F473601

General Info

Members Datasets Scaffolds Average Seq Length
664 373 1328 205

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100526200|Ga0070660_1005262001
Length 235
Sequence MRSISYEVAITDMASLGQQPHGLTGLGGFGRHRWPVTLRHGAVVLSPLRHRDRVAWERVRRENMNWLRPWEATLPPGAQLGPATYAGLVRSVTRQAREGRMLPWLVFYDEGTEGSRPQLAGQLTVSGIVGGSASWGQIGYWVDQRLAGRGIIPTAVALAVDYCFQVMSLHRIEIAIRPENTKSLRVVAKLGFRPEGLRPRYLHIDGDWRDHLVFALNAEEVPEGLLRRWENLRQR

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
55 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
128 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
129 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
132 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
140 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
141 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
142 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
143 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
144 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
145 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
151 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
235 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
266 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
279 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
283 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
284 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
285 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
286 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
287 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
288 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
289 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
292 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
293 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
294 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
295 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
296 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
297 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
298 2643221548 Streptomyces sp. Root55 Isolate Unclassified
299 2643221578 Streptomyces sp. Root63 Isolate Unclassified
300 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
301 2643221647 Streptomyces sp. Root369 Isolate Unclassified
302 2643221670 Streptomyces sp. Root431 Isolate Unclassified
303 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
304 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
305 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
306 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
307 2643221714 Streptomyces sp. Root264 Isolate Unclassified
308 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
309 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
310 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
311 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
312 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
313 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
314 2808606448 Streptomyces sp. 193411 Isolate Unclassified
315 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
316 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
317 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
318 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
319 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
320 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
321 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
322 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
323 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
324 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
325 2867369537 Streptomyces sp. Z26 Isolate Unclassified
326 2867428634 Streptomyces sp. RP5T Isolate Unclassified
327 2867475112 Streptomyces sp. TM32 Isolate Unclassified
328 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
329 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
330 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
331 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
332 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
333 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
334 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
335 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
336 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
337 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
338 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
339 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
340 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
341 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
342 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
343 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
344 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
345 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
346 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
347 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
348 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
349 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
350 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
351 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
352 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
353 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
354 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
355 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
356 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
357 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
358 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
359 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
360 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
361 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
362 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
363 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
364 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
365 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
366 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
367 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
368 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
369 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
370 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
371 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
372 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
373 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.35
Metatranscriptomes 0.15
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.52
Nodule 0.15
Rhizoplane 1.81
Rhizosphere 82.68
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100526200 3300005339 Bacteria 985
2 JGI24737J22298_10020196 3300001990 Bacteria 2128
3 JGI24735J21928_10023283 3300002067 Bacteria 1879
4 JGI24738J21930_10010198 3300002075 Bacteria 2097
5 JGI25406J46586_10009060 3300003203 Bacteria 4469
6 rootH1_10025198 3300003316 Bacteria 9784
7 rootH1_10092946 3300003316 Bacteria 1327
8 rootH2_10038068 3300003320 Bacteria 1098
9 rootL2_10013147 3300003322 Bacteria 6040
10 rootH1_10011797 3300003323 Bacteria 11984
11 rootH1_10011810 3300003323 Bacteria 7235
12 rootH1_10018179 3300003323 Bacteria 8119
13 JGI25160J50197_1010936 3300003354 Bacteria 3252
14 Ga0006562J51391_1052725 3300003578 Bacteria 1670
15 Ga0070683_100590997 3300005329 Bacteria 1062
16 Ga0070682_100058766 3300005337 Bacteria 2426
17 Ga0070682_100271115 3300005337 Bacteria 1233
18 Ga0070660_100356872 3300005339 Unclassified 1204
19 Ga0070668_100258147 3300005347 Bacteria 1448
20 Ga0070668_100500527 3300005347 Unclassified 1052
21 Ga0070674_100140091 3300005356 Bacteria 1814
22 Ga0070700_100081830 3300005441 Bacteria 2087
23 Ga0070662_100021514 3300005457 Bacteria 4404
24 Ga0070662_100088769 3300005457 Unclassified 2318
25 Ga0068867_100285588 3300005459 Unclassified 1355
26 Ga0068853_100267629 3300005539 Unclassified 1573
27 Ga0070693_100236657 3300005547 Bacteria 1204
28 Ga0068852_100788074 3300005616 Bacteria 964
29 Ga0068866_10005770 3300005718 Bacteria 5132
30 Ga0068861_100050104 3300005719 Bacteria 3165
31 Ga0068861_100065763 3300005719 Unclassified 2794
32 Ga0081455_10006470 3300005937 Bacteria 12557
33 Ga0081455_10061526 3300005937 Bacteria 3159
34 Ga0081538_10000880 3300005981 Bacteria 32436
35 Ga0081539_10000015 3300005985 Bacteria 395781
36 Ga0081539_10057023 3300005985 Bacteria 2164
37 Ga0075368_10006931 3300006042 Bacteria 3985
38 Ga0075363_100033785 3300006048 Bacteria 2666
39 Ga0075363_100265877 3300006048 Bacteria 990
40 Ga0075432_10000144 3300006058 Bacteria 16785
41 Ga0075432_10037305 3300006058 Unclassified 1691
42 Ga0075367_10001503 3300006178 Bacteria 10077
43 Ga0075370_10197734 3300006353 Bacteria 1185
44 Ga0075428_100045228 3300006844 Bacteria 4837
45 Ga0075428_100104043 3300006844 Bacteria 3096
46 Ga0075428_100220921 3300006844 Bacteria 2046
47 Ga0075430_100040188 3300006846 Bacteria 3960
48 Ga0075431_100025934 3300006847 Bacteria 6008
49 Ga0075433_10009760 3300006852 Bacteria 7690
50 Ga0075433_10076736 3300006852 Bacteria 2943
51 Ga0075434_100002768 3300006871 Bacteria 15519
52 Ga0075434_100024704 3300006871 Bacteria 5876
53 Ga0075429_100056310 3300006880 Bacteria 3422
54 Ga0068865_100070375 3300006881 Bacteria 2479
55 Ga0075436_100007978 3300006914 Bacteria 7250
56 Ga0075435_100011763 3300007076 Bacteria 6457
57 Ga0075435_100065823 3300007076 Bacteria 2947
58 Ga0105244_10072153 3300009036 Bacteria 1720
59 Ga0105244_10118824 3300009036 Bacteria 1281
60 Ga0111539_10051580 3300009094 Bacteria 4899
61 Ga0105245_10024802 3300009098 Bacteria 5268
62 Ga0105245_10917439 3300009098 Bacteria 918
63 Ga0105247_10193329 3300009101 Bacteria 1363
64 Ga0114129_10042711 3300009147 Bacteria 6381
65 Ga0105243_10023749 3300009148 Bacteria 4673
66 Ga0105243_10430201 3300009148 Bacteria 1233
67 Ga0105243_10703382 3300009148 Bacteria 985
68 Ga0105241_10948215 3300009174 Bacteria 802
69 Ga0105248_10128647 3300009177 Bacteria 2857
70 Ga0105237_10650153 3300009545 Bacteria 1061
71 Ga0105238_10051747 3300009551 Bacteria 4130
72 Ga0105249_10013247 3300009553 Bacteria 7277
73 Ga0105249_10035093 3300009553 Bacteria 4546
74 Ga0105249_10702650 3300009553 Bacteria 1071
75 Ga0105239_10048709 3300010375 Bacteria 4646
76 Ga0105246_10037858 3300011119 Bacteria 3239
77 Ga0105246_10125502 3300011119 Bacteria 1909
78 Ga0105246_10259897 3300011119 Bacteria 1383
79 Ga0157343_1005821 3300012488 Bacteria 813
80 Ga0157329_1002046 3300012491 Bacteria 1109
81 Ga0157371_10120544 3300013102 Bacteria 1865
82 Ga0157369_10129129 3300013105 Bacteria 2679
83 Ga0163162_10068934 3300013306 Bacteria 3589
84 Ga0163162_10218764 3300013306 Bacteria 2035
85 Ga0157372_10082687 3300013307 Bacteria 3636
86 Ga0157372_10136772 3300013307 Bacteria 2822
87 Ga0157372_10692171 3300013307 Bacteria 1186
88 Ga0157375_10692064 3300013308 Bacteria 1173
89 Ga0182008_10003143 3300014497 Bacteria 10102
90 Ga0182006_1032259 3300015261 Bacteria 2106
91 Ga0182007_10001538 3300015262 Bacteria 12301
92 Ga0182005_1018418 3300015265 Bacteria 1929
93 Ga0183367_1005 3300015688 Bacteria 652063
94 Ga0163161_10027306 3300017792 Bacteria 4049
95 Ga0213875_10008775 3300021388 Bacteria 5161
96 Ga0209758_1004057 3300025297 Bacteria 12618
97 Ga0207426_1004745 3300025302 Bacteria 6487
98 Ga0207426_1007298 3300025302 Bacteria 4646
99 Ga0207426_1015159 3300025302 Bacteria 2802
100 Ga0207426_1036070 3300025302 Bacteria 1574
101 Ga0207642_10004232 3300025899 Bacteria 4618
102 Ga0207688_10007552 3300025901 Bacteria 5916
103 Ga0207688_10087110 3300025901 Bacteria 1790
104 Ga0207647_10002532 3300025904 Bacteria 13843
105 Ga0207646_10532635 3300025922 Bacteria 1057
106 Ga0207694_10141789 3300025924 Bacteria 1933
107 Ga0207694_10248226 3300025924 Bacteria 1456
108 Ga0207687_10090501 3300025927 Unclassified 2230
109 Ga0207706_10019523 3300025933 Bacteria 6097
110 Ga0207706_10096200 3300025933 Bacteria 2604
111 Ga0207686_10126620 3300025934 Bacteria 1747
112 Ga0207709_10036120 3300025935 Bacteria 2927
113 Ga0207709_10340097 3300025935 Bacteria 1129
114 Ga0207709_10357398 3300025935 Bacteria 1105
115 Ga0207669_10224694 3300025937 Bacteria 1381
116 Ga0207704_10197958 3300025938 Unclassified 1468
117 Ga0207691_10131898 3300025940 Bacteria 2206
118 Ga0207661_10271065 3300025944 Bacteria 1515
119 Ga0207712_10065132 3300025961 Bacteria 2600
120 Ga0207668_10137374 3300025972 Bacteria 1875
121 Ga0207639_10072240 3300026041 Bacteria 2701
122 Ga0207678_10348370 3300026067 Bacteria 1277
123 Ga0207708_10051549 3300026075 Bacteria 3133
124 Ga0207675_100020063 3300026118 Bacteria 6237
125 Ga0207675_100028607 3300026118 Bacteria 5190
126 Ga0207698_10324900 3300026142 Bacteria 1443
127 Ga0207698_10887765 3300026142 Bacteria 898
128 Ga0209371_1013637 3300027312 Bacteria 2269
129 Ga0209813_10027224 3300027866 Bacteria 1658
130 Ga0207428_10001346 3300027907 Bacteria 26169
131 Ga0207428_10007657 3300027907 Bacteria 9833
132 Ga0268266_10337084 3300028379 Bacteria 1415
133 Ga0268264_10225921 3300028381 Unclassified 1726
134 Ga0307517_10030929 3300028786 Bacteria 6254
135 Ga0307517_10330340 3300028786 Bacteria 838
136 Ga0307515_10000054 3300028794 Bacteria 265489
137 Ga0307515_10111166 3300028794 Bacteria 3200
138 Ga0307515_10224756 3300028794 Bacteria 1685
139 Ga0268256_1015076 3300030500 Bacteria 2271
140 Ga0307511_10000604 3300030521 Bacteria 38490
141 Ga0307512_10135799 3300030522 Bacteria 1524
142 Ga0307513_10007543 3300031456 Bacteria 14071
143 Ga0307513_10410083 3300031456 Bacteria 1087
144 Ga0307408_100006918 3300031548 Bacteria 7507
145 Ga0307408_100055563 3300031548 Bacteria 2867
146 Ga0307408_100058772 3300031548 Bacteria 2797
147 Ga0307408_100363564 3300031548 Bacteria 1232
148 Ga0307508_10039144 3300031616 Bacteria 4260
149 Ga0307508_10169616 3300031616 Bacteria 1786
150 Ga0307514_10004003 3300031649 Bacteria 13744
151 Ga0307514_10087391 3300031649 Bacteria 2284
152 Ga0307516_10004216 3300031730 Bacteria 17907
153 Ga0307516_10266745 3300031730 Bacteria 1400
154 Ga0307405_10053812 3300031731 Bacteria 2509
155 Ga0307405_10250538 3300031731 Bacteria 1317
156 Ga0307413_10090759 3300031824 Bacteria 1988
157 Ga0307410_10000241 3300031852 Bacteria 20604
158 Ga0307410_10004074 3300031852 Bacteria 7476
159 Ga0307410_10038305 3300031852 Bacteria 3139
160 Ga0307410_10190841 3300031852 Bacteria 1558
161 Ga0307410_10234472 3300031852 Bacteria 1419
162 Ga0307406_10012922 3300031901 Bacteria 4770
163 Ga0307406_10033169 3300031901 Bacteria 3158
164 Ga0307406_10606671 3300031901 Unclassified 903
165 Ga0307407_10001333 3300031903 Bacteria 8848
166 Ga0307407_10017005 3300031903 Bacteria 3636
167 Ga0307412_10077827 3300031911 Bacteria 2282
168 Ga0307412_10352767 3300031911 Bacteria 1182
169 Ga0307409_100001129 3300031995 Bacteria 12666
170 Ga0307409_100001592 3300031995 Bacteria 11338
171 Ga0307416_100000372 3300032002 Bacteria 23322
172 Ga0307416_100041871 3300032002 Bacteria 3570
173 Ga0307416_100290313 3300032002 Bacteria 1619
174 Ga0307416_100336622 3300032002 Bacteria 1520
175 Ga0307416_100487408 3300032002 Bacteria 1294
176 Ga0307414_10042039 3300032004 Bacteria 3102
177 Ga0307414_10058651 3300032004 Bacteria 2713
178 Ga0307414_10088497 3300032004 Bacteria 2292
179 Ga0307411_10061223 3300032005 Bacteria 2505
180 Ga0307411_10184303 3300032005 Bacteria 1587
181 Ga0307411_10385057 3300032005 Bacteria 1154
182 Ga0307415_100004195 3300032126 Bacteria 7442
183 Ga0307415_100068867 3300032126 Bacteria 2478
184 Ga0307507_10107018 3300033179 Bacteria 2306
185 Ga0307510_10004987 3300033180 Bacteria 15713
186 Ga0307510_10083458 3300033180 Bacteria 3084
187 Ga0307510_10104275 3300033180 Bacteria 2609
188 Ga0307510_10221074 3300033180 Bacteria 1405
189 Ga0395899_0103978 3300037312 Bacteria 2047
190 Ga0395899_0141904 3300037312 Bacteria 1709
191 Ga0395899_0370881 3300037312 Bacteria 953
192 Ga0395900_0037833 3300037418 Bacteria 4974
193 Ga0395900_0117549 3300037418 Bacteria 2728
194 Ga0395900_0165200 3300037418 Bacteria 2256
195 Ga0395900_0241881 3300037418 Bacteria 1810
196 Ga0395900_0592254 3300037418 Bacteria 1050
197 Ga0395900_0759128 3300037418 Bacteria 900
198 Ga0395898_0002648 3300037466 Bacteria 20825
199 Ga0395898_0053092 3300037466 Bacteria 3958
200 Ga0395898_0151191 3300037466 Bacteria 2221
201 Ga0395898_0367607 3300037466 Bacteria 1371
202 Ga0395898_0431216 3300037466 Bacteria 1256
203 Ga0395898_0690688 3300037466 Bacteria 962
204 Ga0395905_0110622 3300037471 Bacteria 2580
205 Ga0395905_0305300 3300037471 Bacteria 1479
206 Ga0395905_0514700 3300037471 Bacteria 1097
207 Ga0436364_0707244 3300037853 Bacteria 16516
208 Ga0436364_0828050 3300037853 Bacteria 1171
209 Ga0395901_0002296 3300038443 Bacteria 19486
210 Ga0395901_0045434 3300038443 Bacteria 4558
211 Ga0395901_0099496 3300038443 Bacteria 3049
212 Ga0395901_0492700 3300038443 Bacteria 1248
213 Ga0439436_0000662 3300041404 Bacteria 9196
214 Ga0439436_0016230 3300041404 Bacteria 2235
215 Ga0439436_0066237 3300041404 Bacteria 1008
216 Ga0439439_0008609 3300041406 Bacteria 2413
217 Ga0451793_0899420 3300041452 Bacteria 8316
218 Ga0451797_0053817 3300041453 Bacteria 1669
219 Ga0451800_0887884 3300041459 Bacteria 806
220 Ga0451833_1083238 3300041491 Bacteria 1401
221 Ga0451837_1453291 3300041494 Bacteria 1598
222 Ga0451841_0208176 3300041498 Bacteria 1233
223 Ga0451841_0350292 3300041498 Bacteria 938
224 Ga0451843_1445243 3300041509 Bacteria 1212
225 Ga0451853_0946350 3300041512 Bacteria 2785
226 Ga0451853_1142566 3300041512 Bacteria 2149
227 Ga0451853_2362840 3300041512 Bacteria 1014
228 Ga0451853_3317335 3300041512 Bacteria 1618
229 Ga0439433_0000579 3300041999 Bacteria 6953
230 Ga0439433_0009479 3300041999 Bacteria 2122
231 Ga0439449_0000256 3300042007 Bacteria 19084
232 Ga0439449_0018433 3300042007 Bacteria 2620
233 Ga0439455_0009844 3300042012 Bacteria 2085
234 Ga0439457_000334 3300042014 Bacteria 13014
235 Ga0439462_0002603 3300042015 Bacteria 4216
236 Ga0439463_009330 3300042016 Bacteria 2414
237 Ga0439463_018260 3300042016 Bacteria 1745
238 Ga0450888_002856 3300042126 Bacteria 1725
239 Ga0450894_000172 3300042131 Bacteria 11515
240 Ga0450898_000346 3300042134 Bacteria 5294
241 Ga0450900_007454 3300042136 Bacteria 1348
242 Ga0450903_000058 3300042138 Bacteria 22483
243 Ga0450906_007009 3300042145 Bacteria 2243
244 Ga0439458_0038716 3300042157 Bacteria 1152
245 Ga0439458_0052413 3300042157 Bacteria 1008
246 Ga0450908_010718 3300042184 Bacteria 1688
247 Ga0439435_0004142 3300042436 Bacteria 3098
248 Ga0439464_0057431 3300042439 Bacteria 1135
249 Ga0439460_0011887 3300042461 Bacteria 2250
250 Ga0439440_0004821 3300042993 Bacteria 2661
251 Ga0439440_0006301 3300042993 Bacteria 2383
252 Ga0466969_0022423 3300044656 Bacteria 3259
253 Ga0466972_0001951 3300044658 Bacteria 10122
254 Ga0466972_0003093 3300044658 Bacteria 8251
255 Ga0466972_0014780 3300044658 Bacteria 3906
256 Ga0466972_0023879 3300044658 Bacteria 3038
257 Ga0466972_0067860 3300044658 Bacteria 1703
258 Ga0466965_0000076 3300044683 Bacteria 29433
259 Ga0466965_0028727 3300044683 Bacteria 2703
260 Ga0466966_0000415 3300044684 Bacteria 27468
261 Ga0466966_0015271 3300044684 Bacteria 5078
262 Ga0466966_0159535 3300044684 Bacteria 1373
263 Ga0466966_0424127 3300044684 Bacteria 799
264 Ga0466961_0001528 3300044693 Bacteria 14328
265 Ga0466961_0011254 3300044693 Bacteria 5720
266 Ga0466961_0060839 3300044693 Bacteria 2401
267 Ga0466961_0095935 3300044693 Bacteria 1870
268 Ga0466963_0000217 3300044694 Bacteria 24560
269 Ga0466963_0008890 3300044694 Bacteria 6028
270 Ga0466963_0009324 3300044694 Bacteria 5909
271 Ga0466964_0011684 3300044706 Bacteria 3320
272 Ga0466964_0107579 3300044706 Bacteria 1239
273 Ga0466964_0123609 3300044706 Bacteria 1169
274 Ga0466971_0000287 3300044719 Bacteria 19329
275 Ga0466968_0049933 3300044735 Bacteria 1783
276 Ga0466970_0000305 3300044765 Bacteria 23911
277 Ga0466970_0065318 3300044765 Bacteria 1952
278 Ga0466957_0001585 3300044842 Bacteria 11950
279 Ga0466957_0064213 3300044842 Bacteria 2258
280 Ga0466957_0141473 3300044842 Bacteria 1550
281 Ga0466960_0002130 3300044901 Bacteria 7381
282 Ga0466960_0055154 3300044901 Bacteria 1932
283 Ga0466959_0091694 3300045049 Bacteria 2181
284 Ga0466958_0001065 3300045836 Bacteria 12581
285 Ga0466958_0063054 3300045836 Bacteria 2260
286 Ga0466967_0023284 3300045976 Bacteria 5072
287 Ga0466967_0760033 3300045976 Bacteria 961
288 Ga0495617_013813 3300046452 Bacteria 2746
289 Ga0495627_007567 3300046453 Bacteria 4154
290 Ga0495627_027140 3300046453 Bacteria 1840
291 Ga0495592_0005534 3300046454 Bacteria 9344
292 Ga0495592_0066683 3300046454 Bacteria 2633
293 Ga0495603_0001471 3300046455 Bacteria 13717
294 Ga0495603_0003066 3300046455 Bacteria 9919
295 Ga0495603_0007420 3300046455 Bacteria 6594
296 Ga0495603_0023021 3300046455 Bacteria 3771
297 Ga0495590_0031651 3300046457 Bacteria 1851
298 Ga0495629_0001012 3300046459 Bacteria 22585
299 Ga0495629_0018930 3300046459 Bacteria 4923
300 Ga0495629_0036165 3300046459 Bacteria 3487
301 Ga0495629_0042355 3300046459 Bacteria 3200
302 Ga0495629_0075269 3300046459 Bacteria 2358
303 Ga0495629_0140635 3300046459 Bacteria 1679
304 Ga0495629_0169295 3300046459 Bacteria 1516
305 Ga0495638_0013543 3300046460 Bacteria 5546
306 Ga0495641_0189587 3300046461 Bacteria 921
307 Ga0495651_0006002 3300046462 Bacteria 9271
308 Ga0495651_0083615 3300046462 Bacteria 2406
309 Ga0495651_0096891 3300046462 Bacteria 2203
310 Ga0495653_0016659 3300046463 Bacteria 5980
311 Ga0495653_0132579 3300046463 Bacteria 1762
312 Ga0495582_0031814 3300046473 Bacteria 2901
313 Ga0495582_0159725 3300046473 Bacteria 1281
314 Ga0495605_0007329 3300046474 Bacteria 6264
315 Ga0495639_0028327 3300046475 Bacteria 2482
316 Ga0495639_0147893 3300046475 Bacteria 1132
317 Ga0495662_0000249 3300046476 Bacteria 22816
318 Ga0495662_0017982 3300046476 Bacteria 3420
319 Ga0495662_0034908 3300046476 Bacteria 2427
320 Ga0495662_0083514 3300046476 Bacteria 1554
321 Ga0495664_0003774 3300046477 Bacteria 8264
322 Ga0495664_0401085 3300046477 Bacteria 823
323 Ga0495585_0029573 3300046492 Bacteria 3117
324 Ga0495594_0000331 3300046499 Bacteria 23477
325 Ga0495594_0012393 3300046499 Bacteria 4441
326 Ga0495594_0034936 3300046499 Bacteria 2736
327 Ga0495594_0209454 3300046499 Bacteria 1111
328 Ga0495596_0026235 3300046500 Bacteria 2349
329 Ga0495607_0064703 3300046501 Bacteria 2064
330 Ga0495606_0004706 3300046507 Bacteria 13466
331 Ga0495608_0070349 3300046511 Bacteria 2284
332 Ga0495608_0292961 3300046511 Bacteria 1008
333 Ga0495610_0044836 3300046512 Bacteria 2192
334 Ga0495616_0006094 3300046513 Bacteria 7349
335 Ga0495618_0024661 3300046514 Bacteria 3726
336 Ga0495618_0029640 3300046514 Bacteria 3414
337 Ga0495618_0055827 3300046514 Bacteria 2500
338 Ga0495620_0017657 3300046515 Bacteria 3549
339 Ga0495620_0100196 3300046515 Bacteria 1155
340 Ga0495628_0013208 3300046516 Bacteria 6944
341 Ga0495628_0091482 3300046516 Bacteria 2354
342 Ga0495628_0139631 3300046516 Bacteria 1849
343 Ga0495631_0027085 3300046518 Bacteria 2626
344 Ga0495632_0102271 3300046519 Bacteria 1350
345 Ga0495637_0049842 3300046520 Bacteria 1757
346 Ga0495643_0007264 3300046522 Bacteria 7164
347 Ga0495648_0070691 3300046524 Bacteria 2026
348 Ga0495666_0011025 3300046526 Bacteria 4509
349 Ga0495666_0159665 3300046526 Bacteria 1046
350 Ga0495652_0040689 3300046529 Bacteria 4017
351 Ga0495652_0053285 3300046529 Bacteria 3448
352 Ga0495652_0058317 3300046529 Bacteria 3269
353 Ga0495652_0227094 3300046529 Bacteria 1399
354 Ga0495654_0019059 3300046530 Bacteria 3590
355 Ga0495665_0076080 3300046531 Bacteria 1767
356 Ga0495640_0003642 3300046533 Bacteria 12373
357 Ga0495640_0011826 3300046533 Bacteria 6695
358 Ga0495640_0029724 3300046533 Bacteria 3920
359 Ga0495640_0075235 3300046533 Bacteria 2255
360 Ga0495586_0019784 3300046535 Bacteria 3585
361 Ga0495587_0193989 3300046536 Bacteria 1149
362 Ga0495609_0002415 3300046538 Bacteria 11484
363 Ga0495645_0002808 3300046543 Bacteria 11814
364 Ga0495645_0090206 3300046543 Bacteria 2191
365 Ga0495645_0139287 3300046543 Bacteria 1694
366 Ga0495645_0316915 3300046543 Bacteria 1014
367 Ga0495622_0004231 3300046557 Bacteria 6690
368 Ga0495622_0005693 3300046557 Bacteria 5779
369 Ga0495633_0056655 3300046558 Bacteria 1841
370 Ga0495667_0112046 3300046559 Bacteria 1763
371 Ga0495667_0328727 3300046559 Bacteria 967
372 Ga0495667_0384095 3300046559 Bacteria 885
373 Ga0495668_0094596 3300046616 Bacteria 1635
374 Ga0495634_0033029 3300046642 Bacteria 3557
375 Ga0495634_0092956 3300046642 Bacteria 1956
376 Ga0495625_0011856 3300046660 Bacteria 7078
377 Ga0495625_0037896 3300046660 Bacteria 3532
378 Ga0495625_0050697 3300046660 Bacteria 2977
379 Ga0495625_0227279 3300046660 Bacteria 1220
380 Ga0495635_0009292 3300046663 Bacteria 6868
381 Ga0495635_0012774 3300046663 Bacteria 5881
382 Ga0495635_0229759 3300046663 Bacteria 1253
383 Ga0495661_0129626 3300046665 Bacteria 1383
384 Ga0495588_0001211 3300046674 Bacteria 11112
385 Ga0495588_0012003 3300046674 Bacteria 4081
386 Ga0495588_0019556 3300046674 Bacteria 3318
387 Ga0495588_0049568 3300046674 Bacteria 2159
388 Ga0495657_0020595 3300046675 Bacteria 4739
389 Ga0495657_0032742 3300046675 Bacteria 3625
390 Ga0495657_0039988 3300046675 Bacteria 3219
391 Ga0495657_0144055 3300046675 Bacteria 1483
392 Ga0495599_0077996 3300046678 Bacteria 2068
393 Ga0495599_0360715 3300046678 Bacteria 870
394 Ga0495623_0077042 3300046679 Bacteria 2068
395 Ga0495646_0000598 3300046680 Bacteria 19615
396 Ga0495646_0054286 3300046680 Bacteria 2411
397 Ga0495658_0472698 3300046683 Bacteria 801
398 Ga0495613_0005985 3300046689 Bacteria 9102
399 Ga0495613_0018582 3300046689 Bacteria 5182
400 Ga0495613_0041030 3300046689 Bacteria 3427
401 Ga0495624_0052834 3300046690 Bacteria 2566
402 Ga0495624_0080698 3300046690 Bacteria 2016
403 Ga0495624_0413757 3300046690 Bacteria 809
404 Ga0495671_0018271 3300046692 Bacteria 3722
405 Ga0495671_0054494 3300046692 Bacteria 1982
406 Ga0495649_0143820 3300046694 Bacteria 1254
407 Ga0495589_0031683 3300046794 Bacteria 2661
408 Ga0495589_0043710 3300046794 Bacteria 2229
409 Ga0495589_0060334 3300046794 Bacteria 1863
410 Ga0495600_0005883 3300046809 Bacteria 7418
411 Ga0495600_0052363 3300046809 Bacteria 2666
412 Ga0495660_0056968 3300046810 Bacteria 2109
413 Ga0495581_0012309 3300047315 Bacteria 4955
414 Ga0495581_0031496 3300047315 Bacteria 3073
415 Ga0495581_0048975 3300047315 Bacteria 2440
416 Ga0495604_0000786 3300047317 Bacteria 26747
417 Ga0495604_0002805 3300047317 Bacteria 13982
418 Ga0495604_0026706 3300047317 Bacteria 4595
419 Ga0495604_0038766 3300047317 Bacteria 3749
420 Ga0495604_0047044 3300047317 Bacteria 3361
421 Ga0495636_0000762 3300047318 Bacteria 11860
422 Ga0495636_0007572 3300047318 Bacteria 4274
423 Ga0495636_0009891 3300047318 Bacteria 3755
424 Ga0495636_0023283 3300047318 Bacteria 2507
425 Ga0495636_0063936 3300047318 Bacteria 1560
426 Ga0495636_0160986 3300047318 Bacteria 1011
427 Ga0495674_0160955 3300047319 Bacteria 1878
428 Ga0495672_0127939 3300047320 Bacteria 1340
429 Ga0495676_0020370 3300047321 Bacteria 5818
430 Ga0495676_0045158 3300047321 Bacteria 3588
431 Ga0495676_0047906 3300047321 Bacteria 3450
432 Ga0495676_0144264 3300047321 Bacteria 1702
433 Ga0495676_0235578 3300047321 Bacteria 1255
434 Ga0495676_0359198 3300047321 Bacteria 972
435 Ga0495683_0091442 3300047323 Bacteria 1474
436 Ga0495687_001705 3300047443 Bacteria 19527
437 Ga0495687_003469 3300047443 Bacteria 11394
438 Ga0495675_0001198 3300047444 Bacteria 15720
439 Ga0495675_0003404 3300047444 Bacteria 9588
440 Ga0495675_0029622 3300047444 Bacteria 3492
441 Ga0495675_0050456 3300047444 Bacteria 2645
442 Ga0495675_0069469 3300047444 Bacteria 2224
443 Ga0495675_0215788 3300047444 Bacteria 1163
444 Ga0495677_0123255 3300047445 Bacteria 989
445 Ga0495685_004949 3300047447 Bacteria 4330
446 Ga0495685_007916 3300047447 Bacteria 3518
447 Ga0495685_023010 3300047447 Bacteria 2144
448 Ga0495685_046329 3300047447 Bacteria 1479
449 Ga0495673_0048646 3300047469 Bacteria 1869
450 Ga0495681_0000252 3300047470 Bacteria 43738
451 Ga0495681_0009308 3300047470 Bacteria 6067
452 Ga0495681_0034114 3300047470 Bacteria 2539
453 Ga0495686_0021297 3300047472 Bacteria 4308
454 Ga0495686_0186218 3300047472 Bacteria 1199
455 Ga0495593_0014268 3300047673 Bacteria 4518
456 Ga0495593_0038821 3300047673 Bacteria 2570
457 Ga0495593_0188867 3300047673 Bacteria 1037
458 Ga0495602_0003179 3300048088 Bacteria 16943
459 Ga0495614_0034511 3300048089 Bacteria 2174
460 Ga0495614_0042406 3300048089 Bacteria 1950
461 Ga0495626_0022519 3300048091 Bacteria 3109
462 Ga0496102_0590238 3300048905 Bacteria 1034
463 Ga0496102_0974665 3300048905 Bacteria 769
464 Ga0496104_0716514 3300048907 Bacteria 908
465 Ga0496108_0026055 3300048911 Bacteria 4823
466 Ga0496108_0223480 3300048911 Bacteria 1636
467 Ga0496108_0579804 3300048911 Bacteria 978
468 Ga0496114_0130752 3300048917 Bacteria 2168
469 Ga0496114_0161562 3300048917 Bacteria 1948
470 Ga0495678_033695 3300049459 Bacteria 2112
471 Ga0501031_0008476 3300049568 Bacteria 6690
472 Ga0501031_0049863 3300049568 Bacteria 2728
473 Ga0501031_0090722 3300049568 Bacteria 1993
474 Ga0501031_0273999 3300049568 Bacteria 1095
475 Ga0501032_0004634 3300049569 Bacteria 10339
476 Ga0501032_0034408 3300049569 Bacteria 3469
477 Ga0501032_0081779 3300049569 Bacteria 2149
478 Ga0501032_0087920 3300049569 Bacteria 2063
479 Ga0501032_0316148 3300049569 Bacteria 1008
480 Ga0501032_0598468 3300049569 Bacteria 701
481 Ga0501033_0046826 3300049570 Bacteria 3215
482 Ga0501033_0068439 3300049570 Bacteria 2610
483 Ga0501034_0000800 3300049571 Bacteria 46777
484 Ga0501034_0100391 3300049571 Bacteria 2888
485 Ga0501034_0204477 3300049571 Bacteria 1931
486 Ga0501034_0234193 3300049571 Bacteria 1784
487 Ga0501034_0358149 3300049571 Bacteria 1386
488 Ga0501036_0000776 3300049572 Bacteria 23673
489 Ga0501036_0003096 3300049572 Bacteria 13270
490 Ga0501036_0022663 3300049572 Bacteria 5285
491 Ga0501036_0034612 3300049572 Bacteria 4273
492 Ga0501036_0090745 3300049572 Bacteria 2581
493 Ga0501036_0129253 3300049572 Bacteria 2133
494 Ga0501036_0180130 3300049572 Bacteria 1779
495 Ga0501037_0053239 3300049573 Bacteria 2960
496 Ga0501037_0062532 3300049573 Bacteria 2714
497 Ga0501037_0112620 3300049573 Bacteria 1959
498 Ga0501037_0276814 3300049573 Bacteria 1170
499 Ga0501037_0417264 3300049573 Bacteria 919
500 Ga0501038_0000447 3300049574 Bacteria 35997
501 Ga0501038_0049355 3300049574 Bacteria 3639
502 Ga0501038_0104101 3300049574 Bacteria 2359
503 Ga0501038_0121327 3300049574 Bacteria 2155
504 Ga0501038_0135365 3300049574 Bacteria 2019
505 Ga0501039_0059790 3300049575 Bacteria 2951
506 Ga0501039_0234391 3300049575 Bacteria 1443
507 Ga0501039_0243027 3300049575 Bacteria 1415
508 Ga0501043_0008342 3300049579 Bacteria 8155
509 Ga0501043_0008487 3300049579 Bacteria 8088
510 Ga0501043_0046707 3300049579 Bacteria 3405
511 Ga0501043_0089814 3300049579 Bacteria 2415
512 Ga0501043_0585509 3300049579 Bacteria 826
513 Ga0501046_0082660 3300049580 Bacteria 2480
514 Ga0501046_0088835 3300049580 Bacteria 2379
515 Ga0501046_0156923 3300049580 Bacteria 1713
516 Ga0501046_0243009 3300049580 Bacteria 1327
517 Ga0501047_0001694 3300049581 Bacteria 21435
518 Ga0501047_0030780 3300049581 Bacteria 5173
519 Ga0501047_0035566 3300049581 Bacteria 4812
520 Ga0501047_0044674 3300049581 Bacteria 4282
521 Ga0501047_0064671 3300049581 Bacteria 3528
522 Ga0501047_0136069 3300049581 Bacteria 2337
523 Ga0501047_0254056 3300049581 Bacteria 1606
524 Ga0501047_0609797 3300049581 Bacteria 912
525 Ga0501047_0818885 3300049581 Bacteria 745
526 Ga0501048_0012258 3300049582 Bacteria 6380
527 Ga0501048_0219608 3300049582 Bacteria 1348
528 Ga0501048_0413743 3300049582 Bacteria 964
529 Ga0501070_0000263 3300049586 Bacteria 49655
530 Ga0501070_0021885 3300049586 Bacteria 5356
531 Ga0501070_0135823 3300049586 Bacteria 2031
532 Ga0501070_0155135 3300049586 Bacteria 1888
533 Ga0501070_0451110 3300049586 Bacteria 1037
534 Ga0501074_0011956 3300049590 Bacteria 6310
535 Ga0501243_025058 3300049675 Bacteria 999
536 Ga0501261_024478 3300049690 Bacteria 884
537 Ga0501079_0512855 3300049741 Bacteria 943
538 Ga0501080_0352153 3300049742 Bacteria 1329
539 Ga0501035_0014232 3300049822 Bacteria 7342
540 Ga0501035_0020177 3300049822 Bacteria 6121
541 Ga0501035_0025044 3300049822 Bacteria 5470
542 Ga0501035_0064392 3300049822 Bacteria 3258
543 Ga0501035_0087626 3300049822 Bacteria 2743
544 Ga0501035_0110451 3300049822 Bacteria 2409
545 Ga0501035_0174593 3300049822 Bacteria 1854
546 Ga0501035_0334264 3300049822 Bacteria 1270
547 Ga0501044_0000401 3300049823 Bacteria 53413
548 Ga0501044_0004318 3300049823 Bacteria 15933
549 Ga0501044_0019266 3300049823 Bacteria 7302
550 Ga0501044_0029377 3300049823 Bacteria 5797
551 Ga0501044_0088280 3300049823 Bacteria 3130
552 Ga0501044_0496219 3300049823 Bacteria 1122
553 Ga0501045_0137424 3300049824 Bacteria 1817
554 Ga0501045_0290344 3300049824 Bacteria 1217
555 nmdc:mga03n38_229904_c1 3300050490 Bacteria 972
556 nmdc:mga03n38_265001_c1 3300050490 Bacteria 912
557 nmdc:mga06z11_5467_c1 3300050494 Bacteria 5100
558 nmdc:mga04h51_37565_c1 3300050495 Bacteria 1564
559 nmdc:mga07m45_222953_c1 3300050496 Bacteria 1097
560 Ga0495601_0221066 3300053077 Bacteria 1237
561 Ga0495612_0024405 3300053078 Bacteria 2427
562 Ga0500610_0080338 3300053079 Bacteria 1699
563 Ga0495655_0004674 3300053083 Bacteria 2363
564 Ga0495595_0040184 3300053084 Bacteria 2137
565 Ga0495619_0192619 3300053085 Bacteria 1411
566 Ga0500578_0109983 3300053086 Bacteria 1738
567 Ga0500644_0067653 3300053088 Bacteria 1278
568 Ga0500583_0032724 3300053092 Bacteria 2296
569 Ga0500640_003321 3300053095 Bacteria 5588
570 Ga0500553_059677 3300053101 Bacteria 1796
571 Ga0500573_0022054 3300053140 Bacteria 3654
572 Ga0500573_0081976 3300053140 Bacteria 1832
573 Ga0500600_0075364 3300053149 Bacteria 1839
574 Ga0500600_0184313 3300053149 Bacteria 1001
575 Ga0500600_0236471 3300053149 Bacteria 830
576 Ga0500624_002317 3300053157 Bacteria 2604
577 Ga0500636_0117826 3300053177 Bacteria 1493
578 Ga0466962_0001173 3300061719 Bacteria 12065
579 Ga0466962_0025824 3300061719 Bacteria 2819
580 Ga0466962_0113031 3300061719 Bacteria 1308
581 Ga0466962_0130665 3300061719 Bacteria 1213
582 2554258011 2554235005 Bacteria 6457341
583 2585300107 2582581312 Bacteria 7308206
584 2585308631 2582581313 Bacteria 10042643
585 2585318737 2582581314 Bacteria 11452267
586 2616695282 2616644814 Bacteria 11555299
587 2616903957 2616644941 Bacteria 8510691
588 2643765714 2643221548 Bacteria 8053412
589 2643898493 2643221578 Bacteria 9213798
590 2643948276 2643221587 Bacteria 7586415
591 2644264117 2643221647 Bacteria 10741251
592 2644388756 2643221670 Bacteria 6497041
593 2644406409 2643221673 Bacteria 9196637
594 2644429749 2643221677 Bacteria 7584031
595 2644437005 2643221678 Bacteria 9540101
596 2644459826 2643221682 Bacteria 6743283
597 2644628750 2643221714 Bacteria 9015452
598 2768644655 2767802112 Bacteria 6465194
599 2785343499 2784746763 Bacteria 9783172
600 2785369300 2784746768 Bacteria 10036182
601 2786670438 2786546132 Bacteria 10419719
602 2793979624 2791355406 Bacteria 11364898
603 2808841903 2808606359 Bacteria 9866990
604 2809232062 2808606448 Bacteria 8656184
605 2811848822 2808606982 Bacteria 7791042
606 2812358353 2811994879 Bacteria 9313447
607 2819697949 2818991463 Bacteria 7948711
608 2852636850 2852635781 Bacteria 8251373
609 2862179548 2862178590 Bacteria 8583590
610 2862285505 2862281513 Bacteria 9621493
611 2862290735 2862290372 Bacteria 7471434
612 2862388668 2862382967 Bacteria 10317375
613 2862515244 2862507626 Bacteria 9425308
614 2863404850 2863404153 Bacteria 9672205
615 2867371753 2867369537 Bacteria 6501581
616 2867430155 2867428634 Bacteria 9590268
617 2867478483 2867475112 Bacteria 6909112
618 2875394423 2875391855 Bacteria 7600475
619 2912720197 2912715099 Bacteria 9460473
620 2912724468 2912723979 Bacteria 8557534
621 2912760594 2912757875 Bacteria 7940295
622 2918504384 2918501144 Bacteria 8668083
623 2919054479 2919051321 Bacteria 4210889
624 2919469654 2919468124 Bacteria 9133025
625 2935392552 2935390628 Bacteria 7043367
626 2946050182 2946045630 Bacteria 8527308
627 2946067524 2946064051 Bacteria 8957905
628 2946075773 2946072368 Bacteria 8999607
629 2947229479 2947224130 Bacteria 9938529
630 2954007640 2954002825 Bacteria 9173742
631 2954386396 2954380949 Bacteria 10050426
632 2954676783 2954673503 Bacteria 9685905
633 2954687383 2954682443 Bacteria 9862841
634 2954697066 2954691527 Bacteria 10720516
635 2954705067 2954701450 Bacteria 10834262
636 2954716379 2954711539 Bacteria 10867210
637 2954726324 2954721474 Bacteria 10456478
638 2954735486 2954731030 Bacteria 10243860
639 2954745248 2954740390 Bacteria 10229294
640 2954754341 2954749733 Bacteria 10366972
641 2954764223 2954759201 Bacteria 9358192
642 2966602695 2966598605 Bacteria 7676064
643 2990062071 2990059506 Bacteria 9321252
644 2995465284 2995463766 Bacteria 8577691
645 2995466642 2995463766 Bacteria 8577691
646 2997455915 2997451912 Bacteria 8492419
647 2997600961 2997600082 Bacteria 9896405
648 3006327032 3006321560 Bacteria 8247479
649 3006428569 3006425503 Bacteria 6491253
650 3006493482 3006486233 Bacteria 8157040
651 3006496206 3006493962 Bacteria 8825450
652 8025481078 8025478263 Bacteria 8209203
653 8025536539 8025530807 Bacteria 8495698
654 8033685177 8033684223 Bacteria 6906479
655 8047896697 8047893842 Bacteria 11723082
656 8048134612 8048127548 Bacteria 11053136
657 8048362225 8048356638 Bacteria 11044339
658 8048373710 8048369669 Bacteria 11666822
659 8048384518 8048379754 Bacteria 11877923
660 8048410201 8048406513 Bacteria 8936924
661 8054162438 8054160619 Bacteria 7783213
662 8056447612 8056447290 Bacteria 7680491
663 8056671891 8056667051 Bacteria 6953971
664 8056833746 8056829672 Bacteria 9045328
665 Ga0070660_100526200
666 JGI24737J22298_10020196
667 JGI24735J21928_10023283
668 JGI24738J21930_10010198
669 JGI25406J46586_10009060
670 rootH1_10025198
671 rootH1_10092946
672 rootH2_10038068
673 rootL2_10013147
674 rootH1_10011797
675 rootH1_10011810
676 rootH1_10018179
677 JGI25160J50197_1010936
678 Ga0006562J51391_1052725
679 Ga0070683_100590997
680 Ga0070682_100058766
681 Ga0070682_100271115
682 Ga0070660_100356872
683 Ga0070668_100258147
684 Ga0070668_100500527
685 Ga0070674_100140091
686 Ga0070700_100081830
687 Ga0070662_100021514
688 Ga0070662_100088769
689 Ga0068867_100285588
690 Ga0068853_100267629
691 Ga0070693_100236657
692 Ga0068852_100788074
693 Ga0068866_10005770
694 Ga0068861_100050104
695 Ga0068861_100065763
696 Ga0081455_10006470
697 Ga0081455_10061526
698 Ga0081538_10000880
699 Ga0081539_10000015
700 Ga0081539_10057023
701 Ga0075368_10006931
702 Ga0075363_100033785
703 Ga0075363_100265877
704 Ga0075432_10000144
705 Ga0075432_10037305
706 Ga0075367_10001503
707 Ga0075370_10197734
708 Ga0075428_100045228
709 Ga0075428_100104043
710 Ga0075428_100220921
711 Ga0075430_100040188
712 Ga0075431_100025934
713 Ga0075433_10009760
714 Ga0075433_10076736
715 Ga0075434_100002768
716 Ga0075434_100024704
717 Ga0075429_100056310
718 Ga0068865_100070375
719 Ga0075436_100007978
720 Ga0075435_100011763
721 Ga0075435_100065823
722 Ga0105244_10072153
723 Ga0105244_10118824
724 Ga0111539_10051580
725 Ga0105245_10024802
726 Ga0105245_10917439
727 Ga0105247_10193329
728 Ga0114129_10042711
729 Ga0105243_10023749
730 Ga0105243_10430201
731 Ga0105243_10703382
732 Ga0105241_10948215
733 Ga0105248_10128647
734 Ga0105237_10650153
735 Ga0105238_10051747
736 Ga0105249_10013247
737 Ga0105249_10035093
738 Ga0105249_10702650
739 Ga0105239_10048709
740 Ga0105246_10037858
741 Ga0105246_10125502
742 Ga0105246_10259897
743 Ga0157343_1005821
744 Ga0157329_1002046
745 Ga0157371_10120544
746 Ga0157369_10129129
747 Ga0163162_10068934
748 Ga0163162_10218764
749 Ga0157372_10082687
750 Ga0157372_10136772
751 Ga0157372_10692171
752 Ga0157375_10692064
753 Ga0182008_10003143
754 Ga0182006_1032259
755 Ga0182007_10001538
756 Ga0182005_1018418
757 Ga0183367_1005
758 Ga0163161_10027306
759 Ga0213875_10008775
760 Ga0209758_1004057
761 Ga0207426_1004745
762 Ga0207426_1007298
763 Ga0207426_1015159
764 Ga0207426_1036070
765 Ga0207642_10004232
766 Ga0207688_10007552
767 Ga0207688_10087110
768 Ga0207647_10002532
769 Ga0207646_10532635
770 Ga0207694_10141789
771 Ga0207694_10248226
772 Ga0207687_10090501
773 Ga0207706_10019523
774 Ga0207706_10096200
775 Ga0207686_10126620
776 Ga0207709_10036120
777 Ga0207709_10340097
778 Ga0207709_10357398
779 Ga0207669_10224694
780 Ga0207704_10197958
781 Ga0207691_10131898
782 Ga0207661_10271065
783 Ga0207712_10065132
784 Ga0207668_10137374
785 Ga0207639_10072240
786 Ga0207678_10348370
787 Ga0207708_10051549
788 Ga0207675_100020063
789 Ga0207675_100028607
790 Ga0207698_10324900
791 Ga0207698_10887765
792 Ga0209371_1013637
793 Ga0209813_10027224
794 Ga0207428_10001346
795 Ga0207428_10007657
796 Ga0268266_10337084
797 Ga0268264_10225921
798 Ga0307517_10030929
799 Ga0307517_10330340
800 Ga0307515_10000054
801 Ga0307515_10111166
802 Ga0307515_10224756
803 Ga0268256_1015076
804 Ga0307511_10000604
805 Ga0307512_10135799
806 Ga0307513_10007543
807 Ga0307513_10410083
808 Ga0307408_100006918
809 Ga0307408_100055563
810 Ga0307408_100058772
811 Ga0307408_100363564
812 Ga0307508_10039144
813 Ga0307508_10169616
814 Ga0307514_10004003
815 Ga0307514_10087391
816 Ga0307516_10004216
817 Ga0307516_10266745
818 Ga0307405_10053812
819 Ga0307405_10250538
820 Ga0307413_10090759
821 Ga0307410_10000241
822 Ga0307410_10004074
823 Ga0307410_10038305
824 Ga0307410_10190841
825 Ga0307410_10234472
826 Ga0307406_10012922
827 Ga0307406_10033169
828 Ga0307406_10606671
829 Ga0307407_10001333
830 Ga0307407_10017005
831 Ga0307412_10077827
832 Ga0307412_10352767
833 Ga0307409_100001129
834 Ga0307409_100001592
835 Ga0307416_100000372
836 Ga0307416_100041871
837 Ga0307416_100290313
838 Ga0307416_100336622
839 Ga0307416_100487408
840 Ga0307414_10042039
841 Ga0307414_10058651
842 Ga0307414_10088497
843 Ga0307411_10061223
844 Ga0307411_10184303
845 Ga0307411_10385057
846 Ga0307415_100004195
847 Ga0307415_100068867
848 Ga0307507_10107018
849 Ga0307510_10004987
850 Ga0307510_10083458
851 Ga0307510_10104275
852 Ga0307510_10221074
853 Ga0395899_0103978
854 Ga0395899_0141904
855 Ga0395899_0370881
856 Ga0395900_0037833
857 Ga0395900_0117549
858 Ga0395900_0165200
859 Ga0395900_0241881
860 Ga0395900_0592254
861 Ga0395900_0759128
862 Ga0395898_0002648
863 Ga0395898_0053092
864 Ga0395898_0151191
865 Ga0395898_0367607
866 Ga0395898_0431216
867 Ga0395898_0690688
868 Ga0395905_0110622
869 Ga0395905_0305300
870 Ga0395905_0514700
871 Ga0436364_0707244
872 Ga0436364_0828050
873 Ga0395901_0002296
874 Ga0395901_0045434
875 Ga0395901_0099496
876 Ga0395901_0492700
877 Ga0439436_0000662
878 Ga0439436_0016230
879 Ga0439436_0066237
880 Ga0439439_0008609
881 Ga0451793_0899420
882 Ga0451797_0053817
883 Ga0451800_0887884
884 Ga0451833_1083238
885 Ga0451837_1453291
886 Ga0451841_0208176
887 Ga0451841_0350292
888 Ga0451843_1445243
889 Ga0451853_0946350
890 Ga0451853_1142566
891 Ga0451853_2362840
892 Ga0451853_3317335
893 Ga0439433_0000579
894 Ga0439433_0009479
895 Ga0439449_0000256
896 Ga0439449_0018433
897 Ga0439455_0009844
898 Ga0439457_000334
899 Ga0439462_0002603
900 Ga0439463_009330
901 Ga0439463_018260
902 Ga0450888_002856
903 Ga0450894_000172
904 Ga0450898_000346
905 Ga0450900_007454
906 Ga0450903_000058
907 Ga0450906_007009
908 Ga0439458_0038716
909 Ga0439458_0052413
910 Ga0450908_010718
911 Ga0439435_0004142
912 Ga0439464_0057431
913 Ga0439460_0011887
914 Ga0439440_0004821
915 Ga0439440_0006301
916 Ga0466969_0022423
917 Ga0466972_0001951
918 Ga0466972_0003093
919 Ga0466972_0014780
920 Ga0466972_0023879
921 Ga0466972_0067860
922 Ga0466965_0000076
923 Ga0466965_0028727
924 Ga0466966_0000415
925 Ga0466966_0015271
926 Ga0466966_0159535
927 Ga0466966_0424127
928 Ga0466961_0001528
929 Ga0466961_0011254
930 Ga0466961_0060839
931 Ga0466961_0095935
932 Ga0466963_0000217
933 Ga0466963_0008890
934 Ga0466963_0009324
935 Ga0466964_0011684
936 Ga0466964_0107579
937 Ga0466964_0123609
938 Ga0466971_0000287
939 Ga0466968_0049933
940 Ga0466970_0000305
941 Ga0466970_0065318
942 Ga0466957_0001585
943 Ga0466957_0064213
944 Ga0466957_0141473
945 Ga0466960_0002130
946 Ga0466960_0055154
947 Ga0466959_0091694
948 Ga0466958_0001065
949 Ga0466958_0063054
950 Ga0466967_0023284
951 Ga0466967_0760033
952 Ga0495617_013813
953 Ga0495627_007567
954 Ga0495627_027140
955 Ga0495592_0005534
956 Ga0495592_0066683
957 Ga0495603_0001471
958 Ga0495603_0003066
959 Ga0495603_0007420
960 Ga0495603_0023021
961 Ga0495590_0031651
962 Ga0495629_0001012
963 Ga0495629_0018930
964 Ga0495629_0036165
965 Ga0495629_0042355
966 Ga0495629_0075269
967 Ga0495629_0140635
968 Ga0495629_0169295
969 Ga0495638_0013543
970 Ga0495641_0189587
971 Ga0495651_0006002
972 Ga0495651_0083615
973 Ga0495651_0096891
974 Ga0495653_0016659
975 Ga0495653_0132579
976 Ga0495582_0031814
977 Ga0495582_0159725
978 Ga0495605_0007329
979 Ga0495639_0028327
980 Ga0495639_0147893
981 Ga0495662_0000249
982 Ga0495662_0017982
983 Ga0495662_0034908
984 Ga0495662_0083514
985 Ga0495664_0003774
986 Ga0495664_0401085
987 Ga0495585_0029573
988 Ga0495594_0000331
989 Ga0495594_0012393
990 Ga0495594_0034936
991 Ga0495594_0209454
992 Ga0495596_0026235
993 Ga0495607_0064703
994 Ga0495606_0004706
995 Ga0495608_0070349
996 Ga0495608_0292961
997 Ga0495610_0044836
998 Ga0495616_0006094
999 Ga0495618_0024661
1000 Ga0495618_0029640
1001 Ga0495618_0055827
1002 Ga0495620_0017657
1003 Ga0495620_0100196
1004 Ga0495628_0013208
1005 Ga0495628_0091482
1006 Ga0495628_0139631
1007 Ga0495631_0027085
1008 Ga0495632_0102271
1009 Ga0495637_0049842
1010 Ga0495643_0007264
1011 Ga0495648_0070691
1012 Ga0495666_0011025
1013 Ga0495666_0159665
1014 Ga0495652_0040689
1015 Ga0495652_0053285
1016 Ga0495652_0058317
1017 Ga0495652_0227094
1018 Ga0495654_0019059
1019 Ga0495665_0076080
1020 Ga0495640_0003642
1021 Ga0495640_0011826
1022 Ga0495640_0029724
1023 Ga0495640_0075235
1024 Ga0495586_0019784
1025 Ga0495587_0193989
1026 Ga0495609_0002415
1027 Ga0495645_0002808
1028 Ga0495645_0090206
1029 Ga0495645_0139287
1030 Ga0495645_0316915
1031 Ga0495622_0004231
1032 Ga0495622_0005693
1033 Ga0495633_0056655
1034 Ga0495667_0112046
1035 Ga0495667_0328727
1036 Ga0495667_0384095
1037 Ga0495668_0094596
1038 Ga0495634_0033029
1039 Ga0495634_0092956
1040 Ga0495625_0011856
1041 Ga0495625_0037896
1042 Ga0495625_0050697
1043 Ga0495625_0227279
1044 Ga0495635_0009292
1045 Ga0495635_0012774
1046 Ga0495635_0229759
1047 Ga0495661_0129626
1048 Ga0495588_0001211
1049 Ga0495588_0012003
1050 Ga0495588_0019556
1051 Ga0495588_0049568
1052 Ga0495657_0020595
1053 Ga0495657_0032742
1054 Ga0495657_0039988
1055 Ga0495657_0144055
1056 Ga0495599_0077996
1057 Ga0495599_0360715
1058 Ga0495623_0077042
1059 Ga0495646_0000598
1060 Ga0495646_0054286
1061 Ga0495658_0472698
1062 Ga0495613_0005985
1063 Ga0495613_0018582
1064 Ga0495613_0041030
1065 Ga0495624_0052834
1066 Ga0495624_0080698
1067 Ga0495624_0413757
1068 Ga0495671_0018271
1069 Ga0495671_0054494
1070 Ga0495649_0143820
1071 Ga0495589_0031683
1072 Ga0495589_0043710
1073 Ga0495589_0060334
1074 Ga0495600_0005883
1075 Ga0495600_0052363
1076 Ga0495660_0056968
1077 Ga0495581_0012309
1078 Ga0495581_0031496
1079 Ga0495581_0048975
1080 Ga0495604_0000786
1081 Ga0495604_0002805
1082 Ga0495604_0026706
1083 Ga0495604_0038766
1084 Ga0495604_0047044
1085 Ga0495636_0000762
1086 Ga0495636_0007572
1087 Ga0495636_0009891
1088 Ga0495636_0023283
1089 Ga0495636_0063936
1090 Ga0495636_0160986
1091 Ga0495674_0160955
1092 Ga0495672_0127939
1093 Ga0495676_0020370
1094 Ga0495676_0045158
1095 Ga0495676_0047906
1096 Ga0495676_0144264
1097 Ga0495676_0235578
1098 Ga0495676_0359198
1099 Ga0495683_0091442
1100 Ga0495687_001705
1101 Ga0495687_003469
1102 Ga0495675_0001198
1103 Ga0495675_0003404
1104 Ga0495675_0029622
1105 Ga0495675_0050456
1106 Ga0495675_0069469
1107 Ga0495675_0215788
1108 Ga0495677_0123255
1109 Ga0495685_004949
1110 Ga0495685_007916
1111 Ga0495685_023010
1112 Ga0495685_046329
1113 Ga0495673_0048646
1114 Ga0495681_0000252
1115 Ga0495681_0009308
1116 Ga0495681_0034114
1117 Ga0495686_0021297
1118 Ga0495686_0186218
1119 Ga0495593_0014268
1120 Ga0495593_0038821
1121 Ga0495593_0188867
1122 Ga0495602_0003179
1123 Ga0495614_0034511
1124 Ga0495614_0042406
1125 Ga0495626_0022519
1126 Ga0496102_0590238
1127 Ga0496102_0974665
1128 Ga0496104_0716514
1129 Ga0496108_0026055
1130 Ga0496108_0223480
1131 Ga0496108_0579804
1132 Ga0496114_0130752
1133 Ga0496114_0161562
1134 Ga0495678_033695
1135 Ga0501031_0008476
1136 Ga0501031_0049863
1137 Ga0501031_0090722
1138 Ga0501031_0273999
1139 Ga0501032_0004634
1140 Ga0501032_0034408
1141 Ga0501032_0081779
1142 Ga0501032_0087920
1143 Ga0501032_0316148
1144 Ga0501032_0598468
1145 Ga0501033_0046826
1146 Ga0501033_0068439
1147 Ga0501034_0000800
1148 Ga0501034_0100391
1149 Ga0501034_0204477
1150 Ga0501034_0234193
1151 Ga0501034_0358149
1152 Ga0501036_0000776
1153 Ga0501036_0003096
1154 Ga0501036_0022663
1155 Ga0501036_0034612
1156 Ga0501036_0090745
1157 Ga0501036_0129253
1158 Ga0501036_0180130
1159 Ga0501037_0053239
1160 Ga0501037_0062532
1161 Ga0501037_0112620
1162 Ga0501037_0276814
1163 Ga0501037_0417264
1164 Ga0501038_0000447
1165 Ga0501038_0049355
1166 Ga0501038_0104101
1167 Ga0501038_0121327
1168 Ga0501038_0135365
1169 Ga0501039_0059790
1170 Ga0501039_0234391
1171 Ga0501039_0243027
1172 Ga0501043_0008342
1173 Ga0501043_0008487
1174 Ga0501043_0046707
1175 Ga0501043_0089814
1176 Ga0501043_0585509
1177 Ga0501046_0082660
1178 Ga0501046_0088835
1179 Ga0501046_0156923
1180 Ga0501046_0243009
1181 Ga0501047_0001694
1182 Ga0501047_0030780
1183 Ga0501047_0035566
1184 Ga0501047_0044674
1185 Ga0501047_0064671
1186 Ga0501047_0136069
1187 Ga0501047_0254056
1188 Ga0501047_0609797
1189 Ga0501047_0818885
1190 Ga0501048_0012258
1191 Ga0501048_0219608
1192 Ga0501048_0413743
1193 Ga0501070_0000263
1194 Ga0501070_0021885
1195 Ga0501070_0135823
1196 Ga0501070_0155135
1197 Ga0501070_0451110
1198 Ga0501074_0011956
1199 Ga0501243_025058
1200 Ga0501261_024478
1201 Ga0501079_0512855
1202 Ga0501080_0352153
1203 Ga0501035_0014232
1204 Ga0501035_0020177
1205 Ga0501035_0025044
1206 Ga0501035_0064392
1207 Ga0501035_0087626
1208 Ga0501035_0110451
1209 Ga0501035_0174593
1210 Ga0501035_0334264
1211 Ga0501044_0000401
1212 Ga0501044_0004318
1213 Ga0501044_0019266
1214 Ga0501044_0029377
1215 Ga0501044_0088280
1216 Ga0501044_0496219
1217 Ga0501045_0137424
1218 Ga0501045_0290344
1219 nmdc:mga03n38_229904_c1
1220 nmdc:mga03n38_265001_c1
1221 nmdc:mga06z11_5467_c1
1222 nmdc:mga04h51_37565_c1
1223 nmdc:mga07m45_222953_c1
1224 Ga0495601_0221066
1225 Ga0495612_0024405
1226 Ga0500610_0080338
1227 Ga0495655_0004674
1228 Ga0495595_0040184
1229 Ga0495619_0192619
1230 Ga0500578_0109983
1231 Ga0500644_0067653
1232 Ga0500583_0032724
1233 Ga0500640_003321
1234 Ga0500553_059677
1235 Ga0500573_0022054
1236 Ga0500573_0081976
1237 Ga0500600_0075364
1238 Ga0500600_0184313
1239 Ga0500600_0236471
1240 Ga0500624_002317
1241 Ga0500636_0117826
1242 Ga0466962_0001173
1243 Ga0466962_0025824
1244 Ga0466962_0113031
1245 Ga0466962_0130665
1246 2554258011
1247 2585300107
1248 2585308631
1249 2585318737
1250 2616695282
1251 2616903957
1252 2643765714
1253 2643898493
1254 2643948276
1255 2644264117
1256 2644388756
1257 2644406409
1258 2644429749
1259 2644437005
1260 2644459826
1261 2644628750
1262 2768644655
1263 2785343499
1264 2785369300
1265 2786670438
1266 2793979624
1267 2808841903
1268 2809232062
1269 2811848822
1270 2812358353
1271 2819697949
1272 2852636850
1273 2862179548
1274 2862285505
1275 2862290735
1276 2862388668
1277 2862515244
1278 2863404850
1279 2867371753
1280 2867430155
1281 2867478483
1282 2875394423
1283 2912720197
1284 2912724468
1285 2912760594
1286 2918504384
1287 2919054479
1288 2919469654
1289 2935392552
1290 2946050182
1291 2946067524
1292 2946075773
1293 2947229479
1294 2954007640
1295 2954386396
1296 2954676783
1297 2954687383
1298 2954697066
1299 2954705067
1300 2954716379
1301 2954726324
1302 2954735486
1303 2954745248
1304 2954754341
1305 2954764223
1306 2966602695
1307 2990062071
1308 2995465284
1309 2995466642
1310 2997455915
1311 2997600961
1312 3006327032
1313 3006428569
1314 3006493482
1315 3006496206
1316 8025481078
1317 8025536539
1318 8033685177
1319 8047896697
1320 8048134612
1321 8048362225
1322 8048373710
1323 8048384518
1324 8048410201
1325 8054162438
1326 8056447612
1327 8056671891
1328 8056833746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

66

192

0.81

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

42

193

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c37-assembly1.cif.gz_A mycobacterium smegmatis rimj in complex with coa-disulfide 0.9271 7 194
1s7k-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form 2 (apo) 0.9246 4 178
3r96-assembly1.cif.gz_A crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp 0.898 4 178
1nsl-assembly1.cif.gz_B crystal structure of probable acetyltransferase 0.8967 4 181
1z9u-assembly1.cif.gz_A structural genomics, the crystal structure of the acetyl transferase, modifies n-terminal serine of 50s ribosomal subunit protein l7/l12 from salmonella typhimurium 0.8942 4 178
ID Description Score Start End Superfamily
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9137 3 182 3.40.630.30
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9087 3 182 3.40.630.30
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9038 4 178 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9035 111 180 3.40.630.30
1nslB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.897 4 181 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4S2TD88-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9902 2 198 GO:0005737
GO:0008999
AF-A0A852ZJS7-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9776 56 194 GO:0005737
GO:0008999
AF-A0A552WLU7-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9738 8 194 GO:0005737
GO:0008999
AF-A0A7X7JAQ7-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9725 2 199 GO:0005737
GO:0008999
AF-A0A6L6AAW3-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9724 97 181 GO:0005737
GO:0008999

Map