F473644
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 664 | 281 | 1328 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300044673|Ga0453683_0084065|Ga0453683_0084065_1406_1852 |
| Length | 148 |
| Sequence | MSDPSQSKSAAQPFPHLKEDPAPSQPLTLLAVATPILGWLVPGGGHFLQKRWGRGALLALSVTSMFVMGLLMQGKVYSANFGDILDVLGFVGNLGAGCLYLMTRAFDWGHGSINLATADYGTKFIIVAGLLNVISAVDAYDIAIGKKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 122 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 204 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 212 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.19 |
| Metatranscriptomes | 1.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.38 |
| Rhizosphere | 91.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 28.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453683_0084065 | 3300044673 | Bacteria | 1994 |
| 2 | JGI24752J21851_1005183 | 3300001976 | Bacteria | 1706 |
| 3 | JGI24737J22298_10062513 | 3300001990 | Bacteria | 1119 |
| 4 | JGI24749J21850_1014250 | 3300002076 | Bacteria | 1114 |
| 5 | JGI24751J29686_10000897 | 3300002459 | Bacteria | 6802 |
| 6 | Ga0058859_10837192 | 3300004798 | Bacteria | 660 |
| 7 | Ga0065712_10004139 | 3300005290 | Bacteria | 3364 |
| 8 | Ga0065715_10091689 | 3300005293 | Bacteria | 5616 |
| 9 | Ga0065707_10670428 | 3300005295 | Bacteria | 653 |
| 10 | Ga0070658_10046918 | 3300005327 | Bacteria | 3496 |
| 11 | Ga0070676_10013721 | 3300005328 | Unclassified | 4441 |
| 12 | Ga0070683_100008827 | 3300005329 | Bacteria | 8576 |
| 13 | Ga0070690_100354913 | 3300005330 | Bacteria | 1065 |
| 14 | Ga0070670_100031846 | 3300005331 | Bacteria | 4541 |
| 15 | Ga0070670_100033866 | 3300005331 | Bacteria | 4399 |
| 16 | Ga0070677_10013649 | 3300005333 | Bacteria | 2846 |
| 17 | Ga0068869_100028188 | 3300005334 | Bacteria | 3922 |
| 18 | Ga0068869_100029145 | 3300005334 | Bacteria | 3864 |
| 19 | Ga0068869_100423063 | 3300005334 | Bacteria | 1099 |
| 20 | Ga0070666_10474238 | 3300005335 | Bacteria | 905 |
| 21 | Ga0070666_10514694 | 3300005335 | Bacteria | 868 |
| 22 | Ga0070680_100058493 | 3300005336 | Unclassified | 3152 |
| 23 | Ga0070680_100169592 | 3300005336 | Bacteria | 1836 |
| 24 | Ga0070682_100268276 | 3300005337 | Bacteria | 1239 |
| 25 | Ga0070682_101247167 | 3300005337 | Unclassified | 629 |
| 26 | Ga0068868_100012207 | 3300005338 | Bacteria | 6276 |
| 27 | Ga0068868_100012948 | 3300005338 | Bacteria | 6102 |
| 28 | Ga0068868_100038646 | 3300005338 | Bacteria | 3705 |
| 29 | Ga0068868_100053277 | 3300005338 | Bacteria | 3187 |
| 30 | Ga0068868_100869427 | 3300005338 | Bacteria | 817 |
| 31 | Ga0068868_100877012 | 3300005338 | Unclassified | 814 |
| 32 | Ga0070660_100001606 | 3300005339 | Bacteria | 15529 |
| 33 | Ga0070689_100085365 | 3300005340 | Bacteria | 2482 |
| 34 | Ga0070687_100016278 | 3300005343 | Bacteria | 3387 |
| 35 | Ga0070661_100006213 | 3300005344 | Bacteria | 8237 |
| 36 | Ga0070661_100169521 | 3300005344 | Bacteria | 1657 |
| 37 | Ga0070668_100038070 | 3300005347 | Bacteria | 3674 |
| 38 | Ga0070669_100003780 | 3300005353 | Bacteria | 10935 |
| 39 | Ga0070675_100020211 | 3300005354 | Bacteria | 5313 |
| 40 | Ga0070671_100105310 | 3300005355 | Bacteria | 2367 |
| 41 | Ga0070673_100025124 | 3300005364 | Bacteria | 4379 |
| 42 | Ga0070673_100282077 | 3300005364 | Unclassified | 1457 |
| 43 | Ga0070688_100002957 | 3300005365 | Bacteria | 8661 |
| 44 | Ga0070659_100001742 | 3300005366 | Bacteria | 15639 |
| 45 | Ga0070667_100034672 | 3300005367 | Unclassified | 4224 |
| 46 | Ga0070667_101153071 | 3300005367 | Bacteria | 725 |
| 47 | Ga0070709_10116272 | 3300005434 | Bacteria | 1805 |
| 48 | Ga0070709_10125231 | 3300005434 | Bacteria | 1747 |
| 49 | Ga0070709_10517563 | 3300005434 | Bacteria | 909 |
| 50 | Ga0070714_100117023 | 3300005435 | Bacteria | 2367 |
| 51 | Ga0070714_100356697 | 3300005435 | Unclassified | 1374 |
| 52 | Ga0070714_100905379 | 3300005435 | Unclassified | 857 |
| 53 | Ga0070714_101340938 | 3300005435 | Unclassified | 698 |
| 54 | Ga0070714_101587830 | 3300005435 | Unclassified | 639 |
| 55 | Ga0070714_102113700 | 3300005435 | Unclassified | 549 |
| 56 | Ga0070713_100028094 | 3300005436 | Bacteria | 4439 |
| 57 | Ga0070713_100188965 | 3300005436 | Bacteria | 1855 |
| 58 | Ga0070713_100193824 | 3300005436 | Unclassified | 1832 |
| 59 | Ga0070713_100277168 | 3300005436 | Unclassified | 1537 |
| 60 | Ga0070713_100287493 | 3300005436 | Bacteria | 1510 |
| 61 | Ga0070713_100330681 | 3300005436 | Unclassified | 1409 |
| 62 | Ga0070713_100422878 | 3300005436 | Bacteria | 1247 |
| 63 | Ga0070713_100466587 | 3300005436 | Unclassified | 1188 |
| 64 | Ga0070713_100723133 | 3300005436 | Unclassified | 951 |
| 65 | Ga0070713_100753886 | 3300005436 | Unclassified | 931 |
| 66 | Ga0070713_100931019 | 3300005436 | Bacteria | 836 |
| 67 | Ga0070713_101031705 | 3300005436 | Unclassified | 794 |
| 68 | Ga0070710_10001549 | 3300005437 | Bacteria | 10861 |
| 69 | Ga0070710_10041452 | 3300005437 | Unclassified | 2542 |
| 70 | Ga0070710_10069692 | 3300005437 | Unclassified | 2023 |
| 71 | Ga0070710_10247950 | 3300005437 | Bacteria | 1144 |
| 72 | Ga0070710_10258585 | 3300005437 | Unclassified | 1122 |
| 73 | Ga0070710_10682873 | 3300005437 | Bacteria | 723 |
| 74 | Ga0070711_100212744 | 3300005439 | Bacteria | 1498 |
| 75 | Ga0070711_100287367 | 3300005439 | Unclassified | 1303 |
| 76 | Ga0070708_100000459 | 3300005445 | Bacteria | 30632 |
| 77 | Ga0070708_100024343 | 3300005445 | Bacteria | 5164 |
| 78 | Ga0070708_100052363 | 3300005445 | Bacteria | 3620 |
| 79 | Ga0070663_100006254 | 3300005455 | Bacteria | 7140 |
| 80 | Ga0070678_100024642 | 3300005456 | Unclassified | 4033 |
| 81 | Ga0070662_100004877 | 3300005457 | Bacteria | 8511 |
| 82 | Ga0070681_10004600 | 3300005458 | Bacteria | 13176 |
| 83 | Ga0070681_10154975 | 3300005458 | Bacteria | 2216 |
| 84 | Ga0070681_10443280 | 3300005458 | Unclassified | 1210 |
| 85 | Ga0068867_100012811 | 3300005459 | Bacteria | 5934 |
| 86 | Ga0070685_10001931 | 3300005466 | Bacteria | 10760 |
| 87 | Ga0070685_10113602 | 3300005466 | Unclassified | 1672 |
| 88 | Ga0070706_100000514 | 3300005467 | Bacteria | 45375 |
| 89 | Ga0070706_100002982 | 3300005467 | Bacteria | 16776 |
| 90 | Ga0070706_100030168 | 3300005467 | Bacteria | 4995 |
| 91 | Ga0070706_100078384 | 3300005467 | Bacteria | 3059 |
| 92 | Ga0070707_100000662 | 3300005468 | Bacteria | 34318 |
| 93 | Ga0070707_100008218 | 3300005468 | Bacteria | 9680 |
| 94 | Ga0070707_100339466 | 3300005468 | Bacteria | 1459 |
| 95 | Ga0070707_100517437 | 3300005468 | Bacteria | 1155 |
| 96 | Ga0070698_100000133 | 3300005471 | Bacteria | 65381 |
| 97 | Ga0070698_100002043 | 3300005471 | Bacteria | 22426 |
| 98 | Ga0070698_100041613 | 3300005471 | Unclassified | 4717 |
| 99 | Ga0070698_100141600 | 3300005471 | Bacteria | 2356 |
| 100 | Ga0070698_101397711 | 3300005471 | Bacteria | 651 |
| 101 | Ga0070699_100000441 | 3300005518 | Bacteria | 39851 |
| 102 | Ga0070699_100148651 | 3300005518 | Bacteria | 2071 |
| 103 | Ga0070699_100645449 | 3300005518 | Bacteria | 966 |
| 104 | Ga0070699_101533879 | 3300005518 | Unclassified | 611 |
| 105 | Ga0070679_100007709 | 3300005530 | Bacteria | 10077 |
| 106 | Ga0070679_100307049 | 3300005530 | Bacteria | 1537 |
| 107 | Ga0070679_100642167 | 3300005530 | Bacteria | 1004 |
| 108 | Ga0070679_100753339 | 3300005530 | Unclassified | 917 |
| 109 | Ga0070684_100001890 | 3300005535 | Bacteria | 15344 |
| 110 | Ga0070684_100034871 | 3300005535 | Bacteria | 4305 |
| 111 | Ga0070684_100048290 | 3300005535 | Unclassified | 3692 |
| 112 | Ga0070697_100000158 | 3300005536 | Bacteria | 55228 |
| 113 | Ga0070697_100004513 | 3300005536 | Bacteria | 10700 |
| 114 | Ga0070697_100860253 | 3300005536 | Unclassified | 803 |
| 115 | Ga0070697_101249264 | 3300005536 | Bacteria | 662 |
| 116 | Ga0068853_100023962 | 3300005539 | Bacteria | 5115 |
| 117 | Ga0068853_100030598 | 3300005539 | Unclassified | 4548 |
| 118 | Ga0068853_100107639 | 3300005539 | Unclassified | 2472 |
| 119 | Ga0068853_100128952 | 3300005539 | Bacteria | 2262 |
| 120 | Ga0068853_100290612 | 3300005539 | Bacteria | 1509 |
| 121 | Ga0068853_100668392 | 3300005539 | Bacteria | 989 |
| 122 | Ga0070672_100006210 | 3300005543 | Bacteria | 8003 |
| 123 | Ga0070672_100956800 | 3300005543 | Unclassified | 758 |
| 124 | Ga0070686_100001751 | 3300005544 | Bacteria | 12151 |
| 125 | Ga0070686_100120132 | 3300005544 | Bacteria | 1803 |
| 126 | Ga0070695_100042489 | 3300005545 | Unclassified | 2886 |
| 127 | Ga0070696_100043518 | 3300005546 | Bacteria | 3107 |
| 128 | Ga0070696_100264152 | 3300005546 | Bacteria | 1306 |
| 129 | Ga0070693_100013310 | 3300005547 | Bacteria | 4188 |
| 130 | Ga0070693_100051240 | 3300005547 | Unclassified | 2363 |
| 131 | Ga0070693_100115422 | 3300005547 | Bacteria | 1658 |
| 132 | Ga0070693_100187290 | 3300005547 | Bacteria | 1336 |
| 133 | Ga0070665_100924805 | 3300005548 | Bacteria | 885 |
| 134 | Ga0068855_100016183 | 3300005563 | Bacteria | 8967 |
| 135 | Ga0068855_100100414 | 3300005563 | Bacteria | 3332 |
| 136 | Ga0068855_100173193 | 3300005563 | Bacteria | 2443 |
| 137 | Ga0068855_100711223 | 3300005563 | Unclassified | 1074 |
| 138 | Ga0070664_100103197 | 3300005564 | Bacteria | 2482 |
| 139 | Ga0068857_100011308 | 3300005577 | Bacteria | 7766 |
| 140 | Ga0068854_100074203 | 3300005578 | Unclassified | 2495 |
| 141 | Ga0068854_100082416 | 3300005578 | Bacteria | 2378 |
| 142 | Ga0068854_100111291 | 3300005578 | Bacteria | 2066 |
| 143 | Ga0068856_100036173 | 3300005614 | Unclassified | 4841 |
| 144 | Ga0068856_100047478 | 3300005614 | Unclassified | 4229 |
| 145 | Ga0068856_100064506 | 3300005614 | Bacteria | 3619 |
| 146 | Ga0068856_100131638 | 3300005614 | Bacteria | 2506 |
| 147 | Ga0068856_100841938 | 3300005614 | Unclassified | 936 |
| 148 | Ga0068852_100023791 | 3300005616 | Bacteria | 4938 |
| 149 | Ga0068852_100146592 | 3300005616 | Unclassified | 2190 |
| 150 | Ga0068852_100167955 | 3300005616 | Bacteria | 2054 |
| 151 | Ga0068859_100015642 | 3300005617 | Bacteria | 7623 |
| 152 | Ga0068859_100231181 | 3300005617 | Bacteria | 1937 |
| 153 | Ga0068864_100202753 | 3300005618 | Bacteria | 1823 |
| 154 | Ga0068864_100513341 | 3300005618 | Bacteria | 1154 |
| 155 | Ga0068866_10063788 | 3300005718 | Bacteria | 1921 |
| 156 | Ga0068866_10106325 | 3300005718 | Bacteria | 1557 |
| 157 | Ga0068866_10800270 | 3300005718 | Unclassified | 655 |
| 158 | Ga0068861_100494305 | 3300005719 | Bacteria | 1105 |
| 159 | Ga0068851_10003046 | 3300005834 | Bacteria | 7410 |
| 160 | Ga0068851_10401575 | 3300005834 | Unclassified | 806 |
| 161 | Ga0068863_100012969 | 3300005841 | Bacteria | 8036 |
| 162 | Ga0068863_100283073 | 3300005841 | Bacteria | 1607 |
| 163 | Ga0068863_100544867 | 3300005841 | Bacteria | 1145 |
| 164 | Ga0068858_100001619 | 3300005842 | Bacteria | 22968 |
| 165 | Ga0068858_100031852 | 3300005842 | Bacteria | 4900 |
| 166 | Ga0068860_100005894 | 3300005843 | Bacteria | 12335 |
| 167 | Ga0068860_100164584 | 3300005843 | Bacteria | 2140 |
| 168 | Ga0068860_100430970 | 3300005843 | Bacteria | 1308 |
| 169 | Ga0068860_101049845 | 3300005843 | Bacteria | 833 |
| 170 | Ga0068862_100102267 | 3300005844 | Bacteria | 2508 |
| 171 | Ga0068862_100600571 | 3300005844 | Bacteria | 1056 |
| 172 | Ga0068862_100925398 | 3300005844 | Bacteria | 858 |
| 173 | Ga0070717_10008691 | 3300006028 | Bacteria | 7599 |
| 174 | Ga0070717_10032983 | 3300006028 | Bacteria | 4176 |
| 175 | Ga0070717_10033339 | 3300006028 | Bacteria | 4155 |
| 176 | Ga0070717_10043538 | 3300006028 | Bacteria | 3665 |
| 177 | Ga0070717_10053000 | 3300006028 | Unclassified | 3343 |
| 178 | Ga0070717_10154341 | 3300006028 | Bacteria | 1988 |
| 179 | Ga0070717_10424688 | 3300006028 | Unclassified | 1196 |
| 180 | Ga0070717_10590216 | 3300006028 | Unclassified | 1007 |
| 181 | Ga0070717_10595458 | 3300006028 | Bacteria | 1003 |
| 182 | Ga0070717_11100481 | 3300006028 | Bacteria | 724 |
| 183 | Ga0070717_11719321 | 3300006028 | Unclassified | 567 |
| 184 | Ga0070715_10006826 | 3300006163 | Bacteria | 3897 |
| 185 | Ga0070715_10053637 | 3300006163 | Unclassified | 1743 |
| 186 | Ga0070715_10231786 | 3300006163 | Unclassified | 955 |
| 187 | Ga0070715_10317657 | 3300006163 | Unclassified | 839 |
| 188 | Ga0070715_10355308 | 3300006163 | Unclassified | 801 |
| 189 | Ga0070715_10978224 | 3300006163 | Unclassified | 526 |
| 190 | Ga0070716_100113337 | 3300006173 | Bacteria | 1684 |
| 191 | Ga0070716_100240155 | 3300006173 | Unclassified | 1228 |
| 192 | Ga0070716_101469254 | 3300006173 | Unclassified | 556 |
| 193 | Ga0070716_101780536 | 3300006173 | Unclassified | 510 |
| 194 | Ga0070712_100000618 | 3300006175 | Bacteria | 20900 |
| 195 | Ga0070712_100015567 | 3300006175 | Bacteria | 4904 |
| 196 | Ga0070712_100107060 | 3300006175 | Bacteria | 2079 |
| 197 | Ga0070712_100211627 | 3300006175 | Bacteria | 1529 |
| 198 | Ga0070712_100560590 | 3300006175 | Unclassified | 963 |
| 199 | Ga0097621_100014488 | 3300006237 | Bacteria | 5901 |
| 200 | Ga0097621_100083010 | 3300006237 | Bacteria | 2669 |
| 201 | Ga0097621_100164056 | 3300006237 | Bacteria | 1911 |
| 202 | Ga0097621_100351280 | 3300006237 | Unclassified | 1311 |
| 203 | Ga0097621_100753119 | 3300006237 | Bacteria | 900 |
| 204 | Ga0068871_100000727 | 3300006358 | Bacteria | 22355 |
| 205 | Ga0068871_100085050 | 3300006358 | Bacteria | 2625 |
| 206 | Ga0068871_100413387 | 3300006358 | Unclassified | 1203 |
| 207 | Ga0068871_100734512 | 3300006358 | Bacteria | 906 |
| 208 | Ga0068871_101284448 | 3300006358 | Unclassified | 688 |
| 209 | Ga0075434_100010363 | 3300006871 | Bacteria | 8737 |
| 210 | Ga0068865_100191958 | 3300006881 | Bacteria | 1580 |
| 211 | Ga0068865_100838901 | 3300006881 | Bacteria | 795 |
| 212 | Ga0075436_100067927 | 3300006914 | Bacteria | 2463 |
| 213 | Ga0075436_100078930 | 3300006914 | Bacteria | 2280 |
| 214 | Ga0075436_100244265 | 3300006914 | Bacteria | 1277 |
| 215 | Ga0097620_100015642 | 3300006931 | Bacteria | 7623 |
| 216 | Ga0097620_100231172 | 3300006931 | Bacteria | 1937 |
| 217 | Ga0075435_100010920 | 3300007076 | Bacteria | 6655 |
| 218 | Ga0075435_100078986 | 3300007076 | Unclassified | 2699 |
| 219 | Ga0099795_10096096 | 3300007788 | Unclassified | 1156 |
| 220 | Ga0099795_10253507 | 3300007788 | Unclassified | 760 |
| 221 | Ga0105250_10058724 | 3300009092 | Bacteria | 1544 |
| 222 | Ga0105240_10017855 | 3300009093 | Bacteria | 9546 |
| 223 | Ga0105240_10236771 | 3300009093 | Bacteria | 2118 |
| 224 | Ga0105240_10530084 | 3300009093 | Bacteria | 1306 |
| 225 | Ga0105240_10904541 | 3300009093 | Unclassified | 949 |
| 226 | Ga0105240_11247680 | 3300009093 | Unclassified | 786 |
| 227 | Ga0105240_12623547 | 3300009093 | Unclassified | 520 |
| 228 | Ga0105245_10004451 | 3300009098 | Bacteria | 12389 |
| 229 | Ga0105245_10015530 | 3300009098 | Bacteria | 6640 |
| 230 | Ga0105245_10016248 | 3300009098 | Bacteria | 6488 |
| 231 | Ga0105245_10023501 | 3300009098 | Bacteria | 5411 |
| 232 | Ga0105245_10076932 | 3300009098 | Bacteria | 3041 |
| 233 | Ga0105245_10103758 | 3300009098 | Bacteria | 2635 |
| 234 | Ga0105247_10149755 | 3300009101 | Unclassified | 1537 |
| 235 | Ga0105247_10840865 | 3300009101 | Unclassified | 704 |
| 236 | Ga0114129_10108973 | 3300009147 | Unclassified | 3823 |
| 237 | Ga0105241_10001007 | 3300009174 | Bacteria | 21393 |
| 238 | Ga0105241_10028094 | 3300009174 | Bacteria | 4189 |
| 239 | Ga0105241_10038332 | 3300009174 | Unclassified | 3612 |
| 240 | Ga0105241_10142388 | 3300009174 | Bacteria | 1954 |
| 241 | Ga0105241_10647399 | 3300009174 | Bacteria | 959 |
| 242 | Ga0105242_10077078 | 3300009176 | Bacteria | 2781 |
| 243 | Ga0105242_10101530 | 3300009176 | Bacteria | 2438 |
| 244 | Ga0105242_10167508 | 3300009176 | Unclassified | 1928 |
| 245 | Ga0105248_10011618 | 3300009177 | Bacteria | 9700 |
| 246 | Ga0105248_10181549 | 3300009177 | Bacteria | 2371 |
| 247 | Ga0105248_10341789 | 3300009177 | Bacteria | 1685 |
| 248 | Ga0105237_10090996 | 3300009545 | Unclassified | 3040 |
| 249 | Ga0105237_10122178 | 3300009545 | Bacteria | 2598 |
| 250 | Ga0105237_10314223 | 3300009545 | Unclassified | 1570 |
| 251 | Ga0105238_10007234 | 3300009551 | Bacteria | 11111 |
| 252 | Ga0105238_10025226 | 3300009551 | Bacteria | 6058 |
| 253 | Ga0105238_10050778 | 3300009551 | Bacteria | 4174 |
| 254 | Ga0105238_10107866 | 3300009551 | Unclassified | 2765 |
| 255 | Ga0105238_11476163 | 3300009551 | Bacteria | 708 |
| 256 | Ga0105249_10013908 | 3300009553 | Bacteria | 7114 |
| 257 | Ga0105239_10040875 | 3300010375 | Bacteria | 5081 |
| 258 | Ga0105239_10044409 | 3300010375 | Bacteria | 4872 |
| 259 | Ga0105239_10200638 | 3300010375 | Unclassified | 2235 |
| 260 | Ga0105239_10672912 | 3300010375 | Unclassified | 1183 |
| 261 | Ga0105239_11118363 | 3300010375 | Bacteria | 907 |
| 262 | Ga0105246_10007859 | 3300011119 | Bacteria | 6545 |
| 263 | Ga0157373_10003057 | 3300013100 | Bacteria | 12628 |
| 264 | Ga0157373_10013678 | 3300013100 | Bacteria | 5950 |
| 265 | Ga0157373_10046473 | 3300013100 | Unclassified | 3098 |
| 266 | Ga0157373_10486121 | 3300013100 | Bacteria | 891 |
| 267 | Ga0157373_10837328 | 3300013100 | Unclassified | 680 |
| 268 | Ga0157371_10002264 | 3300013102 | Bacteria | 18550 |
| 269 | Ga0157371_10758414 | 3300013102 | Unclassified | 729 |
| 270 | Ga0157370_10044441 | 3300013104 | Bacteria | 4270 |
| 271 | Ga0157370_10088625 | 3300013104 | Bacteria | 2906 |
| 272 | Ga0157370_10591219 | 3300013104 | Bacteria | 1016 |
| 273 | Ga0157369_10008028 | 3300013105 | Bacteria | 12111 |
| 274 | Ga0157369_10015743 | 3300013105 | Bacteria | 8521 |
| 275 | Ga0157369_10095020 | 3300013105 | Unclassified | 3182 |
| 276 | Ga0157369_10111522 | 3300013105 | Unclassified | 2907 |
| 277 | Ga0157369_10122337 | 3300013105 | Bacteria | 2760 |
| 278 | Ga0157369_10573976 | 3300013105 | Bacteria | 1165 |
| 279 | Ga0157369_10696712 | 3300013105 | Unclassified | 1046 |
| 280 | Ga0157369_12502146 | 3300013105 | Bacteria | 523 |
| 281 | Ga0157374_10000228 | 3300013296 | Bacteria | 52018 |
| 282 | Ga0157374_10097761 | 3300013296 | Bacteria | 2810 |
| 283 | Ga0157374_10119686 | 3300013296 | Unclassified | 2540 |
| 284 | Ga0157374_10140646 | 3300013296 | Bacteria | 2343 |
| 285 | Ga0157374_10899063 | 3300013296 | Unclassified | 903 |
| 286 | Ga0157378_10000351 | 3300013297 | Bacteria | 45196 |
| 287 | Ga0157378_10007903 | 3300013297 | Bacteria | 9278 |
| 288 | Ga0157378_10051290 | 3300013297 | Bacteria | 3671 |
| 289 | Ga0157378_10226359 | 3300013297 | Bacteria | 1780 |
| 290 | Ga0163162_10004210 | 3300013306 | Bacteria | 13826 |
| 291 | Ga0163162_10019239 | 3300013306 | Bacteria | 6695 |
| 292 | Ga0163162_10088487 | 3300013306 | Bacteria | 3176 |
| 293 | Ga0157372_10005053 | 3300013307 | Bacteria | 14015 |
| 294 | Ga0157372_10009228 | 3300013307 | Bacteria | 10487 |
| 295 | Ga0157372_10009344 | 3300013307 | Bacteria | 10434 |
| 296 | Ga0157372_10039206 | 3300013307 | Bacteria | 5229 |
| 297 | Ga0157372_10054048 | 3300013307 | Bacteria | 4478 |
| 298 | Ga0157372_10517749 | 3300013307 | Bacteria | 1391 |
| 299 | Ga0157372_10676801 | 3300013307 | Bacteria | 1201 |
| 300 | Ga0157372_11031544 | 3300013307 | Bacteria | 952 |
| 301 | Ga0157372_12292005 | 3300013307 | Unclassified | 620 |
| 302 | Ga0157372_12294762 | 3300013307 | Unclassified | 620 |
| 303 | Ga0157372_12794936 | 3300013307 | Unclassified | 560 |
| 304 | Ga0157375_10140664 | 3300013308 | Bacteria | 2540 |
| 305 | Ga0157375_10300217 | 3300013308 | Bacteria | 1769 |
| 306 | Ga0163163_10036969 | 3300014325 | Bacteria | 4747 |
| 307 | Ga0163163_10074333 | 3300014325 | Bacteria | 3390 |
| 308 | Ga0163163_10414669 | 3300014325 | Unclassified | 1405 |
| 309 | Ga0157380_10019901 | 3300014326 | Bacteria | 5008 |
| 310 | Ga0182008_10288597 | 3300014497 | Bacteria | 856 |
| 311 | Ga0157377_10004842 | 3300014745 | Bacteria | 6260 |
| 312 | Ga0157379_10028378 | 3300014968 | Bacteria | 4978 |
| 313 | Ga0157379_10209581 | 3300014968 | Bacteria | 1764 |
| 314 | Ga0157379_11281866 | 3300014968 | Unclassified | 707 |
| 315 | Ga0157376_10008129 | 3300014969 | Bacteria | 7541 |
| 316 | Ga0157376_10024032 | 3300014969 | Unclassified | 4779 |
| 317 | Ga0157376_10038962 | 3300014969 | Bacteria | 3871 |
| 318 | Ga0157376_10260880 | 3300014969 | Unclassified | 1623 |
| 319 | Ga0157376_10400097 | 3300014969 | Bacteria | 1328 |
| 320 | Ga0182007_10131503 | 3300015262 | Unclassified | 842 |
| 321 | Ga0163161_10028230 | 3300017792 | Bacteria | 3984 |
| 322 | Ga0206352_10348191 | 3300020078 | Bacteria | 759 |
| 323 | Ga0213873_10035658 | 3300021358 | Bacteria | 1259 |
| 324 | Ga0213874_10106241 | 3300021377 | Unclassified | 939 |
| 325 | Ga0213876_10294716 | 3300021384 | Unclassified | 862 |
| 326 | Ga0213875_10081889 | 3300021388 | Bacteria | 1506 |
| 327 | Ga0224572_1000176 | 3300024225 | Bacteria | 5867 |
| 328 | Ga0224572_1013048 | 3300024225 | Bacteria | 1584 |
| 329 | Ga0224572_1029944 | 3300024225 | Bacteria | 1040 |
| 330 | Ga0228598_1000403 | 3300024227 | Bacteria | 8753 |
| 331 | Ga0228598_1002548 | 3300024227 | Unclassified | 3960 |
| 332 | Ga0228598_1002880 | 3300024227 | Unclassified | 3734 |
| 333 | Ga0207697_10009374 | 3300025315 | Bacteria | 4233 |
| 334 | Ga0207697_10455362 | 3300025315 | Unclassified | 567 |
| 335 | Ga0207656_10173335 | 3300025321 | Bacteria | 1032 |
| 336 | Ga0207696_1036623 | 3300025711 | Bacteria | 1456 |
| 337 | Ga0207682_10018935 | 3300025893 | Bacteria | 2694 |
| 338 | Ga0207692_10003777 | 3300025898 | Bacteria | 5947 |
| 339 | Ga0207692_10062682 | 3300025898 | Unclassified | 1930 |
| 340 | Ga0207692_10071393 | 3300025898 | Unclassified | 1831 |
| 341 | Ga0207692_10122162 | 3300025898 | Unclassified | 1460 |
| 342 | Ga0207692_10219974 | 3300025898 | Bacteria | 1125 |
| 343 | Ga0207692_10220986 | 3300025898 | Unclassified | 1123 |
| 344 | Ga0207692_10245778 | 3300025898 | Unclassified | 1070 |
| 345 | Ga0207692_10599349 | 3300025898 | Bacteria | 708 |
| 346 | Ga0207642_10100494 | 3300025899 | Bacteria | 1451 |
| 347 | Ga0207642_10102843 | 3300025899 | Bacteria | 1438 |
| 348 | Ga0207642_10538394 | 3300025899 | Bacteria | 720 |
| 349 | Ga0207710_10025991 | 3300025900 | Bacteria | 2528 |
| 350 | Ga0207710_10140930 | 3300025900 | Unclassified | 1164 |
| 351 | Ga0207688_10204170 | 3300025901 | Bacteria | 1186 |
| 352 | Ga0207680_10595048 | 3300025903 | Unclassified | 791 |
| 353 | Ga0207647_10002741 | 3300025904 | Bacteria | 13294 |
| 354 | Ga0207647_10044334 | 3300025904 | Bacteria | 2780 |
| 355 | Ga0207685_10018117 | 3300025905 | Unclassified | 2292 |
| 356 | Ga0207699_10000209 | 3300025906 | Bacteria | 34945 |
| 357 | Ga0207699_10076393 | 3300025906 | Unclassified | 2063 |
| 358 | Ga0207699_10122246 | 3300025906 | Bacteria | 1686 |
| 359 | Ga0207699_10137199 | 3300025906 | Bacteria | 1603 |
| 360 | Ga0207699_10370606 | 3300025906 | Unclassified | 1014 |
| 361 | Ga0207699_10674507 | 3300025906 | Bacteria | 756 |
| 362 | Ga0207645_10001689 | 3300025907 | Bacteria | 17919 |
| 363 | Ga0207643_10002573 | 3300025908 | Bacteria | 9824 |
| 364 | Ga0207684_10000614 | 3300025910 | Bacteria | 42486 |
| 365 | Ga0207684_10001907 | 3300025910 | Bacteria | 21656 |
| 366 | Ga0207684_10024360 | 3300025910 | Bacteria | 5161 |
| 367 | Ga0207684_10246043 | 3300025910 | Bacteria | 1543 |
| 368 | Ga0207684_10286568 | 3300025910 | Bacteria | 1420 |
| 369 | Ga0207654_10108898 | 3300025911 | Bacteria | 1720 |
| 370 | Ga0207654_10209718 | 3300025911 | Unclassified | 1287 |
| 371 | Ga0207654_10548730 | 3300025911 | Bacteria | 821 |
| 372 | Ga0207707_10003911 | 3300025912 | Bacteria | 13216 |
| 373 | Ga0207707_10175985 | 3300025912 | Bacteria | 1869 |
| 374 | Ga0207707_10888904 | 3300025912 | Bacteria | 737 |
| 375 | Ga0207695_10068765 | 3300025913 | Unclassified | 3628 |
| 376 | Ga0207695_10268869 | 3300025913 | Bacteria | 1601 |
| 377 | Ga0207671_10028761 | 3300025914 | Unclassified | 4152 |
| 378 | Ga0207671_10070899 | 3300025914 | Bacteria | 2598 |
| 379 | Ga0207671_10084422 | 3300025914 | Bacteria | 2385 |
| 380 | Ga0207671_10213753 | 3300025914 | Bacteria | 1509 |
| 381 | Ga0207693_10000026 | 3300025915 | Bacteria | 122717 |
| 382 | Ga0207693_10022287 | 3300025915 | Bacteria | 5033 |
| 383 | Ga0207693_10042186 | 3300025915 | Bacteria | 3592 |
| 384 | Ga0207693_10108137 | 3300025915 | Unclassified | 2181 |
| 385 | Ga0207693_10118098 | 3300025915 | Bacteria | 2083 |
| 386 | Ga0207693_10192970 | 3300025915 | Unclassified | 1603 |
| 387 | Ga0207693_10333332 | 3300025915 | Unclassified | 1188 |
| 388 | Ga0207693_11291839 | 3300025915 | Bacteria | 546 |
| 389 | Ga0207693_11333860 | 3300025915 | Unclassified | 535 |
| 390 | Ga0207663_10193191 | 3300025916 | Unclassified | 1463 |
| 391 | Ga0207663_10220753 | 3300025916 | Bacteria | 1379 |
| 392 | Ga0207660_10539305 | 3300025917 | Bacteria | 948 |
| 393 | Ga0207660_10544856 | 3300025917 | Bacteria | 943 |
| 394 | Ga0207662_10012728 | 3300025918 | Bacteria | 4690 |
| 395 | Ga0207657_10003520 | 3300025919 | Bacteria | 16725 |
| 396 | Ga0207649_10000445 | 3300025920 | Bacteria | 29893 |
| 397 | Ga0207646_10002238 | 3300025922 | Bacteria | 23047 |
| 398 | Ga0207646_10044442 | 3300025922 | Bacteria | 3988 |
| 399 | Ga0207646_10071657 | 3300025922 | Unclassified | 3095 |
| 400 | Ga0207646_10116788 | 3300025922 | Bacteria | 2396 |
| 401 | Ga0207646_10294226 | 3300025922 | Bacteria | 1467 |
| 402 | Ga0207646_10372694 | 3300025922 | Bacteria | 1290 |
| 403 | Ga0207681_10064843 | 3300025923 | Bacteria | 2523 |
| 404 | Ga0207694_10089006 | 3300025924 | Unclassified | 2434 |
| 405 | Ga0207694_10335154 | 3300025924 | Unclassified | 1250 |
| 406 | Ga0207650_10000053 | 3300025925 | Bacteria | 164599 |
| 407 | Ga0207650_10644663 | 3300025925 | Bacteria | 893 |
| 408 | Ga0207659_10040078 | 3300025926 | Bacteria | 3272 |
| 409 | Ga0207687_10007071 | 3300025927 | Bacteria | 7397 |
| 410 | Ga0207687_10057994 | 3300025927 | Bacteria | 2722 |
| 411 | Ga0207687_10097425 | 3300025927 | Bacteria | 2157 |
| 412 | Ga0207687_10120730 | 3300025927 | Bacteria | 1960 |
| 413 | Ga0207700_10000306 | 3300025928 | Bacteria | 28993 |
| 414 | Ga0207700_10016653 | 3300025928 | Bacteria | 4890 |
| 415 | Ga0207700_10041153 | 3300025928 | Bacteria | 3379 |
| 416 | Ga0207700_10085731 | 3300025928 | Unclassified | 2473 |
| 417 | Ga0207700_10298695 | 3300025928 | Bacteria | 1390 |
| 418 | Ga0207700_10765699 | 3300025928 | Bacteria | 863 |
| 419 | Ga0207700_10816665 | 3300025928 | Bacteria | 834 |
| 420 | Ga0207700_10884992 | 3300025928 | Unclassified | 799 |
| 421 | Ga0207700_11128287 | 3300025928 | Unclassified | 701 |
| 422 | Ga0207700_11372808 | 3300025928 | Unclassified | 629 |
| 423 | Ga0207700_11915654 | 3300025928 | Unclassified | 519 |
| 424 | Ga0207664_10190336 | 3300025929 | Bacteria | 1766 |
| 425 | Ga0207664_10385894 | 3300025929 | Bacteria | 1244 |
| 426 | Ga0207664_10458459 | 3300025929 | Unclassified | 1138 |
| 427 | Ga0207664_10786928 | 3300025929 | Bacteria | 856 |
| 428 | Ga0207644_10019899 | 3300025931 | Bacteria | 4558 |
| 429 | Ga0207706_10002255 | 3300025933 | Bacteria | 18825 |
| 430 | Ga0207670_10015855 | 3300025936 | Bacteria | 4512 |
| 431 | Ga0207704_10049962 | 3300025938 | Bacteria | 2520 |
| 432 | Ga0207704_11265060 | 3300025938 | Unclassified | 630 |
| 433 | Ga0207665_10012284 | 3300025939 | Bacteria | 5623 |
| 434 | Ga0207665_10027306 | 3300025939 | Unclassified | 3772 |
| 435 | Ga0207665_10221405 | 3300025939 | Bacteria | 1387 |
| 436 | Ga0207665_10492818 | 3300025939 | Unclassified | 946 |
| 437 | Ga0207665_10516230 | 3300025939 | Unclassified | 925 |
| 438 | Ga0207665_10836458 | 3300025939 | Bacteria | 728 |
| 439 | Ga0207691_10003568 | 3300025940 | Bacteria | 15137 |
| 440 | Ga0207691_10658464 | 3300025940 | Unclassified | 884 |
| 441 | Ga0207711_10379737 | 3300025941 | Bacteria | 1311 |
| 442 | Ga0207689_10000542 | 3300025942 | Bacteria | 35861 |
| 443 | Ga0207689_10002682 | 3300025942 | Bacteria | 16456 |
| 444 | Ga0207661_10001208 | 3300025944 | Bacteria | 17288 |
| 445 | Ga0207661_10213512 | 3300025944 | Bacteria | 1702 |
| 446 | Ga0207661_11208026 | 3300025944 | Unclassified | 696 |
| 447 | Ga0207679_10001783 | 3300025945 | Bacteria | 13399 |
| 448 | Ga0207679_10684147 | 3300025945 | Bacteria | 930 |
| 449 | Ga0207667_10144355 | 3300025949 | Bacteria | 2450 |
| 450 | Ga0207667_10216361 | 3300025949 | Unclassified | 1963 |
| 451 | Ga0207667_10326260 | 3300025949 | Bacteria | 1567 |
| 452 | Ga0207667_10735314 | 3300025949 | Unclassified | 987 |
| 453 | Ga0207651_10001496 | 3300025960 | Bacteria | 10642 |
| 454 | Ga0207668_10139975 | 3300025972 | Bacteria | 1859 |
| 455 | Ga0207640_10044827 | 3300025981 | Bacteria | 2836 |
| 456 | Ga0207640_10537863 | 3300025981 | Bacteria | 979 |
| 457 | Ga0207658_10005363 | 3300025986 | Bacteria | 8806 |
| 458 | Ga0207658_10335220 | 3300025986 | Bacteria | 1313 |
| 459 | Ga0207677_10009986 | 3300026023 | Bacteria | 5357 |
| 460 | Ga0207677_10059432 | 3300026023 | Bacteria | 2637 |
| 461 | Ga0207677_10154437 | 3300026023 | Bacteria | 1775 |
| 462 | Ga0207677_10156120 | 3300026023 | Bacteria | 1767 |
| 463 | Ga0207703_10037964 | 3300026035 | Unclassified | 3840 |
| 464 | Ga0207639_10160227 | 3300026041 | Bacteria | 1895 |
| 465 | Ga0207639_10495742 | 3300026041 | Bacteria | 1115 |
| 466 | Ga0207678_10000840 | 3300026067 | Bacteria | 28166 |
| 467 | Ga0207708_10039749 | 3300026075 | Bacteria | 3585 |
| 468 | Ga0207702_10031974 | 3300026078 | Bacteria | 4389 |
| 469 | Ga0207702_10051111 | 3300026078 | Bacteria | 3492 |
| 470 | Ga0207702_10212654 | 3300026078 | Unclassified | 1798 |
| 471 | Ga0207702_10583109 | 3300026078 | Bacteria | 1096 |
| 472 | Ga0207702_11286552 | 3300026078 | Unclassified | 725 |
| 473 | Ga0207641_10000104 | 3300026088 | Bacteria | 122307 |
| 474 | Ga0207648_10002557 | 3300026089 | Bacteria | 19506 |
| 475 | Ga0207676_10000491 | 3300026095 | Bacteria | 33225 |
| 476 | Ga0207674_10001318 | 3300026116 | Bacteria | 32302 |
| 477 | Ga0207674_10134851 | 3300026116 | Unclassified | 2431 |
| 478 | Ga0207674_10871948 | 3300026116 | Bacteria | 868 |
| 479 | Ga0207683_10003204 | 3300026121 | Bacteria | 14276 |
| 480 | Ga0207683_10255159 | 3300026121 | Bacteria | 1601 |
| 481 | Ga0207698_10126136 | 3300026142 | Bacteria | 2177 |
| 482 | Ga0207698_10465464 | 3300026142 | Bacteria | 1223 |
| 483 | Ga0265356_1000478 | 3300028017 | Bacteria | 7213 |
| 484 | Ga0265356_1014073 | 3300028017 | Unclassified | 871 |
| 485 | Ga0268266_10005115 | 3300028379 | Bacteria | 12357 |
| 486 | Ga0268266_10636590 | 3300028379 | Unclassified | 1026 |
| 487 | Ga0268265_10005953 | 3300028380 | Bacteria | 8301 |
| 488 | Ga0268265_10033182 | 3300028380 | Bacteria | 3751 |
| 489 | Ga0268264_10551024 | 3300028381 | Bacteria | 1131 |
| 490 | Ga0265338_10000833 | 3300028800 | Bacteria | 52026 |
| 491 | Ga0265338_10074515 | 3300028800 | Bacteria | 2886 |
| 492 | Ga0265762_1000119 | 3300030760 | Bacteria | 11713 |
| 493 | Ga0265762_1000777 | 3300030760 | Bacteria | 5699 |
| 494 | Ga0265762_1006203 | 3300030760 | Unclassified | 2142 |
| 495 | Ga0265771_1000546 | 3300031010 | Bacteria | 1434 |
| 496 | Ga0265760_10009809 | 3300031090 | Bacteria | 2733 |
| 497 | Ga0265760_10032909 | 3300031090 | Bacteria | 1531 |
| 498 | Ga0265332_10069161 | 3300031238 | Bacteria | 1505 |
| 499 | Ga0265328_10019321 | 3300031239 | Bacteria | 2619 |
| 500 | Ga0265320_10205923 | 3300031240 | Bacteria | 878 |
| 501 | Ga0265325_10017529 | 3300031241 | Bacteria | 3979 |
| 502 | Ga0265329_10164764 | 3300031242 | Bacteria | 721 |
| 503 | Ga0265340_10021603 | 3300031247 | Bacteria | 3301 |
| 504 | Ga0265340_10254714 | 3300031247 | Bacteria | 782 |
| 505 | Ga0265339_10003136 | 3300031249 | Bacteria | 11639 |
| 506 | Ga0265339_10020977 | 3300031249 | Bacteria | 3810 |
| 507 | Ga0265339_10219118 | 3300031249 | Bacteria | 931 |
| 508 | Ga0265339_10314609 | 3300031249 | Bacteria | 744 |
| 509 | Ga0265327_10153153 | 3300031251 | Bacteria | 1069 |
| 510 | Ga0265316_10014345 | 3300031344 | Bacteria | 6978 |
| 511 | Ga0265316_10018684 | 3300031344 | Bacteria | 5953 |
| 512 | Ga0265313_10027981 | 3300031595 | Bacteria | 2940 |
| 513 | Ga0265314_10024132 | 3300031711 | Bacteria | 4618 |
| 514 | Ga0265342_10387979 | 3300031712 | Bacteria | 723 |
| 515 | Ga0373926_0004972 | 3300035083 | Bacteria | 4368 |
| 516 | Ga0373944_0070597 | 3300035089 | Unclassified | 1137 |
| 517 | Ga0373923_0027165 | 3300035111 | Unclassified | 2281 |
| 518 | Ga0373936_0365073 | 3300035113 | Bacteria | 659 |
| 519 | Ga0373941_0077851 | 3300035115 | Bacteria | 1114 |
| 520 | Ga0373945_0021612 | 3300035116 | Bacteria | 2212 |
| 521 | Ga0373953_0031745 | 3300035117 | Unclassified | 2056 |
| 522 | Ga0373956_0126175 | 3300035119 | Bacteria | 1197 |
| 523 | Ga0373956_0324444 | 3300035119 | Unclassified | 734 |
| 524 | Ga0373957_0013624 | 3300035120 | Bacteria | 2763 |
| 525 | Ga0373957_0156654 | 3300035120 | Unclassified | 937 |
| 526 | Ga0373960_0080803 | 3300035121 | Bacteria | 1023 |
| 527 | Ga0373943_0001571 | 3300035170 | Bacteria | 10341 |
| 528 | Ga0373943_0065449 | 3300035170 | Bacteria | 1828 |
| 529 | Ga0373946_0015286 | 3300035171 | Bacteria | 2907 |
| 530 | Ga0373946_0083015 | 3300035171 | Unclassified | 1406 |
| 531 | Ga0373955_0268149 | 3300035172 | Unclassified | 1026 |
| 532 | Ga0373955_0610977 | 3300035172 | Bacteria | 668 |
| 533 | Ga0373924_0000245 | 3300035410 | Bacteria | 16588 |
| 534 | Ga0373924_0548425 | 3300035410 | Unclassified | 520 |
| 535 | Ga0373931_0034450 | 3300035691 | Bacteria | 2628 |
| 536 | Ga0373935_0001333 | 3300035692 | Bacteria | 13657 |
| 537 | Ga0373935_0011396 | 3300035692 | Bacteria | 5338 |
| 538 | Ga0373935_0475651 | 3300035692 | Unclassified | 905 |
| 539 | Ga0373935_1323610 | 3300035692 | Bacteria | 538 |
| 540 | Ga0373935_1452538 | 3300035692 | Bacteria | 513 |
| 541 | Ga0373927_0016685 | 3300035695 | Bacteria | 4844 |
| 542 | Ga0373927_0049622 | 3300035695 | Bacteria | 2714 |
| 543 | Ga0373927_0162660 | 3300035695 | Unclassified | 1462 |
| 544 | Ga0373933_0029242 | 3300035724 | Bacteria | 3185 |
| 545 | Ga0373947_0006708 | 3300035725 | Bacteria | 6678 |
| 546 | Ga0373947_0124293 | 3300035725 | Bacteria | 1641 |
| 547 | Ga0373947_0355924 | 3300035725 | Bacteria | 983 |
| 548 | Ga0373937_0001894 | 3300036401 | Bacteria | 17556 |
| 549 | Ga0373937_0009542 | 3300036401 | Bacteria | 8442 |
| 550 | Ga0373937_0071560 | 3300036401 | Bacteria | 3198 |
| 551 | Ga0373937_0229004 | 3300036401 | Bacteria | 1750 |
| 552 | Ga0373937_1475266 | 3300036401 | Unclassified | 628 |
| 553 | Ga0373925_0001997 | 3300037068 | Bacteria | 16904 |
| 554 | Ga0373925_0375071 | 3300037068 | Unclassified | 1158 |
| 555 | Ga0395900_0592476 | 3300037418 | Bacteria | 1050 |
| 556 | Ga0395900_0933339 | 3300037418 | Bacteria | 790 |
| 557 | Ga0395900_1913195 | 3300037418 | Unclassified | 504 |
| 558 | Ga0395905_0770074 | 3300037471 | Bacteria | 865 |
| 559 | Ga0436364_0509543 | 3300037853 | Bacteria | 1533 |
| 560 | Ga0436365_0870448 | 3300039437 | Unclassified | 876 |
| 561 | Ga0436365_1880233 | 3300039437 | Bacteria | 3313 |
| 562 | Ga0436363_0090843 | 3300039450 | Unclassified | 1015 |
| 563 | Ga0436362_0052614 | 3300039453 | Unclassified | 770 |
| 564 | Ga0436362_0552319 | 3300039453 | Unclassified | 3813 |
| 565 | Ga0436362_0866066 | 3300039453 | Bacteria | 1033 |
| 566 | Ga0451839_1005903 | 3300041496 | Bacteria | 798 |
| 567 | Ga0451577_0040456 | 3300042876 | Bacteria | 4185 |
| 568 | Ga0466961_0581413 | 3300044693 | Unclassified | 674 |
| 569 | Ga0466961_0793281 | 3300044693 | Bacteria | 565 |
| 570 | Ga0453684_0000951 | 3300044712 | Bacteria | 95417 |
| 571 | Ga0451576_0010527 | 3300045051 | Bacteria | 10600 |
| 572 | Ga0451576_0298670 | 3300045051 | Unclassified | 1684 |
| 573 | Ga0451576_1629738 | 3300045051 | Unclassified | 669 |
| 574 | Ga0466958_0167589 | 3300045836 | Bacteria | 1390 |
| 575 | Ga0466958_0201330 | 3300045836 | Unclassified | 1267 |
| 576 | Ga0466967_0093299 | 3300045976 | Bacteria | 2739 |
| 577 | Ga0466967_1758143 | 3300045976 | Unclassified | 617 |
| 578 | Ga0495590_0115993 | 3300046457 | Bacteria | 958 |
| 579 | Ga0495651_0711465 | 3300046462 | Bacteria | 625 |
| 580 | Ga0495651_0835412 | 3300046462 | Unclassified | 567 |
| 581 | Ga0495653_0645844 | 3300046463 | Bacteria | 647 |
| 582 | Ga0495580_0034691 | 3300046472 | Bacteria | 3631 |
| 583 | Ga0495580_0852399 | 3300046472 | Unclassified | 588 |
| 584 | Ga0495582_0101589 | 3300046473 | Bacteria | 1610 |
| 585 | Ga0495582_0107652 | 3300046473 | Bacteria | 1565 |
| 586 | Ga0495652_0039044 | 3300046529 | Bacteria | 4107 |
| 587 | Ga0495665_0703510 | 3300046531 | Unclassified | 501 |
| 588 | Ga0495667_0328220 | 3300046559 | Unclassified | 968 |
| 589 | Ga0495635_1045262 | 3300046663 | Unclassified | 518 |
| 590 | Ga0495623_0001371 | 3300046679 | Bacteria | 16530 |
| 591 | Ga0495623_0263493 | 3300046679 | Bacteria | 965 |
| 592 | Ga0495658_0210100 | 3300046683 | Bacteria | 1216 |
| 593 | Ga0495624_0146024 | 3300046690 | Bacteria | 1448 |
| 594 | Ga0495581_0174655 | 3300047315 | Unclassified | 1256 |
| 595 | Ga0495604_0468992 | 3300047317 | Unclassified | 820 |
| 596 | Ga0495674_0565563 | 3300047319 | Unclassified | 904 |
| 597 | Ga0495680_0663361 | 3300047322 | Unclassified | 692 |
| 598 | Ga0495675_0023510 | 3300047444 | Bacteria | 3927 |
| 599 | Ga0495684_0718191 | 3300047471 | Unclassified | 661 |
| 600 | Ga0495593_0069639 | 3300047673 | Bacteria | 1829 |
| 601 | Ga0495614_0085676 | 3300048089 | Bacteria | 1368 |
| 602 | Ga0495614_0488914 | 3300048089 | Unclassified | 585 |
| 603 | Ga0496100_0181613 | 3300048903 | Bacteria | 1522 |
| 604 | Ga0496100_0800972 | 3300048903 | Bacteria | 738 |
| 605 | Ga0496101_0106541 | 3300048904 | Unclassified | 2105 |
| 606 | Ga0496101_0170924 | 3300048904 | Bacteria | 1671 |
| 607 | Ga0496102_0024594 | 3300048905 | Bacteria | 5355 |
| 608 | Ga0496102_0030087 | 3300048905 | Bacteria | 4860 |
| 609 | Ga0496102_0032116 | 3300048905 | Unclassified | 4716 |
| 610 | Ga0496102_0082818 | 3300048905 | Unclassified | 2959 |
| 611 | Ga0496102_0311210 | 3300048905 | Bacteria | 1484 |
| 612 | Ga0496102_0669525 | 3300048905 | Bacteria | 961 |
| 613 | Ga0496103_0352701 | 3300048906 | Bacteria | 946 |
| 614 | Ga0496104_0114347 | 3300048907 | Bacteria | 2588 |
| 615 | Ga0496104_0153959 | 3300048907 | Bacteria | 2207 |
| 616 | Ga0496104_0201121 | 3300048907 | Unclassified | 1904 |
| 617 | Ga0496104_0310870 | 3300048907 | Bacteria | 1489 |
| 618 | Ga0496104_0429886 | 3300048907 | Unclassified | 1232 |
| 619 | Ga0496105_0000399 | 3300048908 | Bacteria | 28536 |
| 620 | Ga0496105_0008491 | 3300048908 | Bacteria | 7980 |
| 621 | Ga0496105_0041633 | 3300048908 | Unclassified | 3786 |
| 622 | Ga0496105_0763426 | 3300048908 | Bacteria | 738 |
| 623 | Ga0496106_0687143 | 3300048909 | Bacteria | 816 |
| 624 | Ga0496107_1086226 | 3300048910 | Unclassified | 578 |
| 625 | Ga0496108_0000629 | 3300048911 | Bacteria | 27529 |
| 626 | Ga0496108_0685644 | 3300048911 | Bacteria | 889 |
| 627 | Ga0496109_0000270 | 3300048912 | Bacteria | 49971 |
| 628 | Ga0496110_0002501 | 3300048913 | Bacteria | 13796 |
| 629 | Ga0496110_0058340 | 3300048913 | Bacteria | 3400 |
| 630 | Ga0496111_0029137 | 3300048914 | Bacteria | 3919 |
| 631 | Ga0496111_0390933 | 3300048914 | Unclassified | 1028 |
| 632 | Ga0496112_0000121 | 3300048915 | Bacteria | 48786 |
| 633 | Ga0496112_0001780 | 3300048915 | Bacteria | 16927 |
| 634 | Ga0496112_0002178 | 3300048915 | Bacteria | 15583 |
| 635 | Ga0496112_0005362 | 3300048915 | Bacteria | 11080 |
| 636 | Ga0496112_0027881 | 3300048915 | Bacteria | 5448 |
| 637 | Ga0496112_0039232 | 3300048915 | Unclassified | 4627 |
| 638 | Ga0496112_0190516 | 3300048915 | Bacteria | 2013 |
| 639 | Ga0496112_0354675 | 3300048915 | Bacteria | 1409 |
| 640 | Ga0496112_1008876 | 3300048915 | Bacteria | 752 |
| 641 | Ga0496113_0002775 | 3300048916 | Bacteria | 10302 |
| 642 | Ga0496113_0114865 | 3300048916 | Unclassified | 2099 |
| 643 | Ga0496113_0380280 | 3300048916 | Unclassified | 1133 |
| 644 | Ga0496113_0455394 | 3300048916 | Bacteria | 1028 |
| 645 | Ga0496114_0138203 | 3300048917 | Unclassified | 2108 |
| 646 | Ga0496114_0902800 | 3300048917 | Bacteria | 765 |
| 647 | Ga0496115_0039011 | 3300048918 | Unclassified | 3771 |
| 648 | Ga0496115_0148247 | 3300048918 | Bacteria | 1937 |
| 649 | Ga0496115_0194256 | 3300048918 | Bacteria | 1677 |
| 650 | Ga0496115_0325195 | 3300048918 | Unclassified | 1257 |
| 651 | Ga0496115_0955356 | 3300048918 | Bacteria | 658 |
| 652 | Ga0496126_0001722 | 3300048929 | Bacteria | 32467 |
| 653 | nmdc:mga0rr50_629872_c1 | 3300050513 | Bacteria | 915 |
| 654 | nmdc:mga08x19_138127_c1 | 3300050514 | Bacteria | 1644 |
| 655 | nmdc:mga08x19_143618_c1 | 3300050514 | Bacteria | 1613 |
| 656 | nmdc:mga08x19_558765_c1 | 3300050514 | Bacteria | 810 |
| 657 | nmdc:mga08x19_642667_c1 | 3300050514 | Bacteria | 752 |
| 658 | nmdc:mga08x19_7445_c1 | 3300050514 | Bacteria | 6501 |
| 659 | Ga0495601_0394902 | 3300053077 | Bacteria | 897 |
| 660 | Ga0495619_0143241 | 3300053085 | Bacteria | 1647 |
| 661 | Ga0587073_0012920 | 3300059492 | Unclassified | 1457 |
| 662 | Ga0587077_061957 | 3300059493 | Unclassified | 813 |
| 663 | Ga0587080_054617 | 3300059503 | Unclassified | 763 |
| 664 | Ga0587094_109200 | 3300059513 | Unclassified | 542 |
| 665 | Ga0453683_0084065 | |||
| 666 | JGI24752J21851_1005183 | |||
| 667 | JGI24737J22298_10062513 | |||
| 668 | JGI24749J21850_1014250 | |||
| 669 | JGI24751J29686_10000897 | |||
| 670 | Ga0058859_10837192 | |||
| 671 | Ga0065712_10004139 | |||
| 672 | Ga0065715_10091689 | |||
| 673 | Ga0065707_10670428 | |||
| 674 | Ga0070658_10046918 | |||
| 675 | Ga0070676_10013721 | |||
| 676 | Ga0070683_100008827 | |||
| 677 | Ga0070690_100354913 | |||
| 678 | Ga0070670_100031846 | |||
| 679 | Ga0070670_100033866 | |||
| 680 | Ga0070677_10013649 | |||
| 681 | Ga0068869_100028188 | |||
| 682 | Ga0068869_100029145 | |||
| 683 | Ga0068869_100423063 | |||
| 684 | Ga0070666_10474238 | |||
| 685 | Ga0070666_10514694 | |||
| 686 | Ga0070680_100058493 | |||
| 687 | Ga0070680_100169592 | |||
| 688 | Ga0070682_100268276 | |||
| 689 | Ga0070682_101247167 | |||
| 690 | Ga0068868_100012207 | |||
| 691 | Ga0068868_100012948 | |||
| 692 | Ga0068868_100038646 | |||
| 693 | Ga0068868_100053277 | |||
| 694 | Ga0068868_100869427 | |||
| 695 | Ga0068868_100877012 | |||
| 696 | Ga0070660_100001606 | |||
| 697 | Ga0070689_100085365 | |||
| 698 | Ga0070687_100016278 | |||
| 699 | Ga0070661_100006213 | |||
| 700 | Ga0070661_100169521 | |||
| 701 | Ga0070668_100038070 | |||
| 702 | Ga0070669_100003780 | |||
| 703 | Ga0070675_100020211 | |||
| 704 | Ga0070671_100105310 | |||
| 705 | Ga0070673_100025124 | |||
| 706 | Ga0070673_100282077 | |||
| 707 | Ga0070688_100002957 | |||
| 708 | Ga0070659_100001742 | |||
| 709 | Ga0070667_100034672 | |||
| 710 | Ga0070667_101153071 | |||
| 711 | Ga0070709_10116272 | |||
| 712 | Ga0070709_10125231 | |||
| 713 | Ga0070709_10517563 | |||
| 714 | Ga0070714_100117023 | |||
| 715 | Ga0070714_100356697 | |||
| 716 | Ga0070714_100905379 | |||
| 717 | Ga0070714_101340938 | |||
| 718 | Ga0070714_101587830 | |||
| 719 | Ga0070714_102113700 | |||
| 720 | Ga0070713_100028094 | |||
| 721 | Ga0070713_100188965 | |||
| 722 | Ga0070713_100193824 | |||
| 723 | Ga0070713_100277168 | |||
| 724 | Ga0070713_100287493 | |||
| 725 | Ga0070713_100330681 | |||
| 726 | Ga0070713_100422878 | |||
| 727 | Ga0070713_100466587 | |||
| 728 | Ga0070713_100723133 | |||
| 729 | Ga0070713_100753886 | |||
| 730 | Ga0070713_100931019 | |||
| 731 | Ga0070713_101031705 | |||
| 732 | Ga0070710_10001549 | |||
| 733 | Ga0070710_10041452 | |||
| 734 | Ga0070710_10069692 | |||
| 735 | Ga0070710_10247950 | |||
| 736 | Ga0070710_10258585 | |||
| 737 | Ga0070710_10682873 | |||
| 738 | Ga0070711_100212744 | |||
| 739 | Ga0070711_100287367 | |||
| 740 | Ga0070708_100000459 | |||
| 741 | Ga0070708_100024343 | |||
| 742 | Ga0070708_100052363 | |||
| 743 | Ga0070663_100006254 | |||
| 744 | Ga0070678_100024642 | |||
| 745 | Ga0070662_100004877 | |||
| 746 | Ga0070681_10004600 | |||
| 747 | Ga0070681_10154975 | |||
| 748 | Ga0070681_10443280 | |||
| 749 | Ga0068867_100012811 | |||
| 750 | Ga0070685_10001931 | |||
| 751 | Ga0070685_10113602 | |||
| 752 | Ga0070706_100000514 | |||
| 753 | Ga0070706_100002982 | |||
| 754 | Ga0070706_100030168 | |||
| 755 | Ga0070706_100078384 | |||
| 756 | Ga0070707_100000662 | |||
| 757 | Ga0070707_100008218 | |||
| 758 | Ga0070707_100339466 | |||
| 759 | Ga0070707_100517437 | |||
| 760 | Ga0070698_100000133 | |||
| 761 | Ga0070698_100002043 | |||
| 762 | Ga0070698_100041613 | |||
| 763 | Ga0070698_100141600 | |||
| 764 | Ga0070698_101397711 | |||
| 765 | Ga0070699_100000441 | |||
| 766 | Ga0070699_100148651 | |||
| 767 | Ga0070699_100645449 | |||
| 768 | Ga0070699_101533879 | |||
| 769 | Ga0070679_100007709 | |||
| 770 | Ga0070679_100307049 | |||
| 771 | Ga0070679_100642167 | |||
| 772 | Ga0070679_100753339 | |||
| 773 | Ga0070684_100001890 | |||
| 774 | Ga0070684_100034871 | |||
| 775 | Ga0070684_100048290 | |||
| 776 | Ga0070697_100000158 | |||
| 777 | Ga0070697_100004513 | |||
| 778 | Ga0070697_100860253 | |||
| 779 | Ga0070697_101249264 | |||
| 780 | Ga0068853_100023962 | |||
| 781 | Ga0068853_100030598 | |||
| 782 | Ga0068853_100107639 | |||
| 783 | Ga0068853_100128952 | |||
| 784 | Ga0068853_100290612 | |||
| 785 | Ga0068853_100668392 | |||
| 786 | Ga0070672_100006210 | |||
| 787 | Ga0070672_100956800 | |||
| 788 | Ga0070686_100001751 | |||
| 789 | Ga0070686_100120132 | |||
| 790 | Ga0070695_100042489 | |||
| 791 | Ga0070696_100043518 | |||
| 792 | Ga0070696_100264152 | |||
| 793 | Ga0070693_100013310 | |||
| 794 | Ga0070693_100051240 | |||
| 795 | Ga0070693_100115422 | |||
| 796 | Ga0070693_100187290 | |||
| 797 | Ga0070665_100924805 | |||
| 798 | Ga0068855_100016183 | |||
| 799 | Ga0068855_100100414 | |||
| 800 | Ga0068855_100173193 | |||
| 801 | Ga0068855_100711223 | |||
| 802 | Ga0070664_100103197 | |||
| 803 | Ga0068857_100011308 | |||
| 804 | Ga0068854_100074203 | |||
| 805 | Ga0068854_100082416 | |||
| 806 | Ga0068854_100111291 | |||
| 807 | Ga0068856_100036173 | |||
| 808 | Ga0068856_100047478 | |||
| 809 | Ga0068856_100064506 | |||
| 810 | Ga0068856_100131638 | |||
| 811 | Ga0068856_100841938 | |||
| 812 | Ga0068852_100023791 | |||
| 813 | Ga0068852_100146592 | |||
| 814 | Ga0068852_100167955 | |||
| 815 | Ga0068859_100015642 | |||
| 816 | Ga0068859_100231181 | |||
| 817 | Ga0068864_100202753 | |||
| 818 | Ga0068864_100513341 | |||
| 819 | Ga0068866_10063788 | |||
| 820 | Ga0068866_10106325 | |||
| 821 | Ga0068866_10800270 | |||
| 822 | Ga0068861_100494305 | |||
| 823 | Ga0068851_10003046 | |||
| 824 | Ga0068851_10401575 | |||
| 825 | Ga0068863_100012969 | |||
| 826 | Ga0068863_100283073 | |||
| 827 | Ga0068863_100544867 | |||
| 828 | Ga0068858_100001619 | |||
| 829 | Ga0068858_100031852 | |||
| 830 | Ga0068860_100005894 | |||
| 831 | Ga0068860_100164584 | |||
| 832 | Ga0068860_100430970 | |||
| 833 | Ga0068860_101049845 | |||
| 834 | Ga0068862_100102267 | |||
| 835 | Ga0068862_100600571 | |||
| 836 | Ga0068862_100925398 | |||
| 837 | Ga0070717_10008691 | |||
| 838 | Ga0070717_10032983 | |||
| 839 | Ga0070717_10033339 | |||
| 840 | Ga0070717_10043538 | |||
| 841 | Ga0070717_10053000 | |||
| 842 | Ga0070717_10154341 | |||
| 843 | Ga0070717_10424688 | |||
| 844 | Ga0070717_10590216 | |||
| 845 | Ga0070717_10595458 | |||
| 846 | Ga0070717_11100481 | |||
| 847 | Ga0070717_11719321 | |||
| 848 | Ga0070715_10006826 | |||
| 849 | Ga0070715_10053637 | |||
| 850 | Ga0070715_10231786 | |||
| 851 | Ga0070715_10317657 | |||
| 852 | Ga0070715_10355308 | |||
| 853 | Ga0070715_10978224 | |||
| 854 | Ga0070716_100113337 | |||
| 855 | Ga0070716_100240155 | |||
| 856 | Ga0070716_101469254 | |||
| 857 | Ga0070716_101780536 | |||
| 858 | Ga0070712_100000618 | |||
| 859 | Ga0070712_100015567 | |||
| 860 | Ga0070712_100107060 | |||
| 861 | Ga0070712_100211627 | |||
| 862 | Ga0070712_100560590 | |||
| 863 | Ga0097621_100014488 | |||
| 864 | Ga0097621_100083010 | |||
| 865 | Ga0097621_100164056 | |||
| 866 | Ga0097621_100351280 | |||
| 867 | Ga0097621_100753119 | |||
| 868 | Ga0068871_100000727 | |||
| 869 | Ga0068871_100085050 | |||
| 870 | Ga0068871_100413387 | |||
| 871 | Ga0068871_100734512 | |||
| 872 | Ga0068871_101284448 | |||
| 873 | Ga0075434_100010363 | |||
| 874 | Ga0068865_100191958 | |||
| 875 | Ga0068865_100838901 | |||
| 876 | Ga0075436_100067927 | |||
| 877 | Ga0075436_100078930 | |||
| 878 | Ga0075436_100244265 | |||
| 879 | Ga0097620_100015642 | |||
| 880 | Ga0097620_100231172 | |||
| 881 | Ga0075435_100010920 | |||
| 882 | Ga0075435_100078986 | |||
| 883 | Ga0099795_10096096 | |||
| 884 | Ga0099795_10253507 | |||
| 885 | Ga0105250_10058724 | |||
| 886 | Ga0105240_10017855 | |||
| 887 | Ga0105240_10236771 | |||
| 888 | Ga0105240_10530084 | |||
| 889 | Ga0105240_10904541 | |||
| 890 | Ga0105240_11247680 | |||
| 891 | Ga0105240_12623547 | |||
| 892 | Ga0105245_10004451 | |||
| 893 | Ga0105245_10015530 | |||
| 894 | Ga0105245_10016248 | |||
| 895 | Ga0105245_10023501 | |||
| 896 | Ga0105245_10076932 | |||
| 897 | Ga0105245_10103758 | |||
| 898 | Ga0105247_10149755 | |||
| 899 | Ga0105247_10840865 | |||
| 900 | Ga0114129_10108973 | |||
| 901 | Ga0105241_10001007 | |||
| 902 | Ga0105241_10028094 | |||
| 903 | Ga0105241_10038332 | |||
| 904 | Ga0105241_10142388 | |||
| 905 | Ga0105241_10647399 | |||
| 906 | Ga0105242_10077078 | |||
| 907 | Ga0105242_10101530 | |||
| 908 | Ga0105242_10167508 | |||
| 909 | Ga0105248_10011618 | |||
| 910 | Ga0105248_10181549 | |||
| 911 | Ga0105248_10341789 | |||
| 912 | Ga0105237_10090996 | |||
| 913 | Ga0105237_10122178 | |||
| 914 | Ga0105237_10314223 | |||
| 915 | Ga0105238_10007234 | |||
| 916 | Ga0105238_10025226 | |||
| 917 | Ga0105238_10050778 | |||
| 918 | Ga0105238_10107866 | |||
| 919 | Ga0105238_11476163 | |||
| 920 | Ga0105249_10013908 | |||
| 921 | Ga0105239_10040875 | |||
| 922 | Ga0105239_10044409 | |||
| 923 | Ga0105239_10200638 | |||
| 924 | Ga0105239_10672912 | |||
| 925 | Ga0105239_11118363 | |||
| 926 | Ga0105246_10007859 | |||
| 927 | Ga0157373_10003057 | |||
| 928 | Ga0157373_10013678 | |||
| 929 | Ga0157373_10046473 | |||
| 930 | Ga0157373_10486121 | |||
| 931 | Ga0157373_10837328 | |||
| 932 | Ga0157371_10002264 | |||
| 933 | Ga0157371_10758414 | |||
| 934 | Ga0157370_10044441 | |||
| 935 | Ga0157370_10088625 | |||
| 936 | Ga0157370_10591219 | |||
| 937 | Ga0157369_10008028 | |||
| 938 | Ga0157369_10015743 | |||
| 939 | Ga0157369_10095020 | |||
| 940 | Ga0157369_10111522 | |||
| 941 | Ga0157369_10122337 | |||
| 942 | Ga0157369_10573976 | |||
| 943 | Ga0157369_10696712 | |||
| 944 | Ga0157369_12502146 | |||
| 945 | Ga0157374_10000228 | |||
| 946 | Ga0157374_10097761 | |||
| 947 | Ga0157374_10119686 | |||
| 948 | Ga0157374_10140646 | |||
| 949 | Ga0157374_10899063 | |||
| 950 | Ga0157378_10000351 | |||
| 951 | Ga0157378_10007903 | |||
| 952 | Ga0157378_10051290 | |||
| 953 | Ga0157378_10226359 | |||
| 954 | Ga0163162_10004210 | |||
| 955 | Ga0163162_10019239 | |||
| 956 | Ga0163162_10088487 | |||
| 957 | Ga0157372_10005053 | |||
| 958 | Ga0157372_10009228 | |||
| 959 | Ga0157372_10009344 | |||
| 960 | Ga0157372_10039206 | |||
| 961 | Ga0157372_10054048 | |||
| 962 | Ga0157372_10517749 | |||
| 963 | Ga0157372_10676801 | |||
| 964 | Ga0157372_11031544 | |||
| 965 | Ga0157372_12292005 | |||
| 966 | Ga0157372_12294762 | |||
| 967 | Ga0157372_12794936 | |||
| 968 | Ga0157375_10140664 | |||
| 969 | Ga0157375_10300217 | |||
| 970 | Ga0163163_10036969 | |||
| 971 | Ga0163163_10074333 | |||
| 972 | Ga0163163_10414669 | |||
| 973 | Ga0157380_10019901 | |||
| 974 | Ga0182008_10288597 | |||
| 975 | Ga0157377_10004842 | |||
| 976 | Ga0157379_10028378 | |||
| 977 | Ga0157379_10209581 | |||
| 978 | Ga0157379_11281866 | |||
| 979 | Ga0157376_10008129 | |||
| 980 | Ga0157376_10024032 | |||
| 981 | Ga0157376_10038962 | |||
| 982 | Ga0157376_10260880 | |||
| 983 | Ga0157376_10400097 | |||
| 984 | Ga0182007_10131503 | |||
| 985 | Ga0163161_10028230 | |||
| 986 | Ga0206352_10348191 | |||
| 987 | Ga0213873_10035658 | |||
| 988 | Ga0213874_10106241 | |||
| 989 | Ga0213876_10294716 | |||
| 990 | Ga0213875_10081889 | |||
| 991 | Ga0224572_1000176 | |||
| 992 | Ga0224572_1013048 | |||
| 993 | Ga0224572_1029944 | |||
| 994 | Ga0228598_1000403 | |||
| 995 | Ga0228598_1002548 | |||
| 996 | Ga0228598_1002880 | |||
| 997 | Ga0207697_10009374 | |||
| 998 | Ga0207697_10455362 | |||
| 999 | Ga0207656_10173335 | |||
| 1000 | Ga0207696_1036623 | |||
| 1001 | Ga0207682_10018935 | |||
| 1002 | Ga0207692_10003777 | |||
| 1003 | Ga0207692_10062682 | |||
| 1004 | Ga0207692_10071393 | |||
| 1005 | Ga0207692_10122162 | |||
| 1006 | Ga0207692_10219974 | |||
| 1007 | Ga0207692_10220986 | |||
| 1008 | Ga0207692_10245778 | |||
| 1009 | Ga0207692_10599349 | |||
| 1010 | Ga0207642_10100494 | |||
| 1011 | Ga0207642_10102843 | |||
| 1012 | Ga0207642_10538394 | |||
| 1013 | Ga0207710_10025991 | |||
| 1014 | Ga0207710_10140930 | |||
| 1015 | Ga0207688_10204170 | |||
| 1016 | Ga0207680_10595048 | |||
| 1017 | Ga0207647_10002741 | |||
| 1018 | Ga0207647_10044334 | |||
| 1019 | Ga0207685_10018117 | |||
| 1020 | Ga0207699_10000209 | |||
| 1021 | Ga0207699_10076393 | |||
| 1022 | Ga0207699_10122246 | |||
| 1023 | Ga0207699_10137199 | |||
| 1024 | Ga0207699_10370606 | |||
| 1025 | Ga0207699_10674507 | |||
| 1026 | Ga0207645_10001689 | |||
| 1027 | Ga0207643_10002573 | |||
| 1028 | Ga0207684_10000614 | |||
| 1029 | Ga0207684_10001907 | |||
| 1030 | Ga0207684_10024360 | |||
| 1031 | Ga0207684_10246043 | |||
| 1032 | Ga0207684_10286568 | |||
| 1033 | Ga0207654_10108898 | |||
| 1034 | Ga0207654_10209718 | |||
| 1035 | Ga0207654_10548730 | |||
| 1036 | Ga0207707_10003911 | |||
| 1037 | Ga0207707_10175985 | |||
| 1038 | Ga0207707_10888904 | |||
| 1039 | Ga0207695_10068765 | |||
| 1040 | Ga0207695_10268869 | |||
| 1041 | Ga0207671_10028761 | |||
| 1042 | Ga0207671_10070899 | |||
| 1043 | Ga0207671_10084422 | |||
| 1044 | Ga0207671_10213753 | |||
| 1045 | Ga0207693_10000026 | |||
| 1046 | Ga0207693_10022287 | |||
| 1047 | Ga0207693_10042186 | |||
| 1048 | Ga0207693_10108137 | |||
| 1049 | Ga0207693_10118098 | |||
| 1050 | Ga0207693_10192970 | |||
| 1051 | Ga0207693_10333332 | |||
| 1052 | Ga0207693_11291839 | |||
| 1053 | Ga0207693_11333860 | |||
| 1054 | Ga0207663_10193191 | |||
| 1055 | Ga0207663_10220753 | |||
| 1056 | Ga0207660_10539305 | |||
| 1057 | Ga0207660_10544856 | |||
| 1058 | Ga0207662_10012728 | |||
| 1059 | Ga0207657_10003520 | |||
| 1060 | Ga0207649_10000445 | |||
| 1061 | Ga0207646_10002238 | |||
| 1062 | Ga0207646_10044442 | |||
| 1063 | Ga0207646_10071657 | |||
| 1064 | Ga0207646_10116788 | |||
| 1065 | Ga0207646_10294226 | |||
| 1066 | Ga0207646_10372694 | |||
| 1067 | Ga0207681_10064843 | |||
| 1068 | Ga0207694_10089006 | |||
| 1069 | Ga0207694_10335154 | |||
| 1070 | Ga0207650_10000053 | |||
| 1071 | Ga0207650_10644663 | |||
| 1072 | Ga0207659_10040078 | |||
| 1073 | Ga0207687_10007071 | |||
| 1074 | Ga0207687_10057994 | |||
| 1075 | Ga0207687_10097425 | |||
| 1076 | Ga0207687_10120730 | |||
| 1077 | Ga0207700_10000306 | |||
| 1078 | Ga0207700_10016653 | |||
| 1079 | Ga0207700_10041153 | |||
| 1080 | Ga0207700_10085731 | |||
| 1081 | Ga0207700_10298695 | |||
| 1082 | Ga0207700_10765699 | |||
| 1083 | Ga0207700_10816665 | |||
| 1084 | Ga0207700_10884992 | |||
| 1085 | Ga0207700_11128287 | |||
| 1086 | Ga0207700_11372808 | |||
| 1087 | Ga0207700_11915654 | |||
| 1088 | Ga0207664_10190336 | |||
| 1089 | Ga0207664_10385894 | |||
| 1090 | Ga0207664_10458459 | |||
| 1091 | Ga0207664_10786928 | |||
| 1092 | Ga0207644_10019899 | |||
| 1093 | Ga0207706_10002255 | |||
| 1094 | Ga0207670_10015855 | |||
| 1095 | Ga0207704_10049962 | |||
| 1096 | Ga0207704_11265060 | |||
| 1097 | Ga0207665_10012284 | |||
| 1098 | Ga0207665_10027306 | |||
| 1099 | Ga0207665_10221405 | |||
| 1100 | Ga0207665_10492818 | |||
| 1101 | Ga0207665_10516230 | |||
| 1102 | Ga0207665_10836458 | |||
| 1103 | Ga0207691_10003568 | |||
| 1104 | Ga0207691_10658464 | |||
| 1105 | Ga0207711_10379737 | |||
| 1106 | Ga0207689_10000542 | |||
| 1107 | Ga0207689_10002682 | |||
| 1108 | Ga0207661_10001208 | |||
| 1109 | Ga0207661_10213512 | |||
| 1110 | Ga0207661_11208026 | |||
| 1111 | Ga0207679_10001783 | |||
| 1112 | Ga0207679_10684147 | |||
| 1113 | Ga0207667_10144355 | |||
| 1114 | Ga0207667_10216361 | |||
| 1115 | Ga0207667_10326260 | |||
| 1116 | Ga0207667_10735314 | |||
| 1117 | Ga0207651_10001496 | |||
| 1118 | Ga0207668_10139975 | |||
| 1119 | Ga0207640_10044827 | |||
| 1120 | Ga0207640_10537863 | |||
| 1121 | Ga0207658_10005363 | |||
| 1122 | Ga0207658_10335220 | |||
| 1123 | Ga0207677_10009986 | |||
| 1124 | Ga0207677_10059432 | |||
| 1125 | Ga0207677_10154437 | |||
| 1126 | Ga0207677_10156120 | |||
| 1127 | Ga0207703_10037964 | |||
| 1128 | Ga0207639_10160227 | |||
| 1129 | Ga0207639_10495742 | |||
| 1130 | Ga0207678_10000840 | |||
| 1131 | Ga0207708_10039749 | |||
| 1132 | Ga0207702_10031974 | |||
| 1133 | Ga0207702_10051111 | |||
| 1134 | Ga0207702_10212654 | |||
| 1135 | Ga0207702_10583109 | |||
| 1136 | Ga0207702_11286552 | |||
| 1137 | Ga0207641_10000104 | |||
| 1138 | Ga0207648_10002557 | |||
| 1139 | Ga0207676_10000491 | |||
| 1140 | Ga0207674_10001318 | |||
| 1141 | Ga0207674_10134851 | |||
| 1142 | Ga0207674_10871948 | |||
| 1143 | Ga0207683_10003204 | |||
| 1144 | Ga0207683_10255159 | |||
| 1145 | Ga0207698_10126136 | |||
| 1146 | Ga0207698_10465464 | |||
| 1147 | Ga0265356_1000478 | |||
| 1148 | Ga0265356_1014073 | |||
| 1149 | Ga0268266_10005115 | |||
| 1150 | Ga0268266_10636590 | |||
| 1151 | Ga0268265_10005953 | |||
| 1152 | Ga0268265_10033182 | |||
| 1153 | Ga0268264_10551024 | |||
| 1154 | Ga0265338_10000833 | |||
| 1155 | Ga0265338_10074515 | |||
| 1156 | Ga0265762_1000119 | |||
| 1157 | Ga0265762_1000777 | |||
| 1158 | Ga0265762_1006203 | |||
| 1159 | Ga0265771_1000546 | |||
| 1160 | Ga0265760_10009809 | |||
| 1161 | Ga0265760_10032909 | |||
| 1162 | Ga0265332_10069161 | |||
| 1163 | Ga0265328_10019321 | |||
| 1164 | Ga0265320_10205923 | |||
| 1165 | Ga0265325_10017529 | |||
| 1166 | Ga0265329_10164764 | |||
| 1167 | Ga0265340_10021603 | |||
| 1168 | Ga0265340_10254714 | |||
| 1169 | Ga0265339_10003136 | |||
| 1170 | Ga0265339_10020977 | |||
| 1171 | Ga0265339_10219118 | |||
| 1172 | Ga0265339_10314609 | |||
| 1173 | Ga0265327_10153153 | |||
| 1174 | Ga0265316_10014345 | |||
| 1175 | Ga0265316_10018684 | |||
| 1176 | Ga0265313_10027981 | |||
| 1177 | Ga0265314_10024132 | |||
| 1178 | Ga0265342_10387979 | |||
| 1179 | Ga0373926_0004972 | |||
| 1180 | Ga0373944_0070597 | |||
| 1181 | Ga0373923_0027165 | |||
| 1182 | Ga0373936_0365073 | |||
| 1183 | Ga0373941_0077851 | |||
| 1184 | Ga0373945_0021612 | |||
| 1185 | Ga0373953_0031745 | |||
| 1186 | Ga0373956_0126175 | |||
| 1187 | Ga0373956_0324444 | |||
| 1188 | Ga0373957_0013624 | |||
| 1189 | Ga0373957_0156654 | |||
| 1190 | Ga0373960_0080803 | |||
| 1191 | Ga0373943_0001571 | |||
| 1192 | Ga0373943_0065449 | |||
| 1193 | Ga0373946_0015286 | |||
| 1194 | Ga0373946_0083015 | |||
| 1195 | Ga0373955_0268149 | |||
| 1196 | Ga0373955_0610977 | |||
| 1197 | Ga0373924_0000245 | |||
| 1198 | Ga0373924_0548425 | |||
| 1199 | Ga0373931_0034450 | |||
| 1200 | Ga0373935_0001333 | |||
| 1201 | Ga0373935_0011396 | |||
| 1202 | Ga0373935_0475651 | |||
| 1203 | Ga0373935_1323610 | |||
| 1204 | Ga0373935_1452538 | |||
| 1205 | Ga0373927_0016685 | |||
| 1206 | Ga0373927_0049622 | |||
| 1207 | Ga0373927_0162660 | |||
| 1208 | Ga0373933_0029242 | |||
| 1209 | Ga0373947_0006708 | |||
| 1210 | Ga0373947_0124293 | |||
| 1211 | Ga0373947_0355924 | |||
| 1212 | Ga0373937_0001894 | |||
| 1213 | Ga0373937_0009542 | |||
| 1214 | Ga0373937_0071560 | |||
| 1215 | Ga0373937_0229004 | |||
| 1216 | Ga0373937_1475266 | |||
| 1217 | Ga0373925_0001997 | |||
| 1218 | Ga0373925_0375071 | |||
| 1219 | Ga0395900_0592476 | |||
| 1220 | Ga0395900_0933339 | |||
| 1221 | Ga0395900_1913195 | |||
| 1222 | Ga0395905_0770074 | |||
| 1223 | Ga0436364_0509543 | |||
| 1224 | Ga0436365_0870448 | |||
| 1225 | Ga0436365_1880233 | |||
| 1226 | Ga0436363_0090843 | |||
| 1227 | Ga0436362_0052614 | |||
| 1228 | Ga0436362_0552319 | |||
| 1229 | Ga0436362_0866066 | |||
| 1230 | Ga0451839_1005903 | |||
| 1231 | Ga0451577_0040456 | |||
| 1232 | Ga0466961_0581413 | |||
| 1233 | Ga0466961_0793281 | |||
| 1234 | Ga0453684_0000951 | |||
| 1235 | Ga0451576_0010527 | |||
| 1236 | Ga0451576_0298670 | |||
| 1237 | Ga0451576_1629738 | |||
| 1238 | Ga0466958_0167589 | |||
| 1239 | Ga0466958_0201330 | |||
| 1240 | Ga0466967_0093299 | |||
| 1241 | Ga0466967_1758143 | |||
| 1242 | Ga0495590_0115993 | |||
| 1243 | Ga0495651_0711465 | |||
| 1244 | Ga0495651_0835412 | |||
| 1245 | Ga0495653_0645844 | |||
| 1246 | Ga0495580_0034691 | |||
| 1247 | Ga0495580_0852399 | |||
| 1248 | Ga0495582_0101589 | |||
| 1249 | Ga0495582_0107652 | |||
| 1250 | Ga0495652_0039044 | |||
| 1251 | Ga0495665_0703510 | |||
| 1252 | Ga0495667_0328220 | |||
| 1253 | Ga0495635_1045262 | |||
| 1254 | Ga0495623_0001371 | |||
| 1255 | Ga0495623_0263493 | |||
| 1256 | Ga0495658_0210100 | |||
| 1257 | Ga0495624_0146024 | |||
| 1258 | Ga0495581_0174655 | |||
| 1259 | Ga0495604_0468992 | |||
| 1260 | Ga0495674_0565563 | |||
| 1261 | Ga0495680_0663361 | |||
| 1262 | Ga0495675_0023510 | |||
| 1263 | Ga0495684_0718191 | |||
| 1264 | Ga0495593_0069639 | |||
| 1265 | Ga0495614_0085676 | |||
| 1266 | Ga0495614_0488914 | |||
| 1267 | Ga0496100_0181613 | |||
| 1268 | Ga0496100_0800972 | |||
| 1269 | Ga0496101_0106541 | |||
| 1270 | Ga0496101_0170924 | |||
| 1271 | Ga0496102_0024594 | |||
| 1272 | Ga0496102_0030087 | |||
| 1273 | Ga0496102_0032116 | |||
| 1274 | Ga0496102_0082818 | |||
| 1275 | Ga0496102_0311210 | |||
| 1276 | Ga0496102_0669525 | |||
| 1277 | Ga0496103_0352701 | |||
| 1278 | Ga0496104_0114347 | |||
| 1279 | Ga0496104_0153959 | |||
| 1280 | Ga0496104_0201121 | |||
| 1281 | Ga0496104_0310870 | |||
| 1282 | Ga0496104_0429886 | |||
| 1283 | Ga0496105_0000399 | |||
| 1284 | Ga0496105_0008491 | |||
| 1285 | Ga0496105_0041633 | |||
| 1286 | Ga0496105_0763426 | |||
| 1287 | Ga0496106_0687143 | |||
| 1288 | Ga0496107_1086226 | |||
| 1289 | Ga0496108_0000629 | |||
| 1290 | Ga0496108_0685644 | |||
| 1291 | Ga0496109_0000270 | |||
| 1292 | Ga0496110_0002501 | |||
| 1293 | Ga0496110_0058340 | |||
| 1294 | Ga0496111_0029137 | |||
| 1295 | Ga0496111_0390933 | |||
| 1296 | Ga0496112_0000121 | |||
| 1297 | Ga0496112_0001780 | |||
| 1298 | Ga0496112_0002178 | |||
| 1299 | Ga0496112_0005362 | |||
| 1300 | Ga0496112_0027881 | |||
| 1301 | Ga0496112_0039232 | |||
| 1302 | Ga0496112_0190516 | |||
| 1303 | Ga0496112_0354675 | |||
| 1304 | Ga0496112_1008876 | |||
| 1305 | Ga0496113_0002775 | |||
| 1306 | Ga0496113_0114865 | |||
| 1307 | Ga0496113_0380280 | |||
| 1308 | Ga0496113_0455394 | |||
| 1309 | Ga0496114_0138203 | |||
| 1310 | Ga0496114_0902800 | |||
| 1311 | Ga0496115_0039011 | |||
| 1312 | Ga0496115_0148247 | |||
| 1313 | Ga0496115_0194256 | |||
| 1314 | Ga0496115_0325195 | |||
| 1315 | Ga0496115_0955356 | |||
| 1316 | Ga0496126_0001722 | |||
| 1317 | nmdc:mga0rr50_629872_c1 | |||
| 1318 | nmdc:mga08x19_138127_c1 | |||
| 1319 | nmdc:mga08x19_143618_c1 | |||
| 1320 | nmdc:mga08x19_558765_c1 | |||
| 1321 | nmdc:mga08x19_642667_c1 | |||
| 1322 | nmdc:mga08x19_7445_c1 | |||
| 1323 | Ga0495601_0394902 | |||
| 1324 | Ga0495619_0143241 | |||
| 1325 | Ga0587073_0012920 | |||
| 1326 | Ga0587077_061957 | |||
| 1327 | Ga0587080_054617 | |||
| 1328 | Ga0587094_109200 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mjt-assembly1.cif.gz_C | kcsa open gate e71v mutant with barium | 0.3522 | 56 | 142 |
| 2fzf-assembly1.cif.gz_B | hypothetical protein pfu-1136390-001 from pyrococcus furiosus | 0.3385 | 26 | 144 |
| 7mjt-assembly1.cif.gz_C | kcsa open gate e71v mutant with barium | 0.3176 | 56 | 142 |
| 1p3v-assembly1.cif.gz_A | crystal structures of the no-and co-bound heme oxygenase from neisseria meningitidis: implications for oxygen activation | 0.3162 | 25 | 141 |
| 8w6i-assembly1.cif.gz_A | cryo-em structure of escherichia coli str k12 ftsex complex with atp-gamma-s in peptidisc | 0.3141 | 40 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FW85_259_476_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4715 | 47 | 141 | 1.20.1250.20 |
| af_O60637_1_104_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.4348 | 58 | 143 | 1.20.120.350 |
| af_Q4V915_1_105_1.20.5.110 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.4338 | 58 | 143 | 1.20.5.110 |
| af_Q66H06_1_104_1.20.5.110 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.4263 | 58 | 143 | 1.20.5.110 |
| af_P31053_1_108_1.20.5.110 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.4246 | 58 | 143 | 1.20.5.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7N0C4-F1-model_v4 | DUF6677 domain-containing protein | 0.973 | 23 | 144 |
GO:0016020
|
| AF-A0A2W0AZQ2-F1-model_v4 | DUF6677 domain-containing protein | 0.9725 | 26 | 144 |
GO:0016020
|
| AF-A0A2W0BFX9-F1-model_v4 | DUF6677 domain-containing protein | 0.9719 | 25 | 144 |
GO:0016020
|
| AF-A0A2V9NXE6-F1-model_v4 | DUF6677 domain-containing protein | 0.9718 | 15 | 144 |
GO:0016020
|
| AF-A0A1Q7N0C4-F1-model_v4 | DUF6677 domain-containing protein | 0.9652 | 23 | 144 |
GO:0016020
|