F473644

General Info

Members Datasets Scaffolds Average Seq Length
664 281 1328 139

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0084065|Ga0453683_0084065_1406_1852
Length 148
Sequence MSDPSQSKSAAQPFPHLKEDPAPSQPLTLLAVATPILGWLVPGGGHFLQKRWGRGALLALSVTSMFVMGLLMQGKVYSANFGDILDVLGFVGNLGAGCLYLMTRAFDWGHGSINLATADYGTKFIIVAGLLNVISAVDAYDIAIGKKP

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
122 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
204 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 1.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.38
Rhizosphere 91.11
Stem 0
Stem Tuber 0
Unclassified 28.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0084065 3300044673 Bacteria 1994
2 JGI24752J21851_1005183 3300001976 Bacteria 1706
3 JGI24737J22298_10062513 3300001990 Bacteria 1119
4 JGI24749J21850_1014250 3300002076 Bacteria 1114
5 JGI24751J29686_10000897 3300002459 Bacteria 6802
6 Ga0058859_10837192 3300004798 Bacteria 660
7 Ga0065712_10004139 3300005290 Bacteria 3364
8 Ga0065715_10091689 3300005293 Bacteria 5616
9 Ga0065707_10670428 3300005295 Bacteria 653
10 Ga0070658_10046918 3300005327 Bacteria 3496
11 Ga0070676_10013721 3300005328 Unclassified 4441
12 Ga0070683_100008827 3300005329 Bacteria 8576
13 Ga0070690_100354913 3300005330 Bacteria 1065
14 Ga0070670_100031846 3300005331 Bacteria 4541
15 Ga0070670_100033866 3300005331 Bacteria 4399
16 Ga0070677_10013649 3300005333 Bacteria 2846
17 Ga0068869_100028188 3300005334 Bacteria 3922
18 Ga0068869_100029145 3300005334 Bacteria 3864
19 Ga0068869_100423063 3300005334 Bacteria 1099
20 Ga0070666_10474238 3300005335 Bacteria 905
21 Ga0070666_10514694 3300005335 Bacteria 868
22 Ga0070680_100058493 3300005336 Unclassified 3152
23 Ga0070680_100169592 3300005336 Bacteria 1836
24 Ga0070682_100268276 3300005337 Bacteria 1239
25 Ga0070682_101247167 3300005337 Unclassified 629
26 Ga0068868_100012207 3300005338 Bacteria 6276
27 Ga0068868_100012948 3300005338 Bacteria 6102
28 Ga0068868_100038646 3300005338 Bacteria 3705
29 Ga0068868_100053277 3300005338 Bacteria 3187
30 Ga0068868_100869427 3300005338 Bacteria 817
31 Ga0068868_100877012 3300005338 Unclassified 814
32 Ga0070660_100001606 3300005339 Bacteria 15529
33 Ga0070689_100085365 3300005340 Bacteria 2482
34 Ga0070687_100016278 3300005343 Bacteria 3387
35 Ga0070661_100006213 3300005344 Bacteria 8237
36 Ga0070661_100169521 3300005344 Bacteria 1657
37 Ga0070668_100038070 3300005347 Bacteria 3674
38 Ga0070669_100003780 3300005353 Bacteria 10935
39 Ga0070675_100020211 3300005354 Bacteria 5313
40 Ga0070671_100105310 3300005355 Bacteria 2367
41 Ga0070673_100025124 3300005364 Bacteria 4379
42 Ga0070673_100282077 3300005364 Unclassified 1457
43 Ga0070688_100002957 3300005365 Bacteria 8661
44 Ga0070659_100001742 3300005366 Bacteria 15639
45 Ga0070667_100034672 3300005367 Unclassified 4224
46 Ga0070667_101153071 3300005367 Bacteria 725
47 Ga0070709_10116272 3300005434 Bacteria 1805
48 Ga0070709_10125231 3300005434 Bacteria 1747
49 Ga0070709_10517563 3300005434 Bacteria 909
50 Ga0070714_100117023 3300005435 Bacteria 2367
51 Ga0070714_100356697 3300005435 Unclassified 1374
52 Ga0070714_100905379 3300005435 Unclassified 857
53 Ga0070714_101340938 3300005435 Unclassified 698
54 Ga0070714_101587830 3300005435 Unclassified 639
55 Ga0070714_102113700 3300005435 Unclassified 549
56 Ga0070713_100028094 3300005436 Bacteria 4439
57 Ga0070713_100188965 3300005436 Bacteria 1855
58 Ga0070713_100193824 3300005436 Unclassified 1832
59 Ga0070713_100277168 3300005436 Unclassified 1537
60 Ga0070713_100287493 3300005436 Bacteria 1510
61 Ga0070713_100330681 3300005436 Unclassified 1409
62 Ga0070713_100422878 3300005436 Bacteria 1247
63 Ga0070713_100466587 3300005436 Unclassified 1188
64 Ga0070713_100723133 3300005436 Unclassified 951
65 Ga0070713_100753886 3300005436 Unclassified 931
66 Ga0070713_100931019 3300005436 Bacteria 836
67 Ga0070713_101031705 3300005436 Unclassified 794
68 Ga0070710_10001549 3300005437 Bacteria 10861
69 Ga0070710_10041452 3300005437 Unclassified 2542
70 Ga0070710_10069692 3300005437 Unclassified 2023
71 Ga0070710_10247950 3300005437 Bacteria 1144
72 Ga0070710_10258585 3300005437 Unclassified 1122
73 Ga0070710_10682873 3300005437 Bacteria 723
74 Ga0070711_100212744 3300005439 Bacteria 1498
75 Ga0070711_100287367 3300005439 Unclassified 1303
76 Ga0070708_100000459 3300005445 Bacteria 30632
77 Ga0070708_100024343 3300005445 Bacteria 5164
78 Ga0070708_100052363 3300005445 Bacteria 3620
79 Ga0070663_100006254 3300005455 Bacteria 7140
80 Ga0070678_100024642 3300005456 Unclassified 4033
81 Ga0070662_100004877 3300005457 Bacteria 8511
82 Ga0070681_10004600 3300005458 Bacteria 13176
83 Ga0070681_10154975 3300005458 Bacteria 2216
84 Ga0070681_10443280 3300005458 Unclassified 1210
85 Ga0068867_100012811 3300005459 Bacteria 5934
86 Ga0070685_10001931 3300005466 Bacteria 10760
87 Ga0070685_10113602 3300005466 Unclassified 1672
88 Ga0070706_100000514 3300005467 Bacteria 45375
89 Ga0070706_100002982 3300005467 Bacteria 16776
90 Ga0070706_100030168 3300005467 Bacteria 4995
91 Ga0070706_100078384 3300005467 Bacteria 3059
92 Ga0070707_100000662 3300005468 Bacteria 34318
93 Ga0070707_100008218 3300005468 Bacteria 9680
94 Ga0070707_100339466 3300005468 Bacteria 1459
95 Ga0070707_100517437 3300005468 Bacteria 1155
96 Ga0070698_100000133 3300005471 Bacteria 65381
97 Ga0070698_100002043 3300005471 Bacteria 22426
98 Ga0070698_100041613 3300005471 Unclassified 4717
99 Ga0070698_100141600 3300005471 Bacteria 2356
100 Ga0070698_101397711 3300005471 Bacteria 651
101 Ga0070699_100000441 3300005518 Bacteria 39851
102 Ga0070699_100148651 3300005518 Bacteria 2071
103 Ga0070699_100645449 3300005518 Bacteria 966
104 Ga0070699_101533879 3300005518 Unclassified 611
105 Ga0070679_100007709 3300005530 Bacteria 10077
106 Ga0070679_100307049 3300005530 Bacteria 1537
107 Ga0070679_100642167 3300005530 Bacteria 1004
108 Ga0070679_100753339 3300005530 Unclassified 917
109 Ga0070684_100001890 3300005535 Bacteria 15344
110 Ga0070684_100034871 3300005535 Bacteria 4305
111 Ga0070684_100048290 3300005535 Unclassified 3692
112 Ga0070697_100000158 3300005536 Bacteria 55228
113 Ga0070697_100004513 3300005536 Bacteria 10700
114 Ga0070697_100860253 3300005536 Unclassified 803
115 Ga0070697_101249264 3300005536 Bacteria 662
116 Ga0068853_100023962 3300005539 Bacteria 5115
117 Ga0068853_100030598 3300005539 Unclassified 4548
118 Ga0068853_100107639 3300005539 Unclassified 2472
119 Ga0068853_100128952 3300005539 Bacteria 2262
120 Ga0068853_100290612 3300005539 Bacteria 1509
121 Ga0068853_100668392 3300005539 Bacteria 989
122 Ga0070672_100006210 3300005543 Bacteria 8003
123 Ga0070672_100956800 3300005543 Unclassified 758
124 Ga0070686_100001751 3300005544 Bacteria 12151
125 Ga0070686_100120132 3300005544 Bacteria 1803
126 Ga0070695_100042489 3300005545 Unclassified 2886
127 Ga0070696_100043518 3300005546 Bacteria 3107
128 Ga0070696_100264152 3300005546 Bacteria 1306
129 Ga0070693_100013310 3300005547 Bacteria 4188
130 Ga0070693_100051240 3300005547 Unclassified 2363
131 Ga0070693_100115422 3300005547 Bacteria 1658
132 Ga0070693_100187290 3300005547 Bacteria 1336
133 Ga0070665_100924805 3300005548 Bacteria 885
134 Ga0068855_100016183 3300005563 Bacteria 8967
135 Ga0068855_100100414 3300005563 Bacteria 3332
136 Ga0068855_100173193 3300005563 Bacteria 2443
137 Ga0068855_100711223 3300005563 Unclassified 1074
138 Ga0070664_100103197 3300005564 Bacteria 2482
139 Ga0068857_100011308 3300005577 Bacteria 7766
140 Ga0068854_100074203 3300005578 Unclassified 2495
141 Ga0068854_100082416 3300005578 Bacteria 2378
142 Ga0068854_100111291 3300005578 Bacteria 2066
143 Ga0068856_100036173 3300005614 Unclassified 4841
144 Ga0068856_100047478 3300005614 Unclassified 4229
145 Ga0068856_100064506 3300005614 Bacteria 3619
146 Ga0068856_100131638 3300005614 Bacteria 2506
147 Ga0068856_100841938 3300005614 Unclassified 936
148 Ga0068852_100023791 3300005616 Bacteria 4938
149 Ga0068852_100146592 3300005616 Unclassified 2190
150 Ga0068852_100167955 3300005616 Bacteria 2054
151 Ga0068859_100015642 3300005617 Bacteria 7623
152 Ga0068859_100231181 3300005617 Bacteria 1937
153 Ga0068864_100202753 3300005618 Bacteria 1823
154 Ga0068864_100513341 3300005618 Bacteria 1154
155 Ga0068866_10063788 3300005718 Bacteria 1921
156 Ga0068866_10106325 3300005718 Bacteria 1557
157 Ga0068866_10800270 3300005718 Unclassified 655
158 Ga0068861_100494305 3300005719 Bacteria 1105
159 Ga0068851_10003046 3300005834 Bacteria 7410
160 Ga0068851_10401575 3300005834 Unclassified 806
161 Ga0068863_100012969 3300005841 Bacteria 8036
162 Ga0068863_100283073 3300005841 Bacteria 1607
163 Ga0068863_100544867 3300005841 Bacteria 1145
164 Ga0068858_100001619 3300005842 Bacteria 22968
165 Ga0068858_100031852 3300005842 Bacteria 4900
166 Ga0068860_100005894 3300005843 Bacteria 12335
167 Ga0068860_100164584 3300005843 Bacteria 2140
168 Ga0068860_100430970 3300005843 Bacteria 1308
169 Ga0068860_101049845 3300005843 Bacteria 833
170 Ga0068862_100102267 3300005844 Bacteria 2508
171 Ga0068862_100600571 3300005844 Bacteria 1056
172 Ga0068862_100925398 3300005844 Bacteria 858
173 Ga0070717_10008691 3300006028 Bacteria 7599
174 Ga0070717_10032983 3300006028 Bacteria 4176
175 Ga0070717_10033339 3300006028 Bacteria 4155
176 Ga0070717_10043538 3300006028 Bacteria 3665
177 Ga0070717_10053000 3300006028 Unclassified 3343
178 Ga0070717_10154341 3300006028 Bacteria 1988
179 Ga0070717_10424688 3300006028 Unclassified 1196
180 Ga0070717_10590216 3300006028 Unclassified 1007
181 Ga0070717_10595458 3300006028 Bacteria 1003
182 Ga0070717_11100481 3300006028 Bacteria 724
183 Ga0070717_11719321 3300006028 Unclassified 567
184 Ga0070715_10006826 3300006163 Bacteria 3897
185 Ga0070715_10053637 3300006163 Unclassified 1743
186 Ga0070715_10231786 3300006163 Unclassified 955
187 Ga0070715_10317657 3300006163 Unclassified 839
188 Ga0070715_10355308 3300006163 Unclassified 801
189 Ga0070715_10978224 3300006163 Unclassified 526
190 Ga0070716_100113337 3300006173 Bacteria 1684
191 Ga0070716_100240155 3300006173 Unclassified 1228
192 Ga0070716_101469254 3300006173 Unclassified 556
193 Ga0070716_101780536 3300006173 Unclassified 510
194 Ga0070712_100000618 3300006175 Bacteria 20900
195 Ga0070712_100015567 3300006175 Bacteria 4904
196 Ga0070712_100107060 3300006175 Bacteria 2079
197 Ga0070712_100211627 3300006175 Bacteria 1529
198 Ga0070712_100560590 3300006175 Unclassified 963
199 Ga0097621_100014488 3300006237 Bacteria 5901
200 Ga0097621_100083010 3300006237 Bacteria 2669
201 Ga0097621_100164056 3300006237 Bacteria 1911
202 Ga0097621_100351280 3300006237 Unclassified 1311
203 Ga0097621_100753119 3300006237 Bacteria 900
204 Ga0068871_100000727 3300006358 Bacteria 22355
205 Ga0068871_100085050 3300006358 Bacteria 2625
206 Ga0068871_100413387 3300006358 Unclassified 1203
207 Ga0068871_100734512 3300006358 Bacteria 906
208 Ga0068871_101284448 3300006358 Unclassified 688
209 Ga0075434_100010363 3300006871 Bacteria 8737
210 Ga0068865_100191958 3300006881 Bacteria 1580
211 Ga0068865_100838901 3300006881 Bacteria 795
212 Ga0075436_100067927 3300006914 Bacteria 2463
213 Ga0075436_100078930 3300006914 Bacteria 2280
214 Ga0075436_100244265 3300006914 Bacteria 1277
215 Ga0097620_100015642 3300006931 Bacteria 7623
216 Ga0097620_100231172 3300006931 Bacteria 1937
217 Ga0075435_100010920 3300007076 Bacteria 6655
218 Ga0075435_100078986 3300007076 Unclassified 2699
219 Ga0099795_10096096 3300007788 Unclassified 1156
220 Ga0099795_10253507 3300007788 Unclassified 760
221 Ga0105250_10058724 3300009092 Bacteria 1544
222 Ga0105240_10017855 3300009093 Bacteria 9546
223 Ga0105240_10236771 3300009093 Bacteria 2118
224 Ga0105240_10530084 3300009093 Bacteria 1306
225 Ga0105240_10904541 3300009093 Unclassified 949
226 Ga0105240_11247680 3300009093 Unclassified 786
227 Ga0105240_12623547 3300009093 Unclassified 520
228 Ga0105245_10004451 3300009098 Bacteria 12389
229 Ga0105245_10015530 3300009098 Bacteria 6640
230 Ga0105245_10016248 3300009098 Bacteria 6488
231 Ga0105245_10023501 3300009098 Bacteria 5411
232 Ga0105245_10076932 3300009098 Bacteria 3041
233 Ga0105245_10103758 3300009098 Bacteria 2635
234 Ga0105247_10149755 3300009101 Unclassified 1537
235 Ga0105247_10840865 3300009101 Unclassified 704
236 Ga0114129_10108973 3300009147 Unclassified 3823
237 Ga0105241_10001007 3300009174 Bacteria 21393
238 Ga0105241_10028094 3300009174 Bacteria 4189
239 Ga0105241_10038332 3300009174 Unclassified 3612
240 Ga0105241_10142388 3300009174 Bacteria 1954
241 Ga0105241_10647399 3300009174 Bacteria 959
242 Ga0105242_10077078 3300009176 Bacteria 2781
243 Ga0105242_10101530 3300009176 Bacteria 2438
244 Ga0105242_10167508 3300009176 Unclassified 1928
245 Ga0105248_10011618 3300009177 Bacteria 9700
246 Ga0105248_10181549 3300009177 Bacteria 2371
247 Ga0105248_10341789 3300009177 Bacteria 1685
248 Ga0105237_10090996 3300009545 Unclassified 3040
249 Ga0105237_10122178 3300009545 Bacteria 2598
250 Ga0105237_10314223 3300009545 Unclassified 1570
251 Ga0105238_10007234 3300009551 Bacteria 11111
252 Ga0105238_10025226 3300009551 Bacteria 6058
253 Ga0105238_10050778 3300009551 Bacteria 4174
254 Ga0105238_10107866 3300009551 Unclassified 2765
255 Ga0105238_11476163 3300009551 Bacteria 708
256 Ga0105249_10013908 3300009553 Bacteria 7114
257 Ga0105239_10040875 3300010375 Bacteria 5081
258 Ga0105239_10044409 3300010375 Bacteria 4872
259 Ga0105239_10200638 3300010375 Unclassified 2235
260 Ga0105239_10672912 3300010375 Unclassified 1183
261 Ga0105239_11118363 3300010375 Bacteria 907
262 Ga0105246_10007859 3300011119 Bacteria 6545
263 Ga0157373_10003057 3300013100 Bacteria 12628
264 Ga0157373_10013678 3300013100 Bacteria 5950
265 Ga0157373_10046473 3300013100 Unclassified 3098
266 Ga0157373_10486121 3300013100 Bacteria 891
267 Ga0157373_10837328 3300013100 Unclassified 680
268 Ga0157371_10002264 3300013102 Bacteria 18550
269 Ga0157371_10758414 3300013102 Unclassified 729
270 Ga0157370_10044441 3300013104 Bacteria 4270
271 Ga0157370_10088625 3300013104 Bacteria 2906
272 Ga0157370_10591219 3300013104 Bacteria 1016
273 Ga0157369_10008028 3300013105 Bacteria 12111
274 Ga0157369_10015743 3300013105 Bacteria 8521
275 Ga0157369_10095020 3300013105 Unclassified 3182
276 Ga0157369_10111522 3300013105 Unclassified 2907
277 Ga0157369_10122337 3300013105 Bacteria 2760
278 Ga0157369_10573976 3300013105 Bacteria 1165
279 Ga0157369_10696712 3300013105 Unclassified 1046
280 Ga0157369_12502146 3300013105 Bacteria 523
281 Ga0157374_10000228 3300013296 Bacteria 52018
282 Ga0157374_10097761 3300013296 Bacteria 2810
283 Ga0157374_10119686 3300013296 Unclassified 2540
284 Ga0157374_10140646 3300013296 Bacteria 2343
285 Ga0157374_10899063 3300013296 Unclassified 903
286 Ga0157378_10000351 3300013297 Bacteria 45196
287 Ga0157378_10007903 3300013297 Bacteria 9278
288 Ga0157378_10051290 3300013297 Bacteria 3671
289 Ga0157378_10226359 3300013297 Bacteria 1780
290 Ga0163162_10004210 3300013306 Bacteria 13826
291 Ga0163162_10019239 3300013306 Bacteria 6695
292 Ga0163162_10088487 3300013306 Bacteria 3176
293 Ga0157372_10005053 3300013307 Bacteria 14015
294 Ga0157372_10009228 3300013307 Bacteria 10487
295 Ga0157372_10009344 3300013307 Bacteria 10434
296 Ga0157372_10039206 3300013307 Bacteria 5229
297 Ga0157372_10054048 3300013307 Bacteria 4478
298 Ga0157372_10517749 3300013307 Bacteria 1391
299 Ga0157372_10676801 3300013307 Bacteria 1201
300 Ga0157372_11031544 3300013307 Bacteria 952
301 Ga0157372_12292005 3300013307 Unclassified 620
302 Ga0157372_12294762 3300013307 Unclassified 620
303 Ga0157372_12794936 3300013307 Unclassified 560
304 Ga0157375_10140664 3300013308 Bacteria 2540
305 Ga0157375_10300217 3300013308 Bacteria 1769
306 Ga0163163_10036969 3300014325 Bacteria 4747
307 Ga0163163_10074333 3300014325 Bacteria 3390
308 Ga0163163_10414669 3300014325 Unclassified 1405
309 Ga0157380_10019901 3300014326 Bacteria 5008
310 Ga0182008_10288597 3300014497 Bacteria 856
311 Ga0157377_10004842 3300014745 Bacteria 6260
312 Ga0157379_10028378 3300014968 Bacteria 4978
313 Ga0157379_10209581 3300014968 Bacteria 1764
314 Ga0157379_11281866 3300014968 Unclassified 707
315 Ga0157376_10008129 3300014969 Bacteria 7541
316 Ga0157376_10024032 3300014969 Unclassified 4779
317 Ga0157376_10038962 3300014969 Bacteria 3871
318 Ga0157376_10260880 3300014969 Unclassified 1623
319 Ga0157376_10400097 3300014969 Bacteria 1328
320 Ga0182007_10131503 3300015262 Unclassified 842
321 Ga0163161_10028230 3300017792 Bacteria 3984
322 Ga0206352_10348191 3300020078 Bacteria 759
323 Ga0213873_10035658 3300021358 Bacteria 1259
324 Ga0213874_10106241 3300021377 Unclassified 939
325 Ga0213876_10294716 3300021384 Unclassified 862
326 Ga0213875_10081889 3300021388 Bacteria 1506
327 Ga0224572_1000176 3300024225 Bacteria 5867
328 Ga0224572_1013048 3300024225 Bacteria 1584
329 Ga0224572_1029944 3300024225 Bacteria 1040
330 Ga0228598_1000403 3300024227 Bacteria 8753
331 Ga0228598_1002548 3300024227 Unclassified 3960
332 Ga0228598_1002880 3300024227 Unclassified 3734
333 Ga0207697_10009374 3300025315 Bacteria 4233
334 Ga0207697_10455362 3300025315 Unclassified 567
335 Ga0207656_10173335 3300025321 Bacteria 1032
336 Ga0207696_1036623 3300025711 Bacteria 1456
337 Ga0207682_10018935 3300025893 Bacteria 2694
338 Ga0207692_10003777 3300025898 Bacteria 5947
339 Ga0207692_10062682 3300025898 Unclassified 1930
340 Ga0207692_10071393 3300025898 Unclassified 1831
341 Ga0207692_10122162 3300025898 Unclassified 1460
342 Ga0207692_10219974 3300025898 Bacteria 1125
343 Ga0207692_10220986 3300025898 Unclassified 1123
344 Ga0207692_10245778 3300025898 Unclassified 1070
345 Ga0207692_10599349 3300025898 Bacteria 708
346 Ga0207642_10100494 3300025899 Bacteria 1451
347 Ga0207642_10102843 3300025899 Bacteria 1438
348 Ga0207642_10538394 3300025899 Bacteria 720
349 Ga0207710_10025991 3300025900 Bacteria 2528
350 Ga0207710_10140930 3300025900 Unclassified 1164
351 Ga0207688_10204170 3300025901 Bacteria 1186
352 Ga0207680_10595048 3300025903 Unclassified 791
353 Ga0207647_10002741 3300025904 Bacteria 13294
354 Ga0207647_10044334 3300025904 Bacteria 2780
355 Ga0207685_10018117 3300025905 Unclassified 2292
356 Ga0207699_10000209 3300025906 Bacteria 34945
357 Ga0207699_10076393 3300025906 Unclassified 2063
358 Ga0207699_10122246 3300025906 Bacteria 1686
359 Ga0207699_10137199 3300025906 Bacteria 1603
360 Ga0207699_10370606 3300025906 Unclassified 1014
361 Ga0207699_10674507 3300025906 Bacteria 756
362 Ga0207645_10001689 3300025907 Bacteria 17919
363 Ga0207643_10002573 3300025908 Bacteria 9824
364 Ga0207684_10000614 3300025910 Bacteria 42486
365 Ga0207684_10001907 3300025910 Bacteria 21656
366 Ga0207684_10024360 3300025910 Bacteria 5161
367 Ga0207684_10246043 3300025910 Bacteria 1543
368 Ga0207684_10286568 3300025910 Bacteria 1420
369 Ga0207654_10108898 3300025911 Bacteria 1720
370 Ga0207654_10209718 3300025911 Unclassified 1287
371 Ga0207654_10548730 3300025911 Bacteria 821
372 Ga0207707_10003911 3300025912 Bacteria 13216
373 Ga0207707_10175985 3300025912 Bacteria 1869
374 Ga0207707_10888904 3300025912 Bacteria 737
375 Ga0207695_10068765 3300025913 Unclassified 3628
376 Ga0207695_10268869 3300025913 Bacteria 1601
377 Ga0207671_10028761 3300025914 Unclassified 4152
378 Ga0207671_10070899 3300025914 Bacteria 2598
379 Ga0207671_10084422 3300025914 Bacteria 2385
380 Ga0207671_10213753 3300025914 Bacteria 1509
381 Ga0207693_10000026 3300025915 Bacteria 122717
382 Ga0207693_10022287 3300025915 Bacteria 5033
383 Ga0207693_10042186 3300025915 Bacteria 3592
384 Ga0207693_10108137 3300025915 Unclassified 2181
385 Ga0207693_10118098 3300025915 Bacteria 2083
386 Ga0207693_10192970 3300025915 Unclassified 1603
387 Ga0207693_10333332 3300025915 Unclassified 1188
388 Ga0207693_11291839 3300025915 Bacteria 546
389 Ga0207693_11333860 3300025915 Unclassified 535
390 Ga0207663_10193191 3300025916 Unclassified 1463
391 Ga0207663_10220753 3300025916 Bacteria 1379
392 Ga0207660_10539305 3300025917 Bacteria 948
393 Ga0207660_10544856 3300025917 Bacteria 943
394 Ga0207662_10012728 3300025918 Bacteria 4690
395 Ga0207657_10003520 3300025919 Bacteria 16725
396 Ga0207649_10000445 3300025920 Bacteria 29893
397 Ga0207646_10002238 3300025922 Bacteria 23047
398 Ga0207646_10044442 3300025922 Bacteria 3988
399 Ga0207646_10071657 3300025922 Unclassified 3095
400 Ga0207646_10116788 3300025922 Bacteria 2396
401 Ga0207646_10294226 3300025922 Bacteria 1467
402 Ga0207646_10372694 3300025922 Bacteria 1290
403 Ga0207681_10064843 3300025923 Bacteria 2523
404 Ga0207694_10089006 3300025924 Unclassified 2434
405 Ga0207694_10335154 3300025924 Unclassified 1250
406 Ga0207650_10000053 3300025925 Bacteria 164599
407 Ga0207650_10644663 3300025925 Bacteria 893
408 Ga0207659_10040078 3300025926 Bacteria 3272
409 Ga0207687_10007071 3300025927 Bacteria 7397
410 Ga0207687_10057994 3300025927 Bacteria 2722
411 Ga0207687_10097425 3300025927 Bacteria 2157
412 Ga0207687_10120730 3300025927 Bacteria 1960
413 Ga0207700_10000306 3300025928 Bacteria 28993
414 Ga0207700_10016653 3300025928 Bacteria 4890
415 Ga0207700_10041153 3300025928 Bacteria 3379
416 Ga0207700_10085731 3300025928 Unclassified 2473
417 Ga0207700_10298695 3300025928 Bacteria 1390
418 Ga0207700_10765699 3300025928 Bacteria 863
419 Ga0207700_10816665 3300025928 Bacteria 834
420 Ga0207700_10884992 3300025928 Unclassified 799
421 Ga0207700_11128287 3300025928 Unclassified 701
422 Ga0207700_11372808 3300025928 Unclassified 629
423 Ga0207700_11915654 3300025928 Unclassified 519
424 Ga0207664_10190336 3300025929 Bacteria 1766
425 Ga0207664_10385894 3300025929 Bacteria 1244
426 Ga0207664_10458459 3300025929 Unclassified 1138
427 Ga0207664_10786928 3300025929 Bacteria 856
428 Ga0207644_10019899 3300025931 Bacteria 4558
429 Ga0207706_10002255 3300025933 Bacteria 18825
430 Ga0207670_10015855 3300025936 Bacteria 4512
431 Ga0207704_10049962 3300025938 Bacteria 2520
432 Ga0207704_11265060 3300025938 Unclassified 630
433 Ga0207665_10012284 3300025939 Bacteria 5623
434 Ga0207665_10027306 3300025939 Unclassified 3772
435 Ga0207665_10221405 3300025939 Bacteria 1387
436 Ga0207665_10492818 3300025939 Unclassified 946
437 Ga0207665_10516230 3300025939 Unclassified 925
438 Ga0207665_10836458 3300025939 Bacteria 728
439 Ga0207691_10003568 3300025940 Bacteria 15137
440 Ga0207691_10658464 3300025940 Unclassified 884
441 Ga0207711_10379737 3300025941 Bacteria 1311
442 Ga0207689_10000542 3300025942 Bacteria 35861
443 Ga0207689_10002682 3300025942 Bacteria 16456
444 Ga0207661_10001208 3300025944 Bacteria 17288
445 Ga0207661_10213512 3300025944 Bacteria 1702
446 Ga0207661_11208026 3300025944 Unclassified 696
447 Ga0207679_10001783 3300025945 Bacteria 13399
448 Ga0207679_10684147 3300025945 Bacteria 930
449 Ga0207667_10144355 3300025949 Bacteria 2450
450 Ga0207667_10216361 3300025949 Unclassified 1963
451 Ga0207667_10326260 3300025949 Bacteria 1567
452 Ga0207667_10735314 3300025949 Unclassified 987
453 Ga0207651_10001496 3300025960 Bacteria 10642
454 Ga0207668_10139975 3300025972 Bacteria 1859
455 Ga0207640_10044827 3300025981 Bacteria 2836
456 Ga0207640_10537863 3300025981 Bacteria 979
457 Ga0207658_10005363 3300025986 Bacteria 8806
458 Ga0207658_10335220 3300025986 Bacteria 1313
459 Ga0207677_10009986 3300026023 Bacteria 5357
460 Ga0207677_10059432 3300026023 Bacteria 2637
461 Ga0207677_10154437 3300026023 Bacteria 1775
462 Ga0207677_10156120 3300026023 Bacteria 1767
463 Ga0207703_10037964 3300026035 Unclassified 3840
464 Ga0207639_10160227 3300026041 Bacteria 1895
465 Ga0207639_10495742 3300026041 Bacteria 1115
466 Ga0207678_10000840 3300026067 Bacteria 28166
467 Ga0207708_10039749 3300026075 Bacteria 3585
468 Ga0207702_10031974 3300026078 Bacteria 4389
469 Ga0207702_10051111 3300026078 Bacteria 3492
470 Ga0207702_10212654 3300026078 Unclassified 1798
471 Ga0207702_10583109 3300026078 Bacteria 1096
472 Ga0207702_11286552 3300026078 Unclassified 725
473 Ga0207641_10000104 3300026088 Bacteria 122307
474 Ga0207648_10002557 3300026089 Bacteria 19506
475 Ga0207676_10000491 3300026095 Bacteria 33225
476 Ga0207674_10001318 3300026116 Bacteria 32302
477 Ga0207674_10134851 3300026116 Unclassified 2431
478 Ga0207674_10871948 3300026116 Bacteria 868
479 Ga0207683_10003204 3300026121 Bacteria 14276
480 Ga0207683_10255159 3300026121 Bacteria 1601
481 Ga0207698_10126136 3300026142 Bacteria 2177
482 Ga0207698_10465464 3300026142 Bacteria 1223
483 Ga0265356_1000478 3300028017 Bacteria 7213
484 Ga0265356_1014073 3300028017 Unclassified 871
485 Ga0268266_10005115 3300028379 Bacteria 12357
486 Ga0268266_10636590 3300028379 Unclassified 1026
487 Ga0268265_10005953 3300028380 Bacteria 8301
488 Ga0268265_10033182 3300028380 Bacteria 3751
489 Ga0268264_10551024 3300028381 Bacteria 1131
490 Ga0265338_10000833 3300028800 Bacteria 52026
491 Ga0265338_10074515 3300028800 Bacteria 2886
492 Ga0265762_1000119 3300030760 Bacteria 11713
493 Ga0265762_1000777 3300030760 Bacteria 5699
494 Ga0265762_1006203 3300030760 Unclassified 2142
495 Ga0265771_1000546 3300031010 Bacteria 1434
496 Ga0265760_10009809 3300031090 Bacteria 2733
497 Ga0265760_10032909 3300031090 Bacteria 1531
498 Ga0265332_10069161 3300031238 Bacteria 1505
499 Ga0265328_10019321 3300031239 Bacteria 2619
500 Ga0265320_10205923 3300031240 Bacteria 878
501 Ga0265325_10017529 3300031241 Bacteria 3979
502 Ga0265329_10164764 3300031242 Bacteria 721
503 Ga0265340_10021603 3300031247 Bacteria 3301
504 Ga0265340_10254714 3300031247 Bacteria 782
505 Ga0265339_10003136 3300031249 Bacteria 11639
506 Ga0265339_10020977 3300031249 Bacteria 3810
507 Ga0265339_10219118 3300031249 Bacteria 931
508 Ga0265339_10314609 3300031249 Bacteria 744
509 Ga0265327_10153153 3300031251 Bacteria 1069
510 Ga0265316_10014345 3300031344 Bacteria 6978
511 Ga0265316_10018684 3300031344 Bacteria 5953
512 Ga0265313_10027981 3300031595 Bacteria 2940
513 Ga0265314_10024132 3300031711 Bacteria 4618
514 Ga0265342_10387979 3300031712 Bacteria 723
515 Ga0373926_0004972 3300035083 Bacteria 4368
516 Ga0373944_0070597 3300035089 Unclassified 1137
517 Ga0373923_0027165 3300035111 Unclassified 2281
518 Ga0373936_0365073 3300035113 Bacteria 659
519 Ga0373941_0077851 3300035115 Bacteria 1114
520 Ga0373945_0021612 3300035116 Bacteria 2212
521 Ga0373953_0031745 3300035117 Unclassified 2056
522 Ga0373956_0126175 3300035119 Bacteria 1197
523 Ga0373956_0324444 3300035119 Unclassified 734
524 Ga0373957_0013624 3300035120 Bacteria 2763
525 Ga0373957_0156654 3300035120 Unclassified 937
526 Ga0373960_0080803 3300035121 Bacteria 1023
527 Ga0373943_0001571 3300035170 Bacteria 10341
528 Ga0373943_0065449 3300035170 Bacteria 1828
529 Ga0373946_0015286 3300035171 Bacteria 2907
530 Ga0373946_0083015 3300035171 Unclassified 1406
531 Ga0373955_0268149 3300035172 Unclassified 1026
532 Ga0373955_0610977 3300035172 Bacteria 668
533 Ga0373924_0000245 3300035410 Bacteria 16588
534 Ga0373924_0548425 3300035410 Unclassified 520
535 Ga0373931_0034450 3300035691 Bacteria 2628
536 Ga0373935_0001333 3300035692 Bacteria 13657
537 Ga0373935_0011396 3300035692 Bacteria 5338
538 Ga0373935_0475651 3300035692 Unclassified 905
539 Ga0373935_1323610 3300035692 Bacteria 538
540 Ga0373935_1452538 3300035692 Bacteria 513
541 Ga0373927_0016685 3300035695 Bacteria 4844
542 Ga0373927_0049622 3300035695 Bacteria 2714
543 Ga0373927_0162660 3300035695 Unclassified 1462
544 Ga0373933_0029242 3300035724 Bacteria 3185
545 Ga0373947_0006708 3300035725 Bacteria 6678
546 Ga0373947_0124293 3300035725 Bacteria 1641
547 Ga0373947_0355924 3300035725 Bacteria 983
548 Ga0373937_0001894 3300036401 Bacteria 17556
549 Ga0373937_0009542 3300036401 Bacteria 8442
550 Ga0373937_0071560 3300036401 Bacteria 3198
551 Ga0373937_0229004 3300036401 Bacteria 1750
552 Ga0373937_1475266 3300036401 Unclassified 628
553 Ga0373925_0001997 3300037068 Bacteria 16904
554 Ga0373925_0375071 3300037068 Unclassified 1158
555 Ga0395900_0592476 3300037418 Bacteria 1050
556 Ga0395900_0933339 3300037418 Bacteria 790
557 Ga0395900_1913195 3300037418 Unclassified 504
558 Ga0395905_0770074 3300037471 Bacteria 865
559 Ga0436364_0509543 3300037853 Bacteria 1533
560 Ga0436365_0870448 3300039437 Unclassified 876
561 Ga0436365_1880233 3300039437 Bacteria 3313
562 Ga0436363_0090843 3300039450 Unclassified 1015
563 Ga0436362_0052614 3300039453 Unclassified 770
564 Ga0436362_0552319 3300039453 Unclassified 3813
565 Ga0436362_0866066 3300039453 Bacteria 1033
566 Ga0451839_1005903 3300041496 Bacteria 798
567 Ga0451577_0040456 3300042876 Bacteria 4185
568 Ga0466961_0581413 3300044693 Unclassified 674
569 Ga0466961_0793281 3300044693 Bacteria 565
570 Ga0453684_0000951 3300044712 Bacteria 95417
571 Ga0451576_0010527 3300045051 Bacteria 10600
572 Ga0451576_0298670 3300045051 Unclassified 1684
573 Ga0451576_1629738 3300045051 Unclassified 669
574 Ga0466958_0167589 3300045836 Bacteria 1390
575 Ga0466958_0201330 3300045836 Unclassified 1267
576 Ga0466967_0093299 3300045976 Bacteria 2739
577 Ga0466967_1758143 3300045976 Unclassified 617
578 Ga0495590_0115993 3300046457 Bacteria 958
579 Ga0495651_0711465 3300046462 Bacteria 625
580 Ga0495651_0835412 3300046462 Unclassified 567
581 Ga0495653_0645844 3300046463 Bacteria 647
582 Ga0495580_0034691 3300046472 Bacteria 3631
583 Ga0495580_0852399 3300046472 Unclassified 588
584 Ga0495582_0101589 3300046473 Bacteria 1610
585 Ga0495582_0107652 3300046473 Bacteria 1565
586 Ga0495652_0039044 3300046529 Bacteria 4107
587 Ga0495665_0703510 3300046531 Unclassified 501
588 Ga0495667_0328220 3300046559 Unclassified 968
589 Ga0495635_1045262 3300046663 Unclassified 518
590 Ga0495623_0001371 3300046679 Bacteria 16530
591 Ga0495623_0263493 3300046679 Bacteria 965
592 Ga0495658_0210100 3300046683 Bacteria 1216
593 Ga0495624_0146024 3300046690 Bacteria 1448
594 Ga0495581_0174655 3300047315 Unclassified 1256
595 Ga0495604_0468992 3300047317 Unclassified 820
596 Ga0495674_0565563 3300047319 Unclassified 904
597 Ga0495680_0663361 3300047322 Unclassified 692
598 Ga0495675_0023510 3300047444 Bacteria 3927
599 Ga0495684_0718191 3300047471 Unclassified 661
600 Ga0495593_0069639 3300047673 Bacteria 1829
601 Ga0495614_0085676 3300048089 Bacteria 1368
602 Ga0495614_0488914 3300048089 Unclassified 585
603 Ga0496100_0181613 3300048903 Bacteria 1522
604 Ga0496100_0800972 3300048903 Bacteria 738
605 Ga0496101_0106541 3300048904 Unclassified 2105
606 Ga0496101_0170924 3300048904 Bacteria 1671
607 Ga0496102_0024594 3300048905 Bacteria 5355
608 Ga0496102_0030087 3300048905 Bacteria 4860
609 Ga0496102_0032116 3300048905 Unclassified 4716
610 Ga0496102_0082818 3300048905 Unclassified 2959
611 Ga0496102_0311210 3300048905 Bacteria 1484
612 Ga0496102_0669525 3300048905 Bacteria 961
613 Ga0496103_0352701 3300048906 Bacteria 946
614 Ga0496104_0114347 3300048907 Bacteria 2588
615 Ga0496104_0153959 3300048907 Bacteria 2207
616 Ga0496104_0201121 3300048907 Unclassified 1904
617 Ga0496104_0310870 3300048907 Bacteria 1489
618 Ga0496104_0429886 3300048907 Unclassified 1232
619 Ga0496105_0000399 3300048908 Bacteria 28536
620 Ga0496105_0008491 3300048908 Bacteria 7980
621 Ga0496105_0041633 3300048908 Unclassified 3786
622 Ga0496105_0763426 3300048908 Bacteria 738
623 Ga0496106_0687143 3300048909 Bacteria 816
624 Ga0496107_1086226 3300048910 Unclassified 578
625 Ga0496108_0000629 3300048911 Bacteria 27529
626 Ga0496108_0685644 3300048911 Bacteria 889
627 Ga0496109_0000270 3300048912 Bacteria 49971
628 Ga0496110_0002501 3300048913 Bacteria 13796
629 Ga0496110_0058340 3300048913 Bacteria 3400
630 Ga0496111_0029137 3300048914 Bacteria 3919
631 Ga0496111_0390933 3300048914 Unclassified 1028
632 Ga0496112_0000121 3300048915 Bacteria 48786
633 Ga0496112_0001780 3300048915 Bacteria 16927
634 Ga0496112_0002178 3300048915 Bacteria 15583
635 Ga0496112_0005362 3300048915 Bacteria 11080
636 Ga0496112_0027881 3300048915 Bacteria 5448
637 Ga0496112_0039232 3300048915 Unclassified 4627
638 Ga0496112_0190516 3300048915 Bacteria 2013
639 Ga0496112_0354675 3300048915 Bacteria 1409
640 Ga0496112_1008876 3300048915 Bacteria 752
641 Ga0496113_0002775 3300048916 Bacteria 10302
642 Ga0496113_0114865 3300048916 Unclassified 2099
643 Ga0496113_0380280 3300048916 Unclassified 1133
644 Ga0496113_0455394 3300048916 Bacteria 1028
645 Ga0496114_0138203 3300048917 Unclassified 2108
646 Ga0496114_0902800 3300048917 Bacteria 765
647 Ga0496115_0039011 3300048918 Unclassified 3771
648 Ga0496115_0148247 3300048918 Bacteria 1937
649 Ga0496115_0194256 3300048918 Bacteria 1677
650 Ga0496115_0325195 3300048918 Unclassified 1257
651 Ga0496115_0955356 3300048918 Bacteria 658
652 Ga0496126_0001722 3300048929 Bacteria 32467
653 nmdc:mga0rr50_629872_c1 3300050513 Bacteria 915
654 nmdc:mga08x19_138127_c1 3300050514 Bacteria 1644
655 nmdc:mga08x19_143618_c1 3300050514 Bacteria 1613
656 nmdc:mga08x19_558765_c1 3300050514 Bacteria 810
657 nmdc:mga08x19_642667_c1 3300050514 Bacteria 752
658 nmdc:mga08x19_7445_c1 3300050514 Bacteria 6501
659 Ga0495601_0394902 3300053077 Bacteria 897
660 Ga0495619_0143241 3300053085 Bacteria 1647
661 Ga0587073_0012920 3300059492 Unclassified 1457
662 Ga0587077_061957 3300059493 Unclassified 813
663 Ga0587080_054617 3300059503 Unclassified 763
664 Ga0587094_109200 3300059513 Unclassified 542
665 Ga0453683_0084065
666 JGI24752J21851_1005183
667 JGI24737J22298_10062513
668 JGI24749J21850_1014250
669 JGI24751J29686_10000897
670 Ga0058859_10837192
671 Ga0065712_10004139
672 Ga0065715_10091689
673 Ga0065707_10670428
674 Ga0070658_10046918
675 Ga0070676_10013721
676 Ga0070683_100008827
677 Ga0070690_100354913
678 Ga0070670_100031846
679 Ga0070670_100033866
680 Ga0070677_10013649
681 Ga0068869_100028188
682 Ga0068869_100029145
683 Ga0068869_100423063
684 Ga0070666_10474238
685 Ga0070666_10514694
686 Ga0070680_100058493
687 Ga0070680_100169592
688 Ga0070682_100268276
689 Ga0070682_101247167
690 Ga0068868_100012207
691 Ga0068868_100012948
692 Ga0068868_100038646
693 Ga0068868_100053277
694 Ga0068868_100869427
695 Ga0068868_100877012
696 Ga0070660_100001606
697 Ga0070689_100085365
698 Ga0070687_100016278
699 Ga0070661_100006213
700 Ga0070661_100169521
701 Ga0070668_100038070
702 Ga0070669_100003780
703 Ga0070675_100020211
704 Ga0070671_100105310
705 Ga0070673_100025124
706 Ga0070673_100282077
707 Ga0070688_100002957
708 Ga0070659_100001742
709 Ga0070667_100034672
710 Ga0070667_101153071
711 Ga0070709_10116272
712 Ga0070709_10125231
713 Ga0070709_10517563
714 Ga0070714_100117023
715 Ga0070714_100356697
716 Ga0070714_100905379
717 Ga0070714_101340938
718 Ga0070714_101587830
719 Ga0070714_102113700
720 Ga0070713_100028094
721 Ga0070713_100188965
722 Ga0070713_100193824
723 Ga0070713_100277168
724 Ga0070713_100287493
725 Ga0070713_100330681
726 Ga0070713_100422878
727 Ga0070713_100466587
728 Ga0070713_100723133
729 Ga0070713_100753886
730 Ga0070713_100931019
731 Ga0070713_101031705
732 Ga0070710_10001549
733 Ga0070710_10041452
734 Ga0070710_10069692
735 Ga0070710_10247950
736 Ga0070710_10258585
737 Ga0070710_10682873
738 Ga0070711_100212744
739 Ga0070711_100287367
740 Ga0070708_100000459
741 Ga0070708_100024343
742 Ga0070708_100052363
743 Ga0070663_100006254
744 Ga0070678_100024642
745 Ga0070662_100004877
746 Ga0070681_10004600
747 Ga0070681_10154975
748 Ga0070681_10443280
749 Ga0068867_100012811
750 Ga0070685_10001931
751 Ga0070685_10113602
752 Ga0070706_100000514
753 Ga0070706_100002982
754 Ga0070706_100030168
755 Ga0070706_100078384
756 Ga0070707_100000662
757 Ga0070707_100008218
758 Ga0070707_100339466
759 Ga0070707_100517437
760 Ga0070698_100000133
761 Ga0070698_100002043
762 Ga0070698_100041613
763 Ga0070698_100141600
764 Ga0070698_101397711
765 Ga0070699_100000441
766 Ga0070699_100148651
767 Ga0070699_100645449
768 Ga0070699_101533879
769 Ga0070679_100007709
770 Ga0070679_100307049
771 Ga0070679_100642167
772 Ga0070679_100753339
773 Ga0070684_100001890
774 Ga0070684_100034871
775 Ga0070684_100048290
776 Ga0070697_100000158
777 Ga0070697_100004513
778 Ga0070697_100860253
779 Ga0070697_101249264
780 Ga0068853_100023962
781 Ga0068853_100030598
782 Ga0068853_100107639
783 Ga0068853_100128952
784 Ga0068853_100290612
785 Ga0068853_100668392
786 Ga0070672_100006210
787 Ga0070672_100956800
788 Ga0070686_100001751
789 Ga0070686_100120132
790 Ga0070695_100042489
791 Ga0070696_100043518
792 Ga0070696_100264152
793 Ga0070693_100013310
794 Ga0070693_100051240
795 Ga0070693_100115422
796 Ga0070693_100187290
797 Ga0070665_100924805
798 Ga0068855_100016183
799 Ga0068855_100100414
800 Ga0068855_100173193
801 Ga0068855_100711223
802 Ga0070664_100103197
803 Ga0068857_100011308
804 Ga0068854_100074203
805 Ga0068854_100082416
806 Ga0068854_100111291
807 Ga0068856_100036173
808 Ga0068856_100047478
809 Ga0068856_100064506
810 Ga0068856_100131638
811 Ga0068856_100841938
812 Ga0068852_100023791
813 Ga0068852_100146592
814 Ga0068852_100167955
815 Ga0068859_100015642
816 Ga0068859_100231181
817 Ga0068864_100202753
818 Ga0068864_100513341
819 Ga0068866_10063788
820 Ga0068866_10106325
821 Ga0068866_10800270
822 Ga0068861_100494305
823 Ga0068851_10003046
824 Ga0068851_10401575
825 Ga0068863_100012969
826 Ga0068863_100283073
827 Ga0068863_100544867
828 Ga0068858_100001619
829 Ga0068858_100031852
830 Ga0068860_100005894
831 Ga0068860_100164584
832 Ga0068860_100430970
833 Ga0068860_101049845
834 Ga0068862_100102267
835 Ga0068862_100600571
836 Ga0068862_100925398
837 Ga0070717_10008691
838 Ga0070717_10032983
839 Ga0070717_10033339
840 Ga0070717_10043538
841 Ga0070717_10053000
842 Ga0070717_10154341
843 Ga0070717_10424688
844 Ga0070717_10590216
845 Ga0070717_10595458
846 Ga0070717_11100481
847 Ga0070717_11719321
848 Ga0070715_10006826
849 Ga0070715_10053637
850 Ga0070715_10231786
851 Ga0070715_10317657
852 Ga0070715_10355308
853 Ga0070715_10978224
854 Ga0070716_100113337
855 Ga0070716_100240155
856 Ga0070716_101469254
857 Ga0070716_101780536
858 Ga0070712_100000618
859 Ga0070712_100015567
860 Ga0070712_100107060
861 Ga0070712_100211627
862 Ga0070712_100560590
863 Ga0097621_100014488
864 Ga0097621_100083010
865 Ga0097621_100164056
866 Ga0097621_100351280
867 Ga0097621_100753119
868 Ga0068871_100000727
869 Ga0068871_100085050
870 Ga0068871_100413387
871 Ga0068871_100734512
872 Ga0068871_101284448
873 Ga0075434_100010363
874 Ga0068865_100191958
875 Ga0068865_100838901
876 Ga0075436_100067927
877 Ga0075436_100078930
878 Ga0075436_100244265
879 Ga0097620_100015642
880 Ga0097620_100231172
881 Ga0075435_100010920
882 Ga0075435_100078986
883 Ga0099795_10096096
884 Ga0099795_10253507
885 Ga0105250_10058724
886 Ga0105240_10017855
887 Ga0105240_10236771
888 Ga0105240_10530084
889 Ga0105240_10904541
890 Ga0105240_11247680
891 Ga0105240_12623547
892 Ga0105245_10004451
893 Ga0105245_10015530
894 Ga0105245_10016248
895 Ga0105245_10023501
896 Ga0105245_10076932
897 Ga0105245_10103758
898 Ga0105247_10149755
899 Ga0105247_10840865
900 Ga0114129_10108973
901 Ga0105241_10001007
902 Ga0105241_10028094
903 Ga0105241_10038332
904 Ga0105241_10142388
905 Ga0105241_10647399
906 Ga0105242_10077078
907 Ga0105242_10101530
908 Ga0105242_10167508
909 Ga0105248_10011618
910 Ga0105248_10181549
911 Ga0105248_10341789
912 Ga0105237_10090996
913 Ga0105237_10122178
914 Ga0105237_10314223
915 Ga0105238_10007234
916 Ga0105238_10025226
917 Ga0105238_10050778
918 Ga0105238_10107866
919 Ga0105238_11476163
920 Ga0105249_10013908
921 Ga0105239_10040875
922 Ga0105239_10044409
923 Ga0105239_10200638
924 Ga0105239_10672912
925 Ga0105239_11118363
926 Ga0105246_10007859
927 Ga0157373_10003057
928 Ga0157373_10013678
929 Ga0157373_10046473
930 Ga0157373_10486121
931 Ga0157373_10837328
932 Ga0157371_10002264
933 Ga0157371_10758414
934 Ga0157370_10044441
935 Ga0157370_10088625
936 Ga0157370_10591219
937 Ga0157369_10008028
938 Ga0157369_10015743
939 Ga0157369_10095020
940 Ga0157369_10111522
941 Ga0157369_10122337
942 Ga0157369_10573976
943 Ga0157369_10696712
944 Ga0157369_12502146
945 Ga0157374_10000228
946 Ga0157374_10097761
947 Ga0157374_10119686
948 Ga0157374_10140646
949 Ga0157374_10899063
950 Ga0157378_10000351
951 Ga0157378_10007903
952 Ga0157378_10051290
953 Ga0157378_10226359
954 Ga0163162_10004210
955 Ga0163162_10019239
956 Ga0163162_10088487
957 Ga0157372_10005053
958 Ga0157372_10009228
959 Ga0157372_10009344
960 Ga0157372_10039206
961 Ga0157372_10054048
962 Ga0157372_10517749
963 Ga0157372_10676801
964 Ga0157372_11031544
965 Ga0157372_12292005
966 Ga0157372_12294762
967 Ga0157372_12794936
968 Ga0157375_10140664
969 Ga0157375_10300217
970 Ga0163163_10036969
971 Ga0163163_10074333
972 Ga0163163_10414669
973 Ga0157380_10019901
974 Ga0182008_10288597
975 Ga0157377_10004842
976 Ga0157379_10028378
977 Ga0157379_10209581
978 Ga0157379_11281866
979 Ga0157376_10008129
980 Ga0157376_10024032
981 Ga0157376_10038962
982 Ga0157376_10260880
983 Ga0157376_10400097
984 Ga0182007_10131503
985 Ga0163161_10028230
986 Ga0206352_10348191
987 Ga0213873_10035658
988 Ga0213874_10106241
989 Ga0213876_10294716
990 Ga0213875_10081889
991 Ga0224572_1000176
992 Ga0224572_1013048
993 Ga0224572_1029944
994 Ga0228598_1000403
995 Ga0228598_1002548
996 Ga0228598_1002880
997 Ga0207697_10009374
998 Ga0207697_10455362
999 Ga0207656_10173335
1000 Ga0207696_1036623
1001 Ga0207682_10018935
1002 Ga0207692_10003777
1003 Ga0207692_10062682
1004 Ga0207692_10071393
1005 Ga0207692_10122162
1006 Ga0207692_10219974
1007 Ga0207692_10220986
1008 Ga0207692_10245778
1009 Ga0207692_10599349
1010 Ga0207642_10100494
1011 Ga0207642_10102843
1012 Ga0207642_10538394
1013 Ga0207710_10025991
1014 Ga0207710_10140930
1015 Ga0207688_10204170
1016 Ga0207680_10595048
1017 Ga0207647_10002741
1018 Ga0207647_10044334
1019 Ga0207685_10018117
1020 Ga0207699_10000209
1021 Ga0207699_10076393
1022 Ga0207699_10122246
1023 Ga0207699_10137199
1024 Ga0207699_10370606
1025 Ga0207699_10674507
1026 Ga0207645_10001689
1027 Ga0207643_10002573
1028 Ga0207684_10000614
1029 Ga0207684_10001907
1030 Ga0207684_10024360
1031 Ga0207684_10246043
1032 Ga0207684_10286568
1033 Ga0207654_10108898
1034 Ga0207654_10209718
1035 Ga0207654_10548730
1036 Ga0207707_10003911
1037 Ga0207707_10175985
1038 Ga0207707_10888904
1039 Ga0207695_10068765
1040 Ga0207695_10268869
1041 Ga0207671_10028761
1042 Ga0207671_10070899
1043 Ga0207671_10084422
1044 Ga0207671_10213753
1045 Ga0207693_10000026
1046 Ga0207693_10022287
1047 Ga0207693_10042186
1048 Ga0207693_10108137
1049 Ga0207693_10118098
1050 Ga0207693_10192970
1051 Ga0207693_10333332
1052 Ga0207693_11291839
1053 Ga0207693_11333860
1054 Ga0207663_10193191
1055 Ga0207663_10220753
1056 Ga0207660_10539305
1057 Ga0207660_10544856
1058 Ga0207662_10012728
1059 Ga0207657_10003520
1060 Ga0207649_10000445
1061 Ga0207646_10002238
1062 Ga0207646_10044442
1063 Ga0207646_10071657
1064 Ga0207646_10116788
1065 Ga0207646_10294226
1066 Ga0207646_10372694
1067 Ga0207681_10064843
1068 Ga0207694_10089006
1069 Ga0207694_10335154
1070 Ga0207650_10000053
1071 Ga0207650_10644663
1072 Ga0207659_10040078
1073 Ga0207687_10007071
1074 Ga0207687_10057994
1075 Ga0207687_10097425
1076 Ga0207687_10120730
1077 Ga0207700_10000306
1078 Ga0207700_10016653
1079 Ga0207700_10041153
1080 Ga0207700_10085731
1081 Ga0207700_10298695
1082 Ga0207700_10765699
1083 Ga0207700_10816665
1084 Ga0207700_10884992
1085 Ga0207700_11128287
1086 Ga0207700_11372808
1087 Ga0207700_11915654
1088 Ga0207664_10190336
1089 Ga0207664_10385894
1090 Ga0207664_10458459
1091 Ga0207664_10786928
1092 Ga0207644_10019899
1093 Ga0207706_10002255
1094 Ga0207670_10015855
1095 Ga0207704_10049962
1096 Ga0207704_11265060
1097 Ga0207665_10012284
1098 Ga0207665_10027306
1099 Ga0207665_10221405
1100 Ga0207665_10492818
1101 Ga0207665_10516230
1102 Ga0207665_10836458
1103 Ga0207691_10003568
1104 Ga0207691_10658464
1105 Ga0207711_10379737
1106 Ga0207689_10000542
1107 Ga0207689_10002682
1108 Ga0207661_10001208
1109 Ga0207661_10213512
1110 Ga0207661_11208026
1111 Ga0207679_10001783
1112 Ga0207679_10684147
1113 Ga0207667_10144355
1114 Ga0207667_10216361
1115 Ga0207667_10326260
1116 Ga0207667_10735314
1117 Ga0207651_10001496
1118 Ga0207668_10139975
1119 Ga0207640_10044827
1120 Ga0207640_10537863
1121 Ga0207658_10005363
1122 Ga0207658_10335220
1123 Ga0207677_10009986
1124 Ga0207677_10059432
1125 Ga0207677_10154437
1126 Ga0207677_10156120
1127 Ga0207703_10037964
1128 Ga0207639_10160227
1129 Ga0207639_10495742
1130 Ga0207678_10000840
1131 Ga0207708_10039749
1132 Ga0207702_10031974
1133 Ga0207702_10051111
1134 Ga0207702_10212654
1135 Ga0207702_10583109
1136 Ga0207702_11286552
1137 Ga0207641_10000104
1138 Ga0207648_10002557
1139 Ga0207676_10000491
1140 Ga0207674_10001318
1141 Ga0207674_10134851
1142 Ga0207674_10871948
1143 Ga0207683_10003204
1144 Ga0207683_10255159
1145 Ga0207698_10126136
1146 Ga0207698_10465464
1147 Ga0265356_1000478
1148 Ga0265356_1014073
1149 Ga0268266_10005115
1150 Ga0268266_10636590
1151 Ga0268265_10005953
1152 Ga0268265_10033182
1153 Ga0268264_10551024
1154 Ga0265338_10000833
1155 Ga0265338_10074515
1156 Ga0265762_1000119
1157 Ga0265762_1000777
1158 Ga0265762_1006203
1159 Ga0265771_1000546
1160 Ga0265760_10009809
1161 Ga0265760_10032909
1162 Ga0265332_10069161
1163 Ga0265328_10019321
1164 Ga0265320_10205923
1165 Ga0265325_10017529
1166 Ga0265329_10164764
1167 Ga0265340_10021603
1168 Ga0265340_10254714
1169 Ga0265339_10003136
1170 Ga0265339_10020977
1171 Ga0265339_10219118
1172 Ga0265339_10314609
1173 Ga0265327_10153153
1174 Ga0265316_10014345
1175 Ga0265316_10018684
1176 Ga0265313_10027981
1177 Ga0265314_10024132
1178 Ga0265342_10387979
1179 Ga0373926_0004972
1180 Ga0373944_0070597
1181 Ga0373923_0027165
1182 Ga0373936_0365073
1183 Ga0373941_0077851
1184 Ga0373945_0021612
1185 Ga0373953_0031745
1186 Ga0373956_0126175
1187 Ga0373956_0324444
1188 Ga0373957_0013624
1189 Ga0373957_0156654
1190 Ga0373960_0080803
1191 Ga0373943_0001571
1192 Ga0373943_0065449
1193 Ga0373946_0015286
1194 Ga0373946_0083015
1195 Ga0373955_0268149
1196 Ga0373955_0610977
1197 Ga0373924_0000245
1198 Ga0373924_0548425
1199 Ga0373931_0034450
1200 Ga0373935_0001333
1201 Ga0373935_0011396
1202 Ga0373935_0475651
1203 Ga0373935_1323610
1204 Ga0373935_1452538
1205 Ga0373927_0016685
1206 Ga0373927_0049622
1207 Ga0373927_0162660
1208 Ga0373933_0029242
1209 Ga0373947_0006708
1210 Ga0373947_0124293
1211 Ga0373947_0355924
1212 Ga0373937_0001894
1213 Ga0373937_0009542
1214 Ga0373937_0071560
1215 Ga0373937_0229004
1216 Ga0373937_1475266
1217 Ga0373925_0001997
1218 Ga0373925_0375071
1219 Ga0395900_0592476
1220 Ga0395900_0933339
1221 Ga0395900_1913195
1222 Ga0395905_0770074
1223 Ga0436364_0509543
1224 Ga0436365_0870448
1225 Ga0436365_1880233
1226 Ga0436363_0090843
1227 Ga0436362_0052614
1228 Ga0436362_0552319
1229 Ga0436362_0866066
1230 Ga0451839_1005903
1231 Ga0451577_0040456
1232 Ga0466961_0581413
1233 Ga0466961_0793281
1234 Ga0453684_0000951
1235 Ga0451576_0010527
1236 Ga0451576_0298670
1237 Ga0451576_1629738
1238 Ga0466958_0167589
1239 Ga0466958_0201330
1240 Ga0466967_0093299
1241 Ga0466967_1758143
1242 Ga0495590_0115993
1243 Ga0495651_0711465
1244 Ga0495651_0835412
1245 Ga0495653_0645844
1246 Ga0495580_0034691
1247 Ga0495580_0852399
1248 Ga0495582_0101589
1249 Ga0495582_0107652
1250 Ga0495652_0039044
1251 Ga0495665_0703510
1252 Ga0495667_0328220
1253 Ga0495635_1045262
1254 Ga0495623_0001371
1255 Ga0495623_0263493
1256 Ga0495658_0210100
1257 Ga0495624_0146024
1258 Ga0495581_0174655
1259 Ga0495604_0468992
1260 Ga0495674_0565563
1261 Ga0495680_0663361
1262 Ga0495675_0023510
1263 Ga0495684_0718191
1264 Ga0495593_0069639
1265 Ga0495614_0085676
1266 Ga0495614_0488914
1267 Ga0496100_0181613
1268 Ga0496100_0800972
1269 Ga0496101_0106541
1270 Ga0496101_0170924
1271 Ga0496102_0024594
1272 Ga0496102_0030087
1273 Ga0496102_0032116
1274 Ga0496102_0082818
1275 Ga0496102_0311210
1276 Ga0496102_0669525
1277 Ga0496103_0352701
1278 Ga0496104_0114347
1279 Ga0496104_0153959
1280 Ga0496104_0201121
1281 Ga0496104_0310870
1282 Ga0496104_0429886
1283 Ga0496105_0000399
1284 Ga0496105_0008491
1285 Ga0496105_0041633
1286 Ga0496105_0763426
1287 Ga0496106_0687143
1288 Ga0496107_1086226
1289 Ga0496108_0000629
1290 Ga0496108_0685644
1291 Ga0496109_0000270
1292 Ga0496110_0002501
1293 Ga0496110_0058340
1294 Ga0496111_0029137
1295 Ga0496111_0390933
1296 Ga0496112_0000121
1297 Ga0496112_0001780
1298 Ga0496112_0002178
1299 Ga0496112_0005362
1300 Ga0496112_0027881
1301 Ga0496112_0039232
1302 Ga0496112_0190516
1303 Ga0496112_0354675
1304 Ga0496112_1008876
1305 Ga0496113_0002775
1306 Ga0496113_0114865
1307 Ga0496113_0380280
1308 Ga0496113_0455394
1309 Ga0496114_0138203
1310 Ga0496114_0902800
1311 Ga0496115_0039011
1312 Ga0496115_0148247
1313 Ga0496115_0194256
1314 Ga0496115_0325195
1315 Ga0496115_0955356
1316 Ga0496126_0001722
1317 nmdc:mga0rr50_629872_c1
1318 nmdc:mga08x19_138127_c1
1319 nmdc:mga08x19_143618_c1
1320 nmdc:mga08x19_558765_c1
1321 nmdc:mga08x19_642667_c1
1322 nmdc:mga08x19_7445_c1
1323 Ga0495601_0394902
1324 Ga0495619_0143241
1325 Ga0587073_0012920
1326 Ga0587077_061957
1327 Ga0587080_054617
1328 Ga0587094_109200

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20382

DUF6677

Family of unknown function (DUF6677)

33

148

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mjt-assembly1.cif.gz_C kcsa open gate e71v mutant with barium 0.3522 56 142
2fzf-assembly1.cif.gz_B hypothetical protein pfu-1136390-001 from pyrococcus furiosus 0.3385 26 144
7mjt-assembly1.cif.gz_C kcsa open gate e71v mutant with barium 0.3176 56 142
1p3v-assembly1.cif.gz_A crystal structures of the no-and co-bound heme oxygenase from neisseria meningitidis: implications for oxygen activation 0.3162 25 141
8w6i-assembly1.cif.gz_A cryo-em structure of escherichia coli str k12 ftsex complex with atp-gamma-s in peptidisc 0.3141 40 144
ID Description Score Start End Superfamily
af_Q2FW85_259_476_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4715 47 141 1.20.1250.20
af_O60637_1_104_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4348 58 143 1.20.120.350
af_Q4V915_1_105_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.4338 58 143 1.20.5.110
af_Q66H06_1_104_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.4263 58 143 1.20.5.110
af_P31053_1_108_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.4246 58 143 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A1Q7N0C4-F1-model_v4 DUF6677 domain-containing protein 0.973 23 144 GO:0016020
AF-A0A2W0AZQ2-F1-model_v4 DUF6677 domain-containing protein 0.9725 26 144 GO:0016020
AF-A0A2W0BFX9-F1-model_v4 DUF6677 domain-containing protein 0.9719 25 144 GO:0016020
AF-A0A2V9NXE6-F1-model_v4 DUF6677 domain-containing protein 0.9718 15 144 GO:0016020
AF-A0A1Q7N0C4-F1-model_v4 DUF6677 domain-containing protein 0.9652 23 144 GO:0016020

Map