0501037_0010285
1214 Ga0501037_0081379
1215 Ga0501038_0032850
1216 Ga0501038_0236781
1217 Ga0501038_0338174
1218 Ga0501038_1083971
1219 Ga0501039_0008966
1220 Ga0501039_0051775
1221 Ga0501040_0104371
1222 Ga0501040_0371464
1223 Ga0501040_0834425
1224 Ga0501041_0004230
1225 Ga0501042_0004487
1226 Ga0501042_0072427
1227 Ga0501043_0104058
1228 Ga0501046_0065908
1229 Ga0501046_0096386
1230 Ga0501046_0280151
1231 Ga0501047_0023715
1232 Ga0501047_0963095
1233 Ga0501047_1096913
1234 Ga0501048_0011832
1235 Ga0501048_0415507
1236 Ga0501067_0744289
1237 Ga0501068_0013957
1238 Ga0501069_0028673
1239 Ga0501070_0005098
1240 Ga0501071_0053442
1241 Ga0501071_0266514
1242 Ga0501071_0313602
1243 Ga0501071_0838044
1244 Ga0501071_1115938
1245 Ga0501072_0105236
1246 Ga0501072_0622390
1247 Ga0501073_0477835
1248 Ga0501074_0126375
1249 Ga0501075_0050971
1250 Ga0501075_0112594
1251 Ga0501076_0093818
1252 Ga0501076_0161500
1253 Ga0501076_0164977
1254 Ga0501076_0539986
1255 Ga0501202_164995
1256 Ga0501210_032436
1257 Ga0501233_219750
1258 Ga0501235_084909
1259 Ga0501234_033730
1260 Ga0501079_0002818
1261 Ga0501079_0193302
1262 Ga0501079_0421337
1263 Ga0501079_1146174
1264 Ga0501080_0132285
1265 Ga0501080_0532119
1266 Ga0501080_0773225
1267 Ga0501081_0348417
1268 Ga0501083_0015233
1269 Ga0501083_0271909
1270 Ga0501270_087642
1271 Ga0501035_0068896
1272 Ga0501035_0174746
1273 Ga0501044_0048583
1274 Ga0501044_0071915
1275 Ga0501045_0010008
1276 Ga0501045_0037247
1277 Ga0501045_0423805
1278 nmdc:mga0k408_158217_c1
1279 nmdc:mga06z11_157318_c1
1280 nmdc:mga06z11_190421_c1
1281 nmdc:mga06z11_403635_c1
1282 nmdc:mga04h51_163803_c1
1283 nmdc:mga05p37_1210617_c1
1284 nmdc:mga05p37_1389172_c1
1285 nmdc:mga05p37_168708_c1
1286 nmdc:mga05p37_218570_c1
1287 nmdc:mga05p37_368570_c1
1288 nmdc:mga05p37_891926_c1
1289 nmdc:mga09592_471514_c1
1290 nmdc:mga09592_566921_c1
1291 nmdc:mga09592_68207_c1
1292 nmdc:mga09592_912276_c1
1293 nmdc:mga0qj67_10972_c1
1294 nmdc:mga0qj67_1126434_c1
1295 nmdc:mga0qj67_199517_c1
1296 nmdc:mga0qj67_251088_c1
1297 nmdc:mga0qj67_343566_c1
1298 nmdc:mga06r32_1236_c1
1299 nmdc:mga06r32_144306_c1
1300 nmdc:mga06r32_1841015_c1
1301 nmdc:mga06r32_224840_c1
1302 nmdc:mga06r32_228408_c1
1303 nmdc:mga06r32_307113_c1
1304 nmdc:mga06r32_351289_c1
1305 nmdc:mga06r32_5733_c1
1306 nmdc:mga08y16_14182_c1
1307 nmdc:mga08y16_44588_c1
1308 nmdc:mga08y16_50228_c1
1309 nmdc:mga08y16_74583_c1
1310 nmdc:mga0n895_1754376_c1
1311 nmdc:mga0n895_1776560_c1
1312 nmdc:mga08x19_5550_c1
1313 nmdc:mga0a205_261500_c1
1314 nmdc:mga0a205_567093_c1
1315 Ga0495601_0052171
1316 Ga0495601_0084047
1317 Ga0495601_0126410
1318 Ga0495619_0159600
1319 Ga0495619_1146194
1320 Ga0501084_0006324
1321 Ga0501084_0175911
1322 Ga0501084_0467408
1323 Ga0587066_002233
1324 Ga0587073_0067117
1325 Ga0587082_010406
1326 Ga0587062_100161
1327 Ga0587067_006844
1328 Ga0587076_003686
1329 Ga0501082_0027190
1330 Ga0501082_0798921
1331 Ga0501082_1339055
1332 Ga0530510_0148656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

32

107

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9463 11 107
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9433 11 107
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9177 6 110
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9138 6 108
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9118 6 108
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9143 10 107 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9118 6 108 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9015 6 110 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8948 6 108 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.88 13 95 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3N5LS61-F1-model_v4 PadR family transcriptional regulator 0.9988 10 110
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9968 10 89
AF-A0A6B9YSR4-F1-model_v4 PadR family transcriptional regulator 0.9946 1 108
AF-A0A2Z5G063-F1-model_v4 Transcriptional regulator, PadR family 0.9945 6 110
AF-A0A1Q7K8V1-F1-model_v4 PadR family transcriptional regulator 0.9942 6 108

Map