F473506
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 662 | 313 | 1324 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300048904|Ga0496101_0032245|Ga0496101_0032245_1688_2725 |
| Length | 345 |
| Sequence | MSDVGSTESPRSEGTGFAGAGAGISRTGARVLDDVELYTLIYRQMLLIRGFEELVQSLFLKGEVYGTTHLYSGQEAVATGVASLLEERDRVAATYRGHGHALALGVDPQALLDEMLGRETGVNGGRAGSMNVTSPADRLIGSFGIVGGSIAAATGAALALSRTTGGVAVAYFGDGAMNQGYVFECLNFAQVQKLPLVLVCENNGYGEYTPFRSVTAGEIRSRAEVMEVPAETVDGMSVWTVREAAARAIDHARAGDGPAFVEALTYRYFGHSRSDPGAYRPEGELDEWKTRDPIVVLRAQLEEEGTGASTLDELERDVSDELERMRERGLAAPFPSTLDVGEFKD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 196 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 197 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 198 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 199 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 200 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 201 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 202 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 203 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 313 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.91 |
| Nodule | 0 |
| Rhizoplane | 8.31 |
| Rhizosphere | 90.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496101_0032245 | 3300048904 | Bacteria | 3686 |
| 2 | Ga0070658_10181782 | 3300005327 | Bacteria | 1769 |
| 3 | Ga0070676_10022878 | 3300005328 | Bacteria | 3508 |
| 4 | Ga0070683_100052919 | 3300005329 | Bacteria | 3762 |
| 5 | Ga0070683_100074926 | 3300005329 | Bacteria | 3161 |
| 6 | Ga0070683_100092440 | 3300005329 | Bacteria | 2842 |
| 7 | Ga0070683_100107201 | 3300005329 | Bacteria | 2634 |
| 8 | Ga0070683_100410263 | 3300005329 | Unclassified | 1292 |
| 9 | Ga0070670_100025282 | 3300005331 | Bacteria | 5109 |
| 10 | Ga0070670_100063240 | 3300005331 | Bacteria | 3176 |
| 11 | Ga0068869_100189681 | 3300005334 | Bacteria | 1616 |
| 12 | Ga0070682_100013359 | 3300005337 | Bacteria | 4722 |
| 13 | Ga0068868_100057126 | 3300005338 | Bacteria | 3083 |
| 14 | Ga0070660_100006183 | 3300005339 | Bacteria | 8284 |
| 15 | Ga0070660_100083443 | 3300005339 | Bacteria | 2510 |
| 16 | Ga0070660_100142995 | 3300005339 | Bacteria | 1920 |
| 17 | Ga0070691_10120273 | 3300005341 | Bacteria | 1322 |
| 18 | Ga0070661_100053041 | 3300005344 | Bacteria | 2967 |
| 19 | Ga0070692_10019780 | 3300005345 | Bacteria | 3255 |
| 20 | Ga0070668_100072282 | 3300005347 | Bacteria | 2688 |
| 21 | Ga0070669_100011579 | 3300005353 | Bacteria | 6258 |
| 22 | Ga0070675_100070588 | 3300005354 | Bacteria | 2895 |
| 23 | Ga0070671_100285656 | 3300005355 | Unclassified | 1404 |
| 24 | Ga0070674_100153850 | 3300005356 | Bacteria | 1738 |
| 25 | Ga0070673_100256706 | 3300005364 | Bacteria | 1525 |
| 26 | Ga0070659_100000071 | 3300005366 | Bacteria | 79797 |
| 27 | Ga0070659_100103273 | 3300005366 | Bacteria | 2296 |
| 28 | Ga0070667_100000521 | 3300005367 | Bacteria | 38631 |
| 29 | Ga0070667_100018523 | 3300005367 | Bacteria | 5776 |
| 30 | Ga0070709_10120623 | 3300005434 | Bacteria | 1777 |
| 31 | Ga0070714_100000342 | 3300005435 | Bacteria | 35053 |
| 32 | Ga0070714_100089007 | 3300005435 | Bacteria | 2702 |
| 33 | Ga0070714_100388094 | 3300005435 | Bacteria | 1317 |
| 34 | Ga0070713_100069530 | 3300005436 | Bacteria | 2969 |
| 35 | Ga0070713_100448072 | 3300005436 | Bacteria | 1212 |
| 36 | Ga0070710_10070269 | 3300005437 | Bacteria | 2016 |
| 37 | Ga0070710_10200643 | 3300005437 | Bacteria | 1259 |
| 38 | Ga0070711_100021417 | 3300005439 | Bacteria | 4180 |
| 39 | Ga0070711_100392332 | 3300005439 | Unclassified | 1125 |
| 40 | Ga0070700_100193601 | 3300005441 | Bacteria | 1423 |
| 41 | Ga0070708_100033219 | 3300005445 | Bacteria | 4483 |
| 42 | Ga0070708_100080435 | 3300005445 | Bacteria | 2949 |
| 43 | Ga0070663_100011213 | 3300005455 | Bacteria | 5615 |
| 44 | Ga0070678_100015365 | 3300005456 | Bacteria | 4864 |
| 45 | Ga0070678_100015655 | 3300005456 | Bacteria | 4827 |
| 46 | Ga0070662_100032079 | 3300005457 | Bacteria | 3691 |
| 47 | Ga0070662_100129924 | 3300005457 | Bacteria | 1941 |
| 48 | Ga0070681_10096947 | 3300005458 | Bacteria | 2896 |
| 49 | Ga0070681_10231390 | 3300005458 | Bacteria | 1763 |
| 50 | Ga0070685_10022590 | 3300005466 | Bacteria | 3431 |
| 51 | Ga0070685_10141079 | 3300005466 | Bacteria | 1517 |
| 52 | Ga0070706_100000823 | 3300005467 | Bacteria | 34270 |
| 53 | Ga0070706_100057572 | 3300005467 | Bacteria | 3587 |
| 54 | Ga0070707_100002811 | 3300005468 | Bacteria | 16548 |
| 55 | Ga0070698_100000805 | 3300005471 | Bacteria | 34234 |
| 56 | Ga0070698_100044298 | 3300005471 | Bacteria | 4558 |
| 57 | Ga0070698_100120026 | 3300005471 | Unclassified | 2590 |
| 58 | Ga0070679_100099050 | 3300005530 | Bacteria | 2902 |
| 59 | Ga0070679_100102811 | 3300005530 | Bacteria | 2843 |
| 60 | Ga0070679_100175502 | 3300005530 | Bacteria | 2115 |
| 61 | Ga0070684_100032864 | 3300005535 | Bacteria | 4427 |
| 62 | Ga0070684_100035945 | 3300005535 | Bacteria | 4243 |
| 63 | Ga0070684_100121212 | 3300005535 | Bacteria | 2353 |
| 64 | Ga0070684_100240393 | 3300005535 | Bacteria | 1654 |
| 65 | Ga0070684_100252936 | 3300005535 | Bacteria | 1611 |
| 66 | Ga0070684_100352787 | 3300005535 | Bacteria | 1353 |
| 67 | Ga0070697_100379840 | 3300005536 | Bacteria | 1224 |
| 68 | Ga0068853_100061002 | 3300005539 | Bacteria | 3261 |
| 69 | Ga0068853_100307895 | 3300005539 | Bacteria | 1466 |
| 70 | Ga0070672_100059327 | 3300005543 | Bacteria | 3010 |
| 71 | Ga0070672_100174845 | 3300005543 | Bacteria | 1787 |
| 72 | Ga0070696_100044154 | 3300005546 | Bacteria | 3086 |
| 73 | Ga0070696_100072476 | 3300005546 | Bacteria | 2426 |
| 74 | Ga0070693_100077116 | 3300005547 | Bacteria | 1977 |
| 75 | Ga0070665_100004920 | 3300005548 | Bacteria | 13860 |
| 76 | Ga0070665_100335740 | 3300005548 | Bacteria | 1516 |
| 77 | Ga0070704_100071693 | 3300005549 | Unclassified | 2518 |
| 78 | Ga0070704_100084762 | 3300005549 | Bacteria | 2343 |
| 79 | Ga0070704_100224083 | 3300005549 | Bacteria | 1530 |
| 80 | Ga0068855_100023638 | 3300005563 | Bacteria | 7360 |
| 81 | Ga0068855_100110665 | 3300005563 | Bacteria | 3153 |
| 82 | Ga0068855_100137556 | 3300005563 | Bacteria | 2786 |
| 83 | Ga0068855_100209444 | 3300005563 | Bacteria | 2191 |
| 84 | Ga0068855_100283822 | 3300005563 | Bacteria | 1837 |
| 85 | Ga0070664_100206715 | 3300005564 | Bacteria | 1753 |
| 86 | Ga0068857_100150700 | 3300005577 | Bacteria | 2107 |
| 87 | Ga0068857_100151545 | 3300005577 | Bacteria | 2101 |
| 88 | Ga0068856_100006059 | 3300005614 | Bacteria | 11883 |
| 89 | Ga0068856_100114058 | 3300005614 | Bacteria | 2701 |
| 90 | Ga0070702_100097959 | 3300005615 | Unclassified | 1793 |
| 91 | Ga0068852_100071670 | 3300005616 | Bacteria | 3043 |
| 92 | Ga0068852_100156419 | 3300005616 | Bacteria | 2124 |
| 93 | Ga0068864_100273198 | 3300005618 | Unclassified | 1575 |
| 94 | Ga0068866_10100059 | 3300005718 | Bacteria | 1598 |
| 95 | Ga0068861_100292494 | 3300005719 | Bacteria | 1407 |
| 96 | Ga0068870_10022120 | 3300005840 | Bacteria | 3121 |
| 97 | Ga0068870_10028295 | 3300005840 | Bacteria | 2813 |
| 98 | Ga0068863_100531790 | 3300005841 | Bacteria | 1160 |
| 99 | Ga0068858_100435189 | 3300005842 | Bacteria | 1263 |
| 100 | Ga0068860_100393501 | 3300005843 | Bacteria | 1370 |
| 101 | Ga0068862_100000772 | 3300005844 | Bacteria | 31885 |
| 102 | Ga0081455_10101779 | 3300005937 | Bacteria | 2305 |
| 103 | Ga0081455_10127874 | 3300005937 | Bacteria | 1991 |
| 104 | Ga0081455_10251523 | 3300005937 | Bacteria | 1292 |
| 105 | Ga0081538_10026632 | 3300005981 | Bacteria | 4037 |
| 106 | Ga0081540_1004204 | 3300005983 | Bacteria | 11064 |
| 107 | Ga0081540_1019924 | 3300005983 | Bacteria | 4054 |
| 108 | Ga0070717_10002940 | 3300006028 | Bacteria | 12103 |
| 109 | Ga0070717_10016455 | 3300006028 | Bacteria | 5734 |
| 110 | Ga0075365_10100543 | 3300006038 | Bacteria | 1979 |
| 111 | Ga0075364_10039922 | 3300006051 | Bacteria | 3043 |
| 112 | Ga0075432_10001987 | 3300006058 | Bacteria | 6795 |
| 113 | Ga0070715_10085318 | 3300006163 | Bacteria | 1442 |
| 114 | Ga0070712_100199675 | 3300006175 | Bacteria | 1570 |
| 115 | Ga0097621_100028225 | 3300006237 | Bacteria | 4422 |
| 116 | Ga0075370_10032801 | 3300006353 | Bacteria | 2905 |
| 117 | Ga0068871_100363214 | 3300006358 | Bacteria | 1283 |
| 118 | Ga0075428_100000211 | 3300006844 | Bacteria | 56062 |
| 119 | Ga0075428_100101291 | 3300006844 | Bacteria | 3140 |
| 120 | Ga0075433_10012759 | 3300006852 | Bacteria | 6803 |
| 121 | Ga0075433_10169894 | 3300006852 | Bacteria | 1940 |
| 122 | Ga0075434_100043521 | 3300006871 | Bacteria | 4454 |
| 123 | Ga0075434_100071241 | 3300006871 | Bacteria | 3467 |
| 124 | Ga0075429_100005341 | 3300006880 | Bacteria | 11052 |
| 125 | Ga0068865_100015100 | 3300006881 | Bacteria | 4920 |
| 126 | Ga0068865_100312832 | 3300006881 | Bacteria | 1261 |
| 127 | Ga0075436_100006476 | 3300006914 | Bacteria | 8021 |
| 128 | Ga0075435_100155573 | 3300007076 | Bacteria | 1923 |
| 129 | Ga0105240_10160060 | 3300009093 | Bacteria | 2675 |
| 130 | Ga0105240_10586883 | 3300009093 | Bacteria | 1229 |
| 131 | Ga0111539_10003281 | 3300009094 | Bacteria | 21391 |
| 132 | Ga0111539_10103504 | 3300009094 | Bacteria | 3341 |
| 133 | Ga0111539_10169415 | 3300009094 | Bacteria | 2552 |
| 134 | Ga0111539_10195746 | 3300009094 | Bacteria | 2358 |
| 135 | Ga0111539_10701644 | 3300009094 | Bacteria | 1178 |
| 136 | Ga0105245_10001672 | 3300009098 | Bacteria | 20188 |
| 137 | Ga0105245_10023674 | 3300009098 | Bacteria | 5391 |
| 138 | Ga0105245_10208538 | 3300009098 | Bacteria | 1880 |
| 139 | Ga0105247_10124185 | 3300009101 | Bacteria | 1676 |
| 140 | Ga0114129_10002058 | 3300009147 | Bacteria | 27627 |
| 141 | Ga0114129_10011553 | 3300009147 | Bacteria | 12574 |
| 142 | Ga0114129_10227574 | 3300009147 | Bacteria | 2512 |
| 143 | Ga0114129_10260844 | 3300009147 | Bacteria | 2323 |
| 144 | Ga0114129_10448329 | 3300009147 | Bacteria | 1693 |
| 145 | Ga0105243_10119698 | 3300009148 | Bacteria | 2218 |
| 146 | Ga0105243_10277364 | 3300009148 | Bacteria | 1508 |
| 147 | Ga0105242_10018143 | 3300009176 | Bacteria | 5497 |
| 148 | Ga0105242_10101880 | 3300009176 | Unclassified | 2434 |
| 149 | Ga0105242_10176057 | 3300009176 | Unclassified | 1884 |
| 150 | Ga0105242_10227184 | 3300009176 | Bacteria | 1671 |
| 151 | Ga0105248_10304657 | 3300009177 | Bacteria | 1794 |
| 152 | Ga0105237_10101507 | 3300009545 | Bacteria | 2869 |
| 153 | Ga0105237_10415324 | 3300009545 | Bacteria | 1351 |
| 154 | Ga0105238_10010169 | 3300009551 | Bacteria | 9437 |
| 155 | Ga0105238_10046758 | 3300009551 | Bacteria | 4365 |
| 156 | Ga0105238_10275082 | 3300009551 | Bacteria | 1664 |
| 157 | Ga0105249_10010169 | 3300009553 | Bacteria | 8262 |
| 158 | Ga0105249_10156441 | 3300009553 | Bacteria | 2199 |
| 159 | Ga0105239_10054676 | 3300010375 | Bacteria | 4379 |
| 160 | Ga0105239_10228885 | 3300010375 | Bacteria | 2086 |
| 161 | Ga0105239_10584398 | 3300010375 | Bacteria | 1273 |
| 162 | Ga0105246_10015910 | 3300011119 | Bacteria | 4757 |
| 163 | Ga0105246_10042671 | 3300011119 | Bacteria | 3072 |
| 164 | Ga0105246_10073261 | 3300011119 | Bacteria | 2417 |
| 165 | Ga0157370_10026174 | 3300013104 | Bacteria | 5762 |
| 166 | Ga0157370_10033161 | 3300013104 | Bacteria | 5035 |
| 167 | Ga0157370_10054870 | 3300013104 | Bacteria | 3798 |
| 168 | Ga0157369_10022942 | 3300013105 | Bacteria | 6960 |
| 169 | Ga0157369_10221769 | 3300013105 | Bacteria | 1979 |
| 170 | Ga0157374_10076623 | 3300013296 | Bacteria | 3162 |
| 171 | Ga0157378_10346514 | 3300013297 | Bacteria | 1450 |
| 172 | Ga0163162_10606949 | 3300013306 | Bacteria | 1220 |
| 173 | Ga0157372_10072238 | 3300013307 | Bacteria | 3888 |
| 174 | Ga0157372_10119470 | 3300013307 | Bacteria | 3026 |
| 175 | Ga0157372_10358312 | 3300013307 | Bacteria | 1699 |
| 176 | Ga0157372_10488001 | 3300013307 | Bacteria | 1436 |
| 177 | Ga0157375_10059076 | 3300013308 | Bacteria | 3797 |
| 178 | Ga0157375_10344250 | 3300013308 | Bacteria | 1656 |
| 179 | Ga0157375_10594092 | 3300013308 | Bacteria | 1267 |
| 180 | Ga0163163_10039202 | 3300014325 | Bacteria | 4622 |
| 181 | Ga0182008_10015027 | 3300014497 | Bacteria | 4047 |
| 182 | Ga0182008_10087434 | 3300014497 | Bacteria | 1535 |
| 183 | Ga0182008_10189682 | 3300014497 | Bacteria | 1043 |
| 184 | Ga0157377_10006166 | 3300014745 | Bacteria | 5697 |
| 185 | Ga0157379_10254688 | 3300014968 | Bacteria | 1594 |
| 186 | Ga0157376_10523823 | 3300014969 | Unclassified | 1169 |
| 187 | Ga0163161_10168797 | 3300017792 | Bacteria | 1672 |
| 188 | Ga0206356_10221095 | 3300020070 | Unclassified | 2062 |
| 189 | Ga0206356_10397882 | 3300020070 | Bacteria | 1720 |
| 190 | Ga0206353_10556283 | 3300020082 | Bacteria | 4449 |
| 191 | Ga0206353_10581081 | 3300020082 | Bacteria | 2175 |
| 192 | Ga0207692_10009347 | 3300025898 | Bacteria | 4090 |
| 193 | Ga0207642_10042592 | 3300025899 | Unclassified | 1997 |
| 194 | Ga0207688_10009635 | 3300025901 | Bacteria | 5260 |
| 195 | Ga0207685_10006858 | 3300025905 | Bacteria | 3134 |
| 196 | Ga0207643_10003002 | 3300025908 | Bacteria | 9098 |
| 197 | Ga0207643_10029234 | 3300025908 | Bacteria | 3065 |
| 198 | Ga0207643_10080409 | 3300025908 | Bacteria | 1888 |
| 199 | Ga0207705_10016247 | 3300025909 | Bacteria | 5337 |
| 200 | Ga0207684_10000008 | 3300025910 | Bacteria | 601602 |
| 201 | Ga0207684_10071765 | 3300025910 | Bacteria | 2941 |
| 202 | Ga0207707_10143212 | 3300025912 | Bacteria | 2089 |
| 203 | Ga0207707_10173526 | 3300025912 | Bacteria | 1884 |
| 204 | Ga0207671_10022752 | 3300025914 | Bacteria | 4736 |
| 205 | Ga0207693_10000919 | 3300025915 | Bacteria | 26430 |
| 206 | Ga0207663_10116131 | 3300025916 | Bacteria | 1824 |
| 207 | Ga0207663_10313550 | 3300025916 | Unclassified | 1176 |
| 208 | Ga0207660_10017196 | 3300025917 | Bacteria | 4799 |
| 209 | Ga0207660_10032251 | 3300025917 | Bacteria | 3615 |
| 210 | Ga0207657_10005718 | 3300025919 | Bacteria | 12973 |
| 211 | Ga0207657_10008090 | 3300025919 | Bacteria | 10721 |
| 212 | Ga0207657_10044056 | 3300025919 | Bacteria | 3925 |
| 213 | Ga0207657_10054299 | 3300025919 | Bacteria | 3465 |
| 214 | Ga0207649_10006826 | 3300025920 | Bacteria | 6203 |
| 215 | Ga0207652_10202468 | 3300025921 | Bacteria | 1787 |
| 216 | Ga0207652_10279687 | 3300025921 | Bacteria | 1505 |
| 217 | Ga0207646_10000763 | 3300025922 | Bacteria | 41723 |
| 218 | Ga0207681_10008373 | 3300025923 | Bacteria | 6324 |
| 219 | Ga0207694_10140519 | 3300025924 | Bacteria | 1942 |
| 220 | Ga0207650_10016445 | 3300025925 | Bacteria | 5171 |
| 221 | Ga0207650_10088839 | 3300025925 | Bacteria | 2357 |
| 222 | Ga0207659_10052897 | 3300025926 | Bacteria | 2895 |
| 223 | Ga0207659_10237639 | 3300025926 | Unclassified | 1472 |
| 224 | Ga0207687_10019191 | 3300025927 | Bacteria | 4527 |
| 225 | Ga0207687_10066899 | 3300025927 | Bacteria | 2555 |
| 226 | Ga0207687_10125728 | 3300025927 | Bacteria | 1925 |
| 227 | Ga0207687_10276304 | 3300025927 | Bacteria | 1345 |
| 228 | Ga0207700_10092550 | 3300025928 | Bacteria | 2390 |
| 229 | Ga0207700_10278790 | 3300025928 | Bacteria | 1437 |
| 230 | Ga0207700_10305522 | 3300025928 | Bacteria | 1375 |
| 231 | Ga0207664_10000617 | 3300025929 | Bacteria | 24668 |
| 232 | Ga0207664_10014782 | 3300025929 | Bacteria | 5650 |
| 233 | Ga0207664_10038374 | 3300025929 | Bacteria | 3714 |
| 234 | Ga0207664_10085867 | 3300025929 | Bacteria | 2569 |
| 235 | Ga0207690_10000188 | 3300025932 | Bacteria | 47744 |
| 236 | Ga0207690_10021370 | 3300025932 | Bacteria | 4013 |
| 237 | Ga0207690_10048138 | 3300025932 | Bacteria | 2833 |
| 238 | Ga0207706_10018226 | 3300025933 | Bacteria | 6316 |
| 239 | Ga0207706_10061523 | 3300025933 | Bacteria | 3306 |
| 240 | Ga0207686_10110530 | 3300025934 | Bacteria | 1853 |
| 241 | Ga0207709_10192918 | 3300025935 | Bacteria | 1448 |
| 242 | Ga0207709_10240395 | 3300025935 | Bacteria | 1317 |
| 243 | Ga0207669_10018564 | 3300025937 | Bacteria | 3599 |
| 244 | Ga0207669_10044410 | 3300025937 | Bacteria | 2610 |
| 245 | Ga0207669_10298135 | 3300025937 | Bacteria | 1224 |
| 246 | Ga0207704_10043766 | 3300025938 | Bacteria | 2647 |
| 247 | Ga0207704_10145281 | 3300025938 | Bacteria | 1665 |
| 248 | Ga0207704_10151300 | 3300025938 | Unclassified | 1638 |
| 249 | Ga0207665_10000603 | 3300025939 | Bacteria | 24124 |
| 250 | Ga0207691_10039180 | 3300025940 | Bacteria | 4384 |
| 251 | Ga0207691_10266120 | 3300025940 | Bacteria | 1477 |
| 252 | Ga0207689_10054974 | 3300025942 | Bacteria | 3277 |
| 253 | Ga0207661_10000463 | 3300025944 | Bacteria | 26200 |
| 254 | Ga0207661_10124436 | 3300025944 | Unclassified | 2200 |
| 255 | Ga0207661_10206626 | 3300025944 | Unclassified | 1729 |
| 256 | Ga0207661_10247820 | 3300025944 | Bacteria | 1582 |
| 257 | Ga0207667_10113428 | 3300025949 | Bacteria | 2794 |
| 258 | Ga0207667_10172599 | 3300025949 | Bacteria | 2222 |
| 259 | Ga0207667_10217722 | 3300025949 | Bacteria | 1956 |
| 260 | Ga0207712_10002284 | 3300025961 | Bacteria | 12449 |
| 261 | Ga0207668_10126321 | 3300025972 | Bacteria | 1945 |
| 262 | Ga0207640_10202294 | 3300025981 | Bacteria | 1506 |
| 263 | Ga0207640_10278195 | 3300025981 | Bacteria | 1313 |
| 264 | Ga0207658_10002483 | 3300025986 | Bacteria | 13439 |
| 265 | Ga0207658_10004120 | 3300025986 | Bacteria | 10138 |
| 266 | Ga0207677_10126729 | 3300026023 | Bacteria | 1931 |
| 267 | Ga0207677_10247999 | 3300026023 | Bacteria | 1444 |
| 268 | Ga0207677_10268469 | 3300026023 | Bacteria | 1394 |
| 269 | Ga0207703_10016991 | 3300026035 | Bacteria | 5674 |
| 270 | Ga0207639_10157039 | 3300026041 | Bacteria | 1912 |
| 271 | Ga0207639_10270405 | 3300026041 | Bacteria | 1490 |
| 272 | Ga0207678_10008989 | 3300026067 | Bacteria | 8792 |
| 273 | Ga0207708_10021885 | 3300026075 | Bacteria | 4824 |
| 274 | Ga0207708_10052203 | 3300026075 | Bacteria | 3114 |
| 275 | Ga0207702_10028487 | 3300026078 | Bacteria | 4643 |
| 276 | Ga0207702_10154015 | 3300026078 | Bacteria | 2094 |
| 277 | Ga0207702_10320031 | 3300026078 | Bacteria | 1477 |
| 278 | Ga0207648_10043497 | 3300026089 | Bacteria | 3942 |
| 279 | Ga0207674_10028849 | 3300026116 | Bacteria | 5850 |
| 280 | Ga0207674_10324096 | 3300026116 | Bacteria | 1490 |
| 281 | Ga0207675_100001496 | 3300026118 | Bacteria | 23416 |
| 282 | Ga0207683_10002515 | 3300026121 | Bacteria | 16003 |
| 283 | Ga0207683_10060153 | 3300026121 | Bacteria | 3339 |
| 284 | Ga0207683_10293028 | 3300026121 | Bacteria | 1488 |
| 285 | Ga0209813_10063924 | 3300027866 | Bacteria | 1181 |
| 286 | Ga0207428_10000315 | 3300027907 | Bacteria | 63531 |
| 287 | Ga0207428_10070484 | 3300027907 | Bacteria | 2747 |
| 288 | Ga0268266_10047771 | 3300028379 | Bacteria | 3668 |
| 289 | Ga0268265_10000736 | 3300028380 | Bacteria | 31918 |
| 290 | Ga0268264_10132049 | 3300028381 | Bacteria | 2215 |
| 291 | Ga0265319_1009539 | 3300028563 | Bacteria | 4126 |
| 292 | Ga0265322_10028651 | 3300028654 | Bacteria | 1591 |
| 293 | Ga0265338_10015737 | 3300028800 | Bacteria | 8285 |
| 294 | Ga0265338_10042393 | 3300028800 | Bacteria | 4239 |
| 295 | Ga0265339_10007410 | 3300031249 | Bacteria | 7094 |
| 296 | Ga0265316_10020436 | 3300031344 | Bacteria | 5634 |
| 297 | Ga0265313_10026781 | 3300031595 | Bacteria | 3030 |
| 298 | Ga0265314_10006777 | 3300031711 | Bacteria | 10049 |
| 299 | Ga0265342_10031976 | 3300031712 | Bacteria | 3248 |
| 300 | Ga0307407_10148648 | 3300031903 | Bacteria | 1520 |
| 301 | Ga0307409_100309189 | 3300031995 | Bacteria | 1474 |
| 302 | Ga0307416_100420378 | 3300032002 | Bacteria | 1381 |
| 303 | Ga0307415_100046294 | 3300032126 | Bacteria | 2921 |
| 304 | Ga0307415_100175914 | 3300032126 | Bacteria | 1674 |
| 305 | Ga0373934_0042171 | 3300035086 | Bacteria | 1802 |
| 306 | Ga0373944_0012216 | 3300035089 | Bacteria | 2364 |
| 307 | Ga0373923_0053976 | 3300035111 | Bacteria | 1691 |
| 308 | Ga0373932_0039895 | 3300035112 | Bacteria | 1349 |
| 309 | Ga0373936_0015399 | 3300035113 | Unclassified | 2931 |
| 310 | Ga0373939_0048414 | 3300035114 | Bacteria | 1310 |
| 311 | Ga0373956_0017042 | 3300035119 | Bacteria | 3058 |
| 312 | Ga0373943_0001514 | 3300035170 | Bacteria | 10514 |
| 313 | Ga0373946_0000684 | 3300035171 | Bacteria | 11397 |
| 314 | Ga0373955_0142115 | 3300035172 | Bacteria | 1408 |
| 315 | Ga0373942_0007075 | 3300035207 | Bacteria | 2595 |
| 316 | Ga0373961_0047784 | 3300035241 | Bacteria | 1259 |
| 317 | Ga0373931_0027133 | 3300035691 | Bacteria | 2920 |
| 318 | Ga0373935_0035974 | 3300035692 | Bacteria | 3093 |
| 319 | Ga0373927_0006434 | 3300035695 | Bacteria | 8004 |
| 320 | Ga0373947_0001551 | 3300035725 | Bacteria | 14082 |
| 321 | Ga0373947_0049242 | 3300035725 | Bacteria | 2529 |
| 322 | Ga0373937_0001462 | 3300036401 | Bacteria | 19776 |
| 323 | Ga0373937_0013260 | 3300036401 | Bacteria | 7259 |
| 324 | Ga0373937_0143624 | 3300036401 | Bacteria | 2233 |
| 325 | Ga0373925_0016109 | 3300037068 | Bacteria | 5413 |
| 326 | Ga0373925_0050590 | 3300037068 | Unclassified | 3099 |
| 327 | Ga0395899_0023938 | 3300037312 | Bacteria | 4620 |
| 328 | Ga0395899_0140247 | 3300037312 | Bacteria | 1720 |
| 329 | Ga0395900_0052762 | 3300037418 | Bacteria | 4185 |
| 330 | Ga0395900_0151455 | 3300037418 | Unclassified | 2369 |
| 331 | Ga0395900_0345941 | 3300037418 | Bacteria | 1461 |
| 332 | Ga0395900_0421275 | 3300037418 | Bacteria | 1296 |
| 333 | Ga0395898_0027962 | 3300037466 | Bacteria | 5655 |
| 334 | Ga0395898_0056257 | 3300037466 | Bacteria | 3835 |
| 335 | Ga0395898_0087418 | 3300037466 | Bacteria | 3002 |
| 336 | Ga0395898_0088670 | 3300037466 | Bacteria | 2978 |
| 337 | Ga0395898_0207892 | 3300037466 | Bacteria | 1868 |
| 338 | Ga0395905_0048403 | 3300037471 | Bacteria | 3984 |
| 339 | Ga0395905_0056453 | 3300037471 | Bacteria | 3673 |
| 340 | Ga0395905_0235523 | 3300037471 | Bacteria | 1711 |
| 341 | Ga0395901_0009918 | 3300038443 | Bacteria | 9655 |
| 342 | Ga0395901_0047081 | 3300038443 | Bacteria | 4478 |
| 343 | Ga0395901_0069625 | 3300038443 | Bacteria | 3664 |
| 344 | Ga0395901_0127304 | 3300038443 | Bacteria | 2676 |
| 345 | Ga0395901_0180943 | 3300038443 | Bacteria | 2211 |
| 346 | Ga0395901_0182516 | 3300038443 | Bacteria | 2201 |
| 347 | Ga0395901_0280089 | 3300038443 | Bacteria | 1732 |
| 348 | Ga0436365_1220139 | 3300039437 | Bacteria | 17807 |
| 349 | Ga0439448_0030166 | 3300042005 | Bacteria | 1719 |
| 350 | Ga0450920_001235 | 3300042122 | Bacteria | 4198 |
| 351 | Ga0439458_0005864 | 3300042157 | Bacteria | 2752 |
| 352 | Ga0466969_0004436 | 3300044656 | Bacteria | 7463 |
| 353 | Ga0466961_0009894 | 3300044693 | Bacteria | 6077 |
| 354 | Ga0466961_0017102 | 3300044693 | Bacteria | 4657 |
| 355 | Ga0466961_0046450 | 3300044693 | Bacteria | 2777 |
| 356 | Ga0466963_0000205 | 3300044694 | Bacteria | 25099 |
| 357 | Ga0466963_0004431 | 3300044694 | Bacteria | 8159 |
| 358 | Ga0466963_0064968 | 3300044694 | Bacteria | 2446 |
| 359 | Ga0466963_0065471 | 3300044694 | Bacteria | 2437 |
| 360 | Ga0466963_0073009 | 3300044694 | Bacteria | 2312 |
| 361 | Ga0466963_0192045 | 3300044694 | Bacteria | 1427 |
| 362 | Ga0466964_0002840 | 3300044706 | Bacteria | 6244 |
| 363 | Ga0466964_0025065 | 3300044706 | Bacteria | 2328 |
| 364 | Ga0466971_0002531 | 3300044719 | Bacteria | 7726 |
| 365 | Ga0466971_0010508 | 3300044719 | Bacteria | 4047 |
| 366 | Ga0466968_0017563 | 3300044735 | Bacteria | 2861 |
| 367 | Ga0466957_0000280 | 3300044842 | Bacteria | 24823 |
| 368 | Ga0451576_0039636 | 3300045051 | Bacteria | 4986 |
| 369 | Ga0466967_0003679 | 3300045976 | Bacteria | 10093 |
| 370 | Ga0466967_0004529 | 3300045976 | Bacteria | 9400 |
| 371 | Ga0466967_0005081 | 3300045976 | Bacteria | 9031 |
| 372 | Ga0466967_0016123 | 3300045976 | Bacteria | 5881 |
| 373 | Ga0466967_0028944 | 3300045976 | Bacteria | 4631 |
| 374 | Ga0466967_0051112 | 3300045976 | Bacteria | 3621 |
| 375 | Ga0466967_0104251 | 3300045976 | Bacteria | 2596 |
| 376 | Ga0466967_0119679 | 3300045976 | Bacteria | 2431 |
| 377 | Ga0466967_0121901 | 3300045976 | Bacteria | 2410 |
| 378 | Ga0466967_0253316 | 3300045976 | Bacteria | 1682 |
| 379 | Ga0466967_0281866 | 3300045976 | Bacteria | 1595 |
| 380 | Ga0466967_0325252 | 3300045976 | Bacteria | 1484 |
| 381 | Ga0466967_0326837 | 3300045976 | Bacteria | 1480 |
| 382 | Ga0466967_0337819 | 3300045976 | Bacteria | 1456 |
| 383 | Ga0495592_0000207 | 3300046454 | Bacteria | 50220 |
| 384 | Ga0495603_0000445 | 3300046455 | Bacteria | 22677 |
| 385 | Ga0495603_0043771 | 3300046455 | Bacteria | 2672 |
| 386 | Ga0495603_0052970 | 3300046455 | Bacteria | 2408 |
| 387 | Ga0495603_0157149 | 3300046455 | Bacteria | 1319 |
| 388 | Ga0495629_0003295 | 3300046459 | Bacteria | 12198 |
| 389 | Ga0495629_0014228 | 3300046459 | Bacteria | 5730 |
| 390 | Ga0495638_0013119 | 3300046460 | Bacteria | 5657 |
| 391 | Ga0495641_0052952 | 3300046461 | Bacteria | 1848 |
| 392 | Ga0495641_0084546 | 3300046461 | Bacteria | 1421 |
| 393 | Ga0495651_0000106 | 3300046462 | Bacteria | 61363 |
| 394 | Ga0495651_0141969 | 3300046462 | Unclassified | 1740 |
| 395 | Ga0495653_0000290 | 3300046463 | Bacteria | 40612 |
| 396 | Ga0495653_0008918 | 3300046463 | Bacteria | 8201 |
| 397 | Ga0495582_0000516 | 3300046473 | Bacteria | 21253 |
| 398 | Ga0495582_0007912 | 3300046473 | Bacteria | 5875 |
| 399 | Ga0495582_0059933 | 3300046473 | Bacteria | 2100 |
| 400 | Ga0495582_0059973 | 3300046473 | Bacteria | 2099 |
| 401 | Ga0495639_0001552 | 3300046475 | Bacteria | 10257 |
| 402 | Ga0495639_0087559 | 3300046475 | Bacteria | 1458 |
| 403 | Ga0495662_0013779 | 3300046476 | Bacteria | 3936 |
| 404 | Ga0495662_0084873 | 3300046476 | Bacteria | 1542 |
| 405 | Ga0495664_0014036 | 3300046477 | Bacteria | 4539 |
| 406 | Ga0495584_0048069 | 3300046491 | Bacteria | 2152 |
| 407 | Ga0495594_0107374 | 3300046499 | Bacteria | 1572 |
| 408 | Ga0495596_0031975 | 3300046500 | Bacteria | 2100 |
| 409 | Ga0495608_0001216 | 3300046511 | Bacteria | 18231 |
| 410 | Ga0495608_0099334 | 3300046511 | Unclassified | 1877 |
| 411 | Ga0495618_0000561 | 3300046514 | Bacteria | 26461 |
| 412 | Ga0495618_0017961 | 3300046514 | Bacteria | 4340 |
| 413 | Ga0495618_0118676 | 3300046514 | Bacteria | 1694 |
| 414 | Ga0495628_0000185 | 3300046516 | Bacteria | 54717 |
| 415 | Ga0495630_0022437 | 3300046517 | Bacteria | 4661 |
| 416 | Ga0495630_0086588 | 3300046517 | Bacteria | 2366 |
| 417 | Ga0495630_0186036 | 3300046517 | Unclassified | 1584 |
| 418 | Ga0495652_0000466 | 3300046529 | Bacteria | 47387 |
| 419 | Ga0495652_0050989 | 3300046529 | Bacteria | 3536 |
| 420 | Ga0495652_0222935 | 3300046529 | Bacteria | 1416 |
| 421 | Ga0495665_0000240 | 3300046531 | Bacteria | 27586 |
| 422 | Ga0495586_0076559 | 3300046535 | Bacteria | 1833 |
| 423 | Ga0495587_0000537 | 3300046536 | Bacteria | 26275 |
| 424 | Ga0495587_0048521 | 3300046536 | Unclassified | 2514 |
| 425 | Ga0495645_0000115 | 3300046543 | Bacteria | 54956 |
| 426 | Ga0495667_0011033 | 3300046559 | Bacteria | 6109 |
| 427 | Ga0495667_0041285 | 3300046559 | Bacteria | 3060 |
| 428 | Ga0495667_0041925 | 3300046559 | Unclassified | 3034 |
| 429 | Ga0495634_0023328 | 3300046642 | Bacteria | 4351 |
| 430 | Ga0495634_0028372 | 3300046642 | Bacteria | 3885 |
| 431 | Ga0495634_0033135 | 3300046642 | Bacteria | 3551 |
| 432 | Ga0495634_0159985 | 3300046642 | Unclassified | 1420 |
| 433 | Ga0495635_0016636 | 3300046663 | Bacteria | 5138 |
| 434 | Ga0495635_0094057 | 3300046663 | Unclassified | 2049 |
| 435 | Ga0495588_0004083 | 3300046674 | Bacteria | 6425 |
| 436 | Ga0495657_0010467 | 3300046675 | Bacteria | 6978 |
| 437 | Ga0495657_0029004 | 3300046675 | Bacteria | 3884 |
| 438 | Ga0495657_0050638 | 3300046675 | Bacteria | 2792 |
| 439 | Ga0495599_0000135 | 3300046678 | Bacteria | 47515 |
| 440 | Ga0495599_0082408 | 3300046678 | Unclassified | 2009 |
| 441 | Ga0495623_0000350 | 3300046679 | Bacteria | 30436 |
| 442 | Ga0495623_0065819 | 3300046679 | Unclassified | 2265 |
| 443 | Ga0495646_0000351 | 3300046680 | Bacteria | 23709 |
| 444 | Ga0495647_0008629 | 3300046681 | Unclassified | 3429 |
| 445 | Ga0495647_0029843 | 3300046681 | Bacteria | 2019 |
| 446 | Ga0495658_0000691 | 3300046683 | Bacteria | 18249 |
| 447 | Ga0495658_0049340 | 3300046683 | Bacteria | 2377 |
| 448 | Ga0495613_0011438 | 3300046689 | Bacteria | 6597 |
| 449 | Ga0495613_0029805 | 3300046689 | Bacteria | 4056 |
| 450 | Ga0495613_0072645 | 3300046689 | Bacteria | 2508 |
| 451 | Ga0495613_0114778 | 3300046689 | Bacteria | 1938 |
| 452 | Ga0495624_0008806 | 3300046690 | Bacteria | 7016 |
| 453 | Ga0495600_0006098 | 3300046809 | Bacteria | 7302 |
| 454 | Ga0495600_0018844 | 3300046809 | Bacteria | 4403 |
| 455 | Ga0495600_0090125 | 3300046809 | Bacteria | 2000 |
| 456 | Ga0495581_0000481 | 3300047315 | Bacteria | 20285 |
| 457 | Ga0495581_0197045 | 3300047315 | Bacteria | 1178 |
| 458 | Ga0495604_0000060 | 3300047317 | Bacteria | 95444 |
| 459 | Ga0495604_0031932 | 3300047317 | Bacteria | 4175 |
| 460 | Ga0495674_0015172 | 3300047319 | Bacteria | 7206 |
| 461 | Ga0495674_0022505 | 3300047319 | Bacteria | 5814 |
| 462 | Ga0495674_0027758 | 3300047319 | Bacteria | 5168 |
| 463 | Ga0495674_0053092 | 3300047319 | Bacteria | 3565 |
| 464 | Ga0495674_0076611 | 3300047319 | Bacteria | 2876 |
| 465 | Ga0495674_0148938 | 3300047319 | Bacteria | 1963 |
| 466 | Ga0495676_0000654 | 3300047321 | Bacteria | 28845 |
| 467 | Ga0495676_0010451 | 3300047321 | Bacteria | 8416 |
| 468 | Ga0495676_0018380 | 3300047321 | Bacteria | 6162 |
| 469 | Ga0495680_0002435 | 3300047322 | Bacteria | 19040 |
| 470 | Ga0495680_0003818 | 3300047322 | Bacteria | 14626 |
| 471 | Ga0495680_0014000 | 3300047322 | Bacteria | 6973 |
| 472 | Ga0495680_0024176 | 3300047322 | Bacteria | 5042 |
| 473 | Ga0495680_0035391 | 3300047322 | Bacteria | 4022 |
| 474 | Ga0495675_0000223 | 3300047444 | Bacteria | 41211 |
| 475 | Ga0495675_0027064 | 3300047444 | Bacteria | 3655 |
| 476 | Ga0495684_0011766 | 3300047471 | Bacteria | 6754 |
| 477 | Ga0495684_0014714 | 3300047471 | Bacteria | 6023 |
| 478 | Ga0495684_0022572 | 3300047471 | Bacteria | 4839 |
| 479 | Ga0495593_0011508 | 3300047673 | Bacteria | 5079 |
| 480 | Ga0495602_0000197 | 3300048088 | Bacteria | 56557 |
| 481 | Ga0495602_0302952 | 3300048088 | Bacteria | 1169 |
| 482 | Ga0495614_0035273 | 3300048089 | Unclassified | 2149 |
| 483 | Ga0496100_0073543 | 3300048903 | Bacteria | 2288 |
| 484 | Ga0496100_0165700 | 3300048903 | Bacteria | 1587 |
| 485 | Ga0496101_0052217 | 3300048904 | Bacteria | 2947 |
| 486 | Ga0496101_0052593 | 3300048904 | Bacteria | 2937 |
| 487 | Ga0496101_0069443 | 3300048904 | Bacteria | 2578 |
| 488 | Ga0496101_0161313 | 3300048904 | Bacteria | 1719 |
| 489 | Ga0496101_0198706 | 3300048904 | Bacteria | 1549 |
| 490 | Ga0496101_0417252 | 3300048904 | Bacteria | 1058 |
| 491 | Ga0496102_0007328 | 3300048905 | Bacteria | 9419 |
| 492 | Ga0496102_0035871 | 3300048905 | Bacteria | 4466 |
| 493 | Ga0496102_0221979 | 3300048905 | Bacteria | 1782 |
| 494 | Ga0496103_0013037 | 3300048906 | Bacteria | 4928 |
| 495 | Ga0496104_0001809 | 3300048907 | Bacteria | 18537 |
| 496 | Ga0496104_0067297 | 3300048907 | Bacteria | 3402 |
| 497 | Ga0496105_0001748 | 3300048908 | Bacteria | 15536 |
| 498 | Ga0496105_0010299 | 3300048908 | Bacteria | 7349 |
| 499 | Ga0496105_0015684 | 3300048908 | Bacteria | 6045 |
| 500 | Ga0496105_0141815 | 3300048908 | Bacteria | 1978 |
| 501 | Ga0496106_0019107 | 3300048909 | Bacteria | 5079 |
| 502 | Ga0496106_0024124 | 3300048909 | Bacteria | 4521 |
| 503 | Ga0496106_0108857 | 3300048909 | Bacteria | 2155 |
| 504 | Ga0496106_0195296 | 3300048909 | Bacteria | 1610 |
| 505 | Ga0496107_0007667 | 3300048910 | Bacteria | 7452 |
| 506 | Ga0496107_0051018 | 3300048910 | Bacteria | 2983 |
| 507 | Ga0496107_0168321 | 3300048910 | Bacteria | 1625 |
| 508 | Ga0496107_0179271 | 3300048910 | Bacteria | 1573 |
| 509 | Ga0496108_0005376 | 3300048911 | Bacteria | 10353 |
| 510 | Ga0496108_0025258 | 3300048911 | Bacteria | 4895 |
| 511 | Ga0496108_0065698 | 3300048911 | Bacteria | 3058 |
| 512 | Ga0496108_0299002 | 3300048911 | Bacteria | 1402 |
| 513 | Ga0496109_0000613 | 3300048912 | Bacteria | 29798 |
| 514 | Ga0496109_0013078 | 3300048912 | Bacteria | 7179 |
| 515 | Ga0496109_0078028 | 3300048912 | Bacteria | 3049 |
| 516 | Ga0496109_0310916 | 3300048912 | Bacteria | 1487 |
| 517 | Ga0496110_0000227 | 3300048913 | Bacteria | 36597 |
| 518 | Ga0496110_0010434 | 3300048913 | Bacteria | 7554 |
| 519 | Ga0496110_0031403 | 3300048913 | Bacteria | 4583 |
| 520 | Ga0496110_0060744 | 3300048913 | Bacteria | 3334 |
| 521 | Ga0496110_0176732 | 3300048913 | Unclassified | 1938 |
| 522 | Ga0496110_0408361 | 3300048913 | Bacteria | 1238 |
| 523 | Ga0496111_0019990 | 3300048914 | Bacteria | 4658 |
| 524 | Ga0496111_0027506 | 3300048914 | Bacteria | 4023 |
| 525 | Ga0496111_0047140 | 3300048914 | Bacteria | 3103 |
| 526 | Ga0496111_0225639 | 3300048914 | Bacteria | 1391 |
| 527 | Ga0496112_0013398 | 3300048915 | Bacteria | 7568 |
| 528 | Ga0496112_0021015 | 3300048915 | Bacteria | 6200 |
| 529 | Ga0496113_0010346 | 3300048916 | Bacteria | 6162 |
| 530 | Ga0496113_0015361 | 3300048916 | Bacteria | 5260 |
| 531 | Ga0496113_0046180 | 3300048916 | Bacteria | 3233 |
| 532 | Ga0496114_0012648 | 3300048917 | Bacteria | 6760 |
| 533 | Ga0496114_0015571 | 3300048917 | Bacteria | 6114 |
| 534 | Ga0496114_0280195 | 3300048917 | Bacteria | 1470 |
| 535 | Ga0496115_0014093 | 3300048918 | Bacteria | 6053 |
| 536 | Ga0496115_0324180 | 3300048918 | Bacteria | 1259 |
| 537 | Ga0501031_0005364 | 3300049568 | Bacteria | 8347 |
| 538 | Ga0501031_0007015 | 3300049568 | Bacteria | 7354 |
| 539 | Ga0501031_0018815 | 3300049568 | Bacteria | 4497 |
| 540 | Ga0501032_0030221 | 3300049569 | Bacteria | 3717 |
| 541 | Ga0501032_0050504 | 3300049569 | Bacteria | 2805 |
| 542 | Ga0501033_0029934 | 3300049570 | Bacteria | 4092 |
| 543 | Ga0501033_0097300 | 3300049570 | Bacteria | 2150 |
| 544 | Ga0501036_0008841 | 3300049572 | Bacteria | 8269 |
| 545 | Ga0501036_0073801 | 3300049572 | Bacteria | 2884 |
| 546 | Ga0501037_0007155 | 3300049573 | Bacteria | 8156 |
| 547 | Ga0501037_0063001 | 3300049573 | Bacteria | 2703 |
| 548 | Ga0501038_0004352 | 3300049574 | Bacteria | 13177 |
| 549 | Ga0501038_0029908 | 3300049574 | Bacteria | 4824 |
| 550 | Ga0501039_0007649 | 3300049575 | Bacteria | 8249 |
| 551 | Ga0501039_0085398 | 3300049575 | Bacteria | 2458 |
| 552 | Ga0501040_0009636 | 3300049576 | Bacteria | 6304 |
| 553 | Ga0501040_0030782 | 3300049576 | Bacteria | 3626 |
| 554 | Ga0501040_0121395 | 3300049576 | Bacteria | 1833 |
| 555 | Ga0501040_0260997 | 3300049576 | Bacteria | 1236 |
| 556 | Ga0501041_0015393 | 3300049577 | Bacteria | 4541 |
| 557 | Ga0501042_0128958 | 3300049578 | Bacteria | 1822 |
| 558 | Ga0501046_0008189 | 3300049580 | Bacteria | 9132 |
| 559 | Ga0501046_0054041 | 3300049580 | Bacteria | 3161 |
| 560 | Ga0501046_0109881 | 3300049580 | Bacteria | 2107 |
| 561 | Ga0501047_0023201 | 3300049581 | Bacteria | 5958 |
| 562 | Ga0501047_0028024 | 3300049581 | Bacteria | 5428 |
| 563 | Ga0501048_0013462 | 3300049582 | Bacteria | 6070 |
| 564 | Ga0501048_0048234 | 3300049582 | Bacteria | 3038 |
| 565 | Ga0501048_0135331 | 3300049582 | Bacteria | 1741 |
| 566 | Ga0501067_0016161 | 3300049583 | Bacteria | 4126 |
| 567 | Ga0501068_0001354 | 3300049584 | Bacteria | 12993 |
| 568 | Ga0501068_0051552 | 3300049584 | Bacteria | 2489 |
| 569 | Ga0501069_0171598 | 3300049585 | Bacteria | 1251 |
| 570 | Ga0501070_0020855 | 3300049586 | Bacteria | 5497 |
| 571 | Ga0501070_0083465 | 3300049586 | Bacteria | 2645 |
| 572 | Ga0501070_0259672 | 3300049586 | Bacteria | 1420 |
| 573 | Ga0501071_0003541 | 3300049587 | Bacteria | 9770 |
| 574 | Ga0501071_0009471 | 3300049587 | Bacteria | 6489 |
| 575 | Ga0501071_0015098 | 3300049587 | Bacteria | 5296 |
| 576 | Ga0501071_0032762 | 3300049587 | Bacteria | 3691 |
| 577 | Ga0501071_0166129 | 3300049587 | Bacteria | 1651 |
| 578 | Ga0501072_0007825 | 3300049588 | Bacteria | 8116 |
| 579 | Ga0501072_0009404 | 3300049588 | Bacteria | 7433 |
| 580 | Ga0501072_0015793 | 3300049588 | Bacteria | 5788 |
| 581 | Ga0501072_0017765 | 3300049588 | Bacteria | 5469 |
| 582 | Ga0501072_0059036 | 3300049588 | Bacteria | 3024 |
| 583 | Ga0501073_0000628 | 3300049589 | Bacteria | 24828 |
| 584 | Ga0501073_0056903 | 3300049589 | Bacteria | 2734 |
| 585 | Ga0501073_0149629 | 3300049589 | Bacteria | 1618 |
| 586 | Ga0501074_0016439 | 3300049590 | Bacteria | 5372 |
| 587 | Ga0501074_0024114 | 3300049590 | Bacteria | 4421 |
| 588 | Ga0501074_0026160 | 3300049590 | Bacteria | 4231 |
| 589 | Ga0501075_0004487 | 3300049591 | Bacteria | 9454 |
| 590 | Ga0501075_0005137 | 3300049591 | Bacteria | 8950 |
| 591 | Ga0501075_0009095 | 3300049591 | Bacteria | 6939 |
| 592 | Ga0501075_0033610 | 3300049591 | Bacteria | 3815 |
| 593 | Ga0501076_0016152 | 3300049592 | Bacteria | 5652 |
| 594 | Ga0501076_0018581 | 3300049592 | Bacteria | 5302 |
| 595 | Ga0501076_0403881 | 3300049592 | Bacteria | 1123 |
| 596 | Ga0501077_0005536 | 3300049593 | Bacteria | 7687 |
| 597 | Ga0501077_0085168 | 3300049593 | Bacteria | 2003 |
| 598 | Ga0501077_0087425 | 3300049593 | Bacteria | 1975 |
| 599 | Ga0501079_0009620 | 3300049741 | Bacteria | 7331 |
| 600 | Ga0501079_0043082 | 3300049741 | Bacteria | 3483 |
| 601 | Ga0501079_0084643 | 3300049741 | Bacteria | 2453 |
| 602 | Ga0501080_0021157 | 3300049742 | Bacteria | 6020 |
| 603 | Ga0501080_0047098 | 3300049742 | Bacteria | 4013 |
| 604 | Ga0501080_0057448 | 3300049742 | Bacteria | 3623 |
| 605 | Ga0501080_0177867 | 3300049742 | Bacteria | 1959 |
| 606 | Ga0501080_0195937 | 3300049742 | Bacteria | 1855 |
| 607 | Ga0501081_0008239 | 3300049743 | Bacteria | 6766 |
| 608 | Ga0501081_0010371 | 3300049743 | Bacteria | 6078 |
| 609 | Ga0501081_0011177 | 3300049743 | Bacteria | 5871 |
| 610 | Ga0501081_0048945 | 3300049743 | Bacteria | 2909 |
| 611 | Ga0501081_0107923 | 3300049743 | Bacteria | 1974 |
| 612 | Ga0501083_0000739 | 3300049744 | Bacteria | 21326 |
| 613 | Ga0501083_0005244 | 3300049744 | Bacteria | 9166 |
| 614 | Ga0501083_0026654 | 3300049744 | Bacteria | 3993 |
| 615 | Ga0501083_0081442 | 3300049744 | Bacteria | 2146 |
| 616 | Ga0501083_0097001 | 3300049744 | Bacteria | 1945 |
| 617 | Ga0501035_0069067 | 3300049822 | Bacteria | 3132 |
| 618 | Ga0501035_0074745 | 3300049822 | Bacteria | 2997 |
| 619 | Ga0501035_0186357 | 3300049822 | Bacteria | 1786 |
| 620 | Ga0501035_0217616 | 3300049822 | Bacteria | 1632 |
| 621 | Ga0501045_0001564 | 3300049824 | Bacteria | 15240 |
| 622 | Ga0501045_0002762 | 3300049824 | Bacteria | 11982 |
| 623 | Ga0501045_0021776 | 3300049824 | Bacteria | 4588 |
| 624 | Ga0501045_0079954 | 3300049824 | Bacteria | 2410 |
| 625 | Ga0501045_0088558 | 3300049824 | Bacteria | 2286 |
| 626 | nmdc:mga00v17_6163_c1 | 3300050491 | Bacteria | 2665 |
| 627 | nmdc:mga0yw44_68050_c1 | 3300050492 | Bacteria | 2202 |
| 628 | nmdc:mga05p37_17104_c1 | 3300050507 | Bacteria | 8748 |
| 629 | nmdc:mga05p37_39397_c1 | 3300050507 | Bacteria | 5802 |
| 630 | nmdc:mga05p37_406091_c1 | 3300050507 | Bacteria | 1589 |
| 631 | nmdc:mga05p37_64172_c1 | 3300050507 | Bacteria | 4519 |
| 632 | nmdc:mga05p37_885_c1 | 3300050507 | Bacteria | 33780 |
| 633 | nmdc:mga09592_6255_c1 | 3300050508 | Bacteria | 9696 |
| 634 | nmdc:mga06r32_391070_c1 | 3300050510 | Bacteria | 1373 |
| 635 | nmdc:mga08y16_1003_c1 | 3300050511 | Bacteria | 27574 |
| 636 | nmdc:mga08y16_120206_c1 | 3300050511 | Bacteria | 2734 |
| 637 | nmdc:mga08y16_27785_c1 | 3300050511 | Bacteria | 5962 |
| 638 | nmdc:mga08y16_402075_c1 | 3300050511 | Bacteria | 1401 |
| 639 | nmdc:mga08y16_543376_c1 | 3300050511 | Bacteria | 1177 |
| 640 | nmdc:mga0n895_14233_c1 | 3300050512 | Bacteria | 7216 |
| 641 | nmdc:mga0rr50_147108_c1 | 3300050513 | Bacteria | 1901 |
| 642 | nmdc:mga0rr50_20546_c1 | 3300050513 | Bacteria | 4489 |
| 643 | nmdc:mga0rr50_25267_c1 | 3300050513 | Bacteria | 4127 |
| 644 | nmdc:mga0a205_107563_c1 | 3300050515 | Bacteria | 2687 |
| 645 | nmdc:mga0a205_110063_c1 | 3300050515 | Bacteria | 2653 |
| 646 | nmdc:mga0a205_9352_c1 | 3300050515 | Bacteria | 8955 |
| 647 | Ga0495601_0000238 | 3300053077 | Bacteria | 29363 |
| 648 | Ga0495601_0008450 | 3300053077 | Bacteria | 6081 |
| 649 | Ga0495601_0037479 | 3300053077 | Bacteria | 3031 |
| 650 | Ga0495595_0024914 | 3300053084 | Unclassified | 2645 |
| 651 | Ga0495595_0035945 | 3300053084 | Bacteria | 2246 |
| 652 | Ga0495619_0000200 | 3300053085 | Bacteria | 43823 |
| 653 | Ga0495619_0015891 | 3300053085 | Bacteria | 4766 |
| 654 | Ga0495619_0020597 | 3300053085 | Bacteria | 4203 |
| 655 | Ga0495619_0040555 | 3300053085 | Bacteria | 3044 |
| 656 | Ga0501084_0037442 | 3300054114 | Bacteria | 4052 |
| 657 | Ga0501082_0019554 | 3300060353 | Bacteria | 5840 |
| 658 | Ga0501082_0045737 | 3300060353 | Bacteria | 3774 |
| 659 | Ga0501082_0143066 | 3300060353 | Bacteria | 2075 |
| 660 | Ga0466962_0001269 | 3300061719 | Bacteria | 11653 |
| 661 | Ga0530510_0187631 | 3300061734 | Bacteria | 1534 |
| 662 | Ga0530510_0295087 | 3300061734 | Bacteria | 1212 |
| 663 | Ga0496101_0032245 | |||
| 664 | Ga0070658_10181782 | |||
| 665 | Ga0070676_10022878 | |||
| 666 | Ga0070683_100052919 | |||
| 667 | Ga0070683_100074926 | |||
| 668 | Ga0070683_100092440 | |||
| 669 | Ga0070683_100107201 | |||
| 670 | Ga0070683_100410263 | |||
| 671 | Ga0070670_100025282 | |||
| 672 | Ga0070670_100063240 | |||
| 673 | Ga0068869_100189681 | |||
| 674 | Ga0070682_100013359 | |||
| 675 | Ga0068868_100057126 | |||
| 676 | Ga0070660_100006183 | |||
| 677 | Ga0070660_100083443 | |||
| 678 | Ga0070660_100142995 | |||
| 679 | Ga0070691_10120273 | |||
| 680 | Ga0070661_100053041 | |||
| 681 | Ga0070692_10019780 | |||
| 682 | Ga0070668_100072282 | |||
| 683 | Ga0070669_100011579 | |||
| 684 | Ga0070675_100070588 | |||
| 685 | Ga0070671_100285656 | |||
| 686 | Ga0070674_100153850 | |||
| 687 | Ga0070673_100256706 | |||
| 688 | Ga0070659_100000071 | |||
| 689 | Ga0070659_100103273 | |||
| 690 | Ga0070667_100000521 | |||
| 691 | Ga0070667_100018523 | |||
| 692 | Ga0070709_10120623 | |||
| 693 | Ga0070714_100000342 | |||
| 694 | Ga0070714_100089007 | |||
| 695 | Ga0070714_100388094 | |||
| 696 | Ga0070713_100069530 | |||
| 697 | Ga0070713_100448072 | |||
| 698 | Ga0070710_10070269 | |||
| 699 | Ga0070710_10200643 | |||
| 700 | Ga0070711_100021417 | |||
| 701 | Ga0070711_100392332 | |||
| 702 | Ga0070700_100193601 | |||
| 703 | Ga0070708_100033219 | |||
| 704 | Ga0070708_100080435 | |||
| 705 | Ga0070663_100011213 | |||
| 706 | Ga0070678_100015365 | |||
| 707 | Ga0070678_100015655 | |||
| 708 | Ga0070662_100032079 | |||
| 709 | Ga0070662_100129924 | |||
| 710 | Ga0070681_10096947 | |||
| 711 | Ga0070681_10231390 | |||
| 712 | Ga0070685_10022590 | |||
| 713 | Ga0070685_10141079 | |||
| 714 | Ga0070706_100000823 | |||
| 715 | Ga0070706_100057572 | |||
| 716 | Ga0070707_100002811 | |||
| 717 | Ga0070698_100000805 | |||
| 718 | Ga0070698_100044298 | |||
| 719 | Ga0070698_100120026 | |||
| 720 | Ga0070679_100099050 | |||
| 721 | Ga0070679_100102811 | |||
| 722 | Ga0070679_100175502 | |||
| 723 | Ga0070684_100032864 | |||
| 724 | Ga0070684_100035945 | |||
| 725 | Ga0070684_100121212 | |||
| 726 | Ga0070684_100240393 | |||
| 727 | Ga0070684_100252936 | |||
| 728 | Ga0070684_100352787 | |||
| 729 | Ga0070697_100379840 | |||
| 730 | Ga0068853_100061002 | |||
| 731 | Ga0068853_100307895 | |||
| 732 | Ga0070672_100059327 | |||
| 733 | Ga0070672_100174845 | |||
| 734 | Ga0070696_100044154 | |||
| 735 | Ga0070696_100072476 | |||
| 736 | Ga0070693_100077116 | |||
| 737 | Ga0070665_100004920 | |||
| 738 | Ga0070665_100335740 | |||
| 739 | Ga0070704_100071693 | |||
| 740 | Ga0070704_100084762 | |||
| 741 | Ga0070704_100224083 | |||
| 742 | Ga0068855_100023638 | |||
| 743 | Ga0068855_100110665 | |||
| 744 | Ga0068855_100137556 | |||
| 745 | Ga0068855_100209444 | |||
| 746 | Ga0068855_100283822 | |||
| 747 | Ga0070664_100206715 | |||
| 748 | Ga0068857_100150700 | |||
| 749 | Ga0068857_100151545 | |||
| 750 | Ga0068856_100006059 | |||
| 751 | Ga0068856_100114058 | |||
| 752 | Ga0070702_100097959 | |||
| 753 | Ga0068852_100071670 | |||
| 754 | Ga0068852_100156419 | |||
| 755 | Ga0068864_100273198 | |||
| 756 | Ga0068866_10100059 | |||
| 757 | Ga0068861_100292494 | |||
| 758 | Ga0068870_10022120 | |||
| 759 | Ga0068870_10028295 | |||
| 760 | Ga0068863_100531790 | |||
| 761 | Ga0068858_100435189 | |||
| 762 | Ga0068860_100393501 | |||
| 763 | Ga0068862_100000772 | |||
| 764 | Ga0081455_10101779 | |||
| 765 | Ga0081455_10127874 | |||
| 766 | Ga0081455_10251523 | |||
| 767 | Ga0081538_10026632 | |||
| 768 | Ga0081540_1004204 | |||
| 769 | Ga0081540_1019924 | |||
| 770 | Ga0070717_10002940 | |||
| 771 | Ga0070717_10016455 | |||
| 772 | Ga0075365_10100543 | |||
| 773 | Ga0075364_10039922 | |||
| 774 | Ga0075432_10001987 | |||
| 775 | Ga0070715_10085318 | |||
| 776 | Ga0070712_100199675 | |||
| 777 | Ga0097621_100028225 | |||
| 778 | Ga0075370_10032801 | |||
| 779 | Ga0068871_100363214 | |||
| 780 | Ga0075428_100000211 | |||
| 781 | Ga0075428_100101291 | |||
| 782 | Ga0075433_10012759 | |||
| 783 | Ga0075433_10169894 | |||
| 784 | Ga0075434_100043521 | |||
| 785 | Ga0075434_100071241 | |||
| 786 | Ga0075429_100005341 | |||
| 787 | Ga0068865_100015100 | |||
| 788 | Ga0068865_100312832 | |||
| 789 | Ga0075436_100006476 | |||
| 790 | Ga0075435_100155573 | |||
| 791 | Ga0105240_10160060 | |||
| 792 | Ga0105240_10586883 | |||
| 793 | Ga0111539_10003281 | |||
| 794 | Ga0111539_10103504 | |||
| 795 | Ga0111539_10169415 | |||
| 796 | Ga0111539_10195746 | |||
| 797 | Ga0111539_10701644 | |||
| 798 | Ga0105245_10001672 | |||
| 799 | Ga0105245_10023674 | |||
| 800 | Ga0105245_10208538 | |||
| 801 | Ga0105247_10124185 | |||
| 802 | Ga0114129_10002058 | |||
| 803 | Ga0114129_10011553 | |||
| 804 | Ga0114129_10227574 | |||
| 805 | Ga0114129_10260844 | |||
| 806 | Ga0114129_10448329 | |||
| 807 | Ga0105243_10119698 | |||
| 808 | Ga0105243_10277364 | |||
| 809 | Ga0105242_10018143 | |||
| 810 | Ga0105242_10101880 | |||
| 811 | Ga0105242_10176057 | |||
| 812 | Ga0105242_10227184 | |||
| 813 | Ga0105248_10304657 | |||
| 814 | Ga0105237_10101507 | |||
| 815 | Ga0105237_10415324 | |||
| 816 | Ga0105238_10010169 | |||
| 817 | Ga0105238_10046758 | |||
| 818 | Ga0105238_10275082 | |||
| 819 | Ga0105249_10010169 | |||
| 820 | Ga0105249_10156441 | |||
| 821 | Ga0105239_10054676 | |||
| 822 | Ga0105239_10228885 | |||
| 823 | Ga0105239_10584398 | |||
| 824 | Ga0105246_10015910 | |||
| 825 | Ga0105246_10042671 | |||
| 826 | Ga0105246_10073261 | |||
| 827 | Ga0157370_10026174 | |||
| 828 | Ga0157370_10033161 | |||
| 829 | Ga0157370_10054870 | |||
| 830 | Ga0157369_10022942 | |||
| 831 | Ga0157369_10221769 | |||
| 832 | Ga0157374_10076623 | |||
| 833 | Ga0157378_10346514 | |||
| 834 | Ga0163162_10606949 | |||
| 835 | Ga0157372_10072238 | |||
| 836 | Ga0157372_10119470 | |||
| 837 | Ga0157372_10358312 | |||
| 838 | Ga0157372_10488001 | |||
| 839 | Ga0157375_10059076 | |||
| 840 | Ga0157375_10344250 | |||
| 841 | Ga0157375_10594092 | |||
| 842 | Ga0163163_10039202 | |||
| 843 | Ga0182008_10015027 | |||
| 844 | Ga0182008_10087434 | |||
| 845 | Ga0182008_10189682 | |||
| 846 | Ga0157377_10006166 | |||
| 847 | Ga0157379_10254688 | |||
| 848 | Ga0157376_10523823 | |||
| 849 | Ga0163161_10168797 | |||
| 850 | Ga0206356_10221095 | |||
| 851 | Ga0206356_10397882 | |||
| 852 | Ga0206353_10556283 | |||
| 853 | Ga0206353_10581081 | |||
| 854 | Ga0207692_10009347 | |||
| 855 | Ga0207642_10042592 | |||
| 856 | Ga0207688_10009635 | |||
| 857 | Ga0207685_10006858 | |||
| 858 | Ga0207643_10003002 | |||
| 859 | Ga0207643_10029234 | |||
| 860 | Ga0207643_10080409 | |||
| 861 | Ga0207705_10016247 | |||
| 862 | Ga0207684_10000008 | |||
| 863 | Ga0207684_10071765 | |||
| 864 | Ga0207707_10143212 | |||
| 865 | Ga0207707_10173526 | |||
| 866 | Ga0207671_10022752 | |||
| 867 | Ga0207693_10000919 | |||
| 868 | Ga0207663_10116131 | |||
| 869 | Ga0207663_10313550 | |||
| 870 | Ga0207660_10017196 | |||
| 871 | Ga0207660_10032251 | |||
| 872 | Ga0207657_10005718 | |||
| 873 | Ga0207657_10008090 | |||
| 874 | Ga0207657_10044056 | |||
| 875 | Ga0207657_10054299 | |||
| 876 | Ga0207649_10006826 | |||
| 877 | Ga0207652_10202468 | |||
| 878 | Ga0207652_10279687 | |||
| 879 | Ga0207646_10000763 | |||
| 880 | Ga0207681_10008373 | |||
| 881 | Ga0207694_10140519 | |||
| 882 | Ga0207650_10016445 | |||
| 883 | Ga0207650_10088839 | |||
| 884 | Ga0207659_10052897 | |||
| 885 | Ga0207659_10237639 | |||
| 886 | Ga0207687_10019191 | |||
| 887 | Ga0207687_10066899 | |||
| 888 | Ga0207687_10125728 | |||
| 889 | Ga0207687_10276304 | |||
| 890 | Ga0207700_10092550 | |||
| 891 | Ga0207700_10278790 | |||
| 892 | Ga0207700_10305522 | |||
| 893 | Ga0207664_10000617 | |||
| 894 | Ga0207664_10014782 | |||
| 895 | Ga0207664_10038374 | |||
| 896 | Ga0207664_10085867 | |||
| 897 | Ga0207690_10000188 | |||
| 898 | Ga0207690_10021370 | |||
| 899 | Ga0207690_10048138 | |||
| 900 | Ga0207706_10018226 | |||
| 901 | Ga0207706_10061523 | |||
| 902 | Ga0207686_10110530 | |||
| 903 | Ga0207709_10192918 | |||
| 904 | Ga0207709_10240395 | |||
| 905 | Ga0207669_10018564 | |||
| 906 | Ga0207669_10044410 | |||
| 907 | Ga0207669_10298135 | |||
| 908 | Ga0207704_10043766 | |||
| 909 | Ga0207704_10145281 | |||
| 910 | Ga0207704_10151300 | |||
| 911 | Ga0207665_10000603 | |||
| 912 | Ga0207691_10039180 | |||
| 913 | Ga0207691_10266120 | |||
| 914 | Ga0207689_10054974 | |||
| 915 | Ga0207661_10000463 | |||
| 916 | Ga0207661_10124436 | |||
| 917 | Ga0207661_10206626 | |||
| 918 | Ga0207661_10247820 | |||
| 919 | Ga0207667_10113428 | |||
| 920 | Ga0207667_10172599 | |||
| 921 | Ga0207667_10217722 | |||
| 922 | Ga0207712_10002284 | |||
| 923 | Ga0207668_10126321 | |||
| 924 | Ga0207640_10202294 | |||
| 925 | Ga0207640_10278195 | |||
| 926 | Ga0207658_10002483 | |||
| 927 | Ga0207658_10004120 | |||
| 928 | Ga0207677_10126729 | |||
| 929 | Ga0207677_10247999 | |||
| 930 | Ga0207677_10268469 | |||
| 931 | Ga0207703_10016991 | |||
| 932 | Ga0207639_10157039 | |||
| 933 | Ga0207639_10270405 | |||
| 934 | Ga0207678_10008989 | |||
| 935 | Ga0207708_10021885 | |||
| 936 | Ga0207708_10052203 | |||
| 937 | Ga0207702_10028487 | |||
| 938 | Ga0207702_10154015 | |||
| 939 | Ga0207702_10320031 | |||
| 940 | Ga0207648_10043497 | |||
| 941 | Ga0207674_10028849 | |||
| 942 | Ga0207674_10324096 | |||
| 943 | Ga0207675_100001496 | |||
| 944 | Ga0207683_10002515 | |||
| 945 | Ga0207683_10060153 | |||
| 946 | Ga0207683_10293028 | |||
| 947 | Ga0209813_10063924 | |||
| 948 | Ga0207428_10000315 | |||
| 949 | Ga0207428_10070484 | |||
| 950 | Ga0268266_10047771 | |||
| 951 | Ga0268265_10000736 | |||
| 952 | Ga0268264_10132049 | |||
| 953 | Ga0265319_1009539 | |||
| 954 | Ga0265322_10028651 | |||
| 955 | Ga0265338_10015737 | |||
| 956 | Ga0265338_10042393 | |||
| 957 | Ga0265339_10007410 | |||
| 958 | Ga0265316_10020436 | |||
| 959 | Ga0265313_10026781 | |||
| 960 | Ga0265314_10006777 | |||
| 961 | Ga0265342_10031976 | |||
| 962 | Ga0307407_10148648 | |||
| 963 | Ga0307409_100309189 | |||
| 964 | Ga0307416_100420378 | |||
| 965 | Ga0307415_100046294 | |||
| 966 | Ga0307415_100175914 | |||
| 967 | Ga0373934_0042171 | |||
| 968 | Ga0373944_0012216 | |||
| 969 | Ga0373923_0053976 | |||
| 970 | Ga0373932_0039895 | |||
| 971 | Ga0373936_0015399 | |||
| 972 | Ga0373939_0048414 | |||
| 973 | Ga0373956_0017042 | |||
| 974 | Ga0373943_0001514 | |||
| 975 | Ga0373946_0000684 | |||
| 976 | Ga0373955_0142115 | |||
| 977 | Ga0373942_0007075 | |||
| 978 | Ga0373961_0047784 | |||
| 979 | Ga0373931_0027133 | |||
| 980 | Ga0373935_0035974 | |||
| 981 | Ga0373927_0006434 | |||
| 982 | Ga0373947_0001551 | |||
| 983 | Ga0373947_0049242 | |||
| 984 | Ga0373937_0001462 | |||
| 985 | Ga0373937_0013260 | |||
| 986 | Ga0373937_0143624 | |||
| 987 | Ga0373925_0016109 | |||
| 988 | Ga0373925_0050590 | |||
| 989 | Ga0395899_0023938 | |||
| 990 | Ga0395899_0140247 | |||
| 991 | Ga0395900_0052762 | |||
| 992 | Ga0395900_0151455 | |||
| 993 | Ga0395900_0345941 | |||
| 994 | Ga0395900_0421275 | |||
| 995 | Ga0395898_0027962 | |||
| 996 | Ga0395898_0056257 | |||
| 997 | Ga0395898_0087418 | |||
| 998 | Ga0395898_0088670 | |||
| 999 | Ga0395898_0207892 | |||
| 1000 | Ga0395905_0048403 | |||
| 1001 | Ga0395905_0056453 | |||
| 1002 | Ga0395905_0235523 | |||
| 1003 | Ga0395901_0009918 | |||
| 1004 | Ga0395901_0047081 | |||
| 1005 | Ga0395901_0069625 | |||
| 1006 | Ga0395901_0127304 | |||
| 1007 | Ga0395901_0180943 | |||
| 1008 | Ga0395901_0182516 | |||
| 1009 | Ga0395901_0280089 | |||
| 1010 | Ga0436365_1220139 | |||
| 1011 | Ga0439448_0030166 | |||
| 1012 | Ga0450920_001235 | |||
| 1013 | Ga0439458_0005864 | |||
| 1014 | Ga0466969_0004436 | |||
| 1015 | Ga0466961_0009894 | |||
| 1016 | Ga0466961_0017102 | |||
| 1017 | Ga0466961_0046450 | |||
| 1018 | Ga0466963_0000205 | |||
| 1019 | Ga0466963_0004431 | |||
| 1020 | Ga0466963_0064968 | |||
| 1021 | Ga0466963_0065471 | |||
| 1022 | Ga0466963_0073009 | |||
| 1023 | Ga0466963_0192045 | |||
| 1024 | Ga0466964_0002840 | |||
| 1025 | Ga0466964_0025065 | |||
| 1026 | Ga0466971_0002531 | |||
| 1027 | Ga0466971_0010508 | |||
| 1028 | Ga0466968_0017563 | |||
| 1029 | Ga0466957_0000280 | |||
| 1030 | Ga0451576_0039636 | |||
| 1031 | Ga0466967_0003679 | |||
| 1032 | Ga0466967_0004529 | |||
| 1033 | Ga0466967_0005081 | |||
| 1034 | Ga0466967_0016123 | |||
| 1035 | Ga0466967_0028944 | |||
| 1036 | Ga0466967_0051112 | |||
| 1037 | Ga0466967_0104251 | |||
| 1038 | Ga0466967_0119679 | |||
| 1039 | Ga0466967_0121901 | |||
| 1040 | Ga0466967_0253316 | |||
| 1041 | Ga0466967_0281866 | |||
| 1042 | Ga0466967_0325252 | |||
| 1043 | Ga0466967_0326837 | |||
| 1044 | Ga0466967_0337819 | |||
| 1045 | Ga0495592_0000207 | |||
| 1046 | Ga0495603_0000445 | |||
| 1047 | Ga0495603_0043771 | |||
| 1048 | Ga0495603_0052970 | |||
| 1049 | Ga0495603_0157149 | |||
| 1050 | Ga0495629_0003295 | |||
| 1051 | Ga0495629_0014228 | |||
| 1052 | Ga0495638_0013119 | |||
| 1053 | Ga0495641_0052952 | |||
| 1054 | Ga0495641_0084546 | |||
| 1055 | Ga0495651_0000106 | |||
| 1056 | Ga0495651_0141969 | |||
| 1057 | Ga0495653_0000290 | |||
| 1058 | Ga0495653_0008918 | |||
| 1059 | Ga0495582_0000516 | |||
| 1060 | Ga0495582_0007912 | |||
| 1061 | Ga0495582_0059933 | |||
| 1062 | Ga0495582_0059973 | |||
| 1063 | Ga0495639_0001552 | |||
| 1064 | Ga0495639_0087559 | |||
| 1065 | Ga0495662_0013779 | |||
| 1066 | Ga0495662_0084873 | |||
| 1067 | Ga0495664_0014036 | |||
| 1068 | Ga0495584_0048069 | |||
| 1069 | Ga0495594_0107374 | |||
| 1070 | Ga0495596_0031975 | |||
| 1071 | Ga0495608_0001216 | |||
| 1072 | Ga0495608_0099334 | |||
| 1073 | Ga0495618_0000561 | |||
| 1074 | Ga0495618_0017961 | |||
| 1075 | Ga0495618_0118676 | |||
| 1076 | Ga0495628_0000185 | |||
| 1077 | Ga0495630_0022437 | |||
| 1078 | Ga0495630_0086588 | |||
| 1079 | Ga0495630_0186036 | |||
| 1080 | Ga0495652_0000466 | |||
| 1081 | Ga0495652_0050989 | |||
| 1082 | Ga0495652_0222935 | |||
| 1083 | Ga0495665_0000240 | |||
| 1084 | Ga0495586_0076559 | |||
| 1085 | Ga0495587_0000537 | |||
| 1086 | Ga0495587_0048521 | |||
| 1087 | Ga0495645_0000115 | |||
| 1088 | Ga0495667_0011033 | |||
| 1089 | Ga0495667_0041285 | |||
| 1090 | Ga0495667_0041925 | |||
| 1091 | Ga0495634_0023328 | |||
| 1092 | Ga0495634_0028372 | |||
| 1093 | Ga0495634_0033135 | |||
| 1094 | Ga0495634_0159985 | |||
| 1095 | Ga0495635_0016636 | |||
| 1096 | Ga0495635_0094057 | |||
| 1097 | Ga0495588_0004083 | |||
| 1098 | Ga0495657_0010467 | |||
| 1099 | Ga0495657_0029004 | |||
| 1100 | Ga0495657_0050638 | |||
| 1101 | Ga0495599_0000135 | |||
| 1102 | Ga0495599_0082408 | |||
| 1103 | Ga0495623_0000350 | |||
| 1104 | Ga0495623_0065819 | |||
| 1105 | Ga0495646_0000351 | |||
| 1106 | Ga0495647_0008629 | |||
| 1107 | Ga0495647_0029843 | |||
| 1108 | Ga0495658_0000691 | |||
| 1109 | Ga0495658_0049340 | |||
| 1110 | Ga0495613_0011438 | |||
| 1111 | Ga0495613_0029805 | |||
| 1112 | Ga0495613_0072645 | |||
| 1113 | Ga0495613_0114778 | |||
| 1114 | Ga0495624_0008806 | |||
| 1115 | Ga0495600_0006098 | |||
| 1116 | Ga0495600_0018844 | |||
| 1117 | Ga0495600_0090125 | |||
| 1118 | Ga0495581_0000481 | |||
| 1119 | Ga0495581_0197045 | |||
| 1120 | Ga0495604_0000060 | |||
| 1121 | Ga0495604_0031932 | |||
| 1122 | Ga0495674_0015172 | |||
| 1123 | Ga0495674_0022505 | |||
| 1124 | Ga0495674_0027758 | |||
| 1125 | Ga0495674_0053092 | |||
| 1126 | Ga0495674_0076611 | |||
| 1127 | Ga0495674_0148938 | |||
| 1128 | Ga0495676_0000654 | |||
| 1129 | Ga0495676_0010451 | |||
| 1130 | Ga0495676_0018380 | |||
| 1131 | Ga0495680_0002435 | |||
| 1132 | Ga0495680_0003818 | |||
| 1133 | Ga0495680_0014000 | |||
| 1134 | Ga0495680_0024176 | |||
| 1135 | Ga0495680_0035391 | |||
| 1136 | Ga0495675_0000223 | |||
| 1137 | Ga0495675_0027064 | |||
| 1138 | Ga0495684_0011766 | |||
| 1139 | Ga0495684_0014714 | |||
| 1140 | Ga0495684_0022572 | |||
| 1141 | Ga0495593_0011508 | |||
| 1142 | Ga0495602_0000197 | |||
| 1143 | Ga0495602_0302952 | |||
| 1144 | Ga0495614_0035273 | |||
| 1145 | Ga0496100_0073543 | |||
| 1146 | Ga0496100_0165700 | |||
| 1147 | Ga0496101_0052217 | |||
| 1148 | Ga0496101_0052593 | |||
| 1149 | Ga0496101_0069443 | |||
| 1150 | Ga0496101_0161313 | |||
| 1151 | Ga0496101_0198706 | |||
| 1152 | Ga0496101_0417252 | |||
| 1153 | Ga0496102_0007328 | |||
| 1154 | Ga0496102_0035871 | |||
| 1155 | Ga0496102_0221979 | |||
| 1156 | Ga0496103_0013037 | |||
| 1157 | Ga0496104_0001809 | |||
| 1158 | Ga0496104_0067297 | |||
| 1159 | Ga0496105_0001748 | |||
| 1160 | Ga0496105_0010299 | |||
| 1161 | Ga0496105_0015684 | |||
| 1162 | Ga0496105_0141815 | |||
| 1163 | Ga0496106_0019107 | |||
| 1164 | Ga0496106_0024124 | |||
| 1165 | Ga0496106_0108857 | |||
| 1166 | Ga0496106_0195296 | |||
| 1167 | Ga0496107_0007667 | |||
| 1168 | Ga0496107_0051018 | |||
| 1169 | Ga0496107_0168321 | |||
| 1170 | Ga0496107_0179271 | |||
| 1171 | Ga0496108_0005376 | |||
| 1172 | Ga0496108_0025258 | |||
| 1173 | Ga0496108_0065698 | |||
| 1174 | Ga0496108_0299002 | |||
| 1175 | Ga0496109_0000613 | |||
| 1176 | Ga0496109_0013078 | |||
| 1177 | Ga0496109_0078028 | |||
| 1178 | Ga0496109_0310916 | |||
| 1179 | Ga0496110_0000227 | |||
| 1180 | Ga0496110_0010434 | |||
| 1181 | Ga0496110_0031403 | |||
| 1182 | Ga0496110_0060744 | |||
| 1183 | Ga0496110_0176732 | |||
| 1184 | Ga0496110_0408361 | |||
| 1185 | Ga0496111_0019990 | |||
| 1186 | Ga0496111_0027506 | |||
| 1187 | Ga0496111_0047140 | |||
| 1188 | Ga0496111_0225639 | |||
| 1189 | Ga0496112_0013398 | |||
| 1190 | Ga0496112_0021015 | |||
| 1191 | Ga0496113_0010346 | |||
| 1192 | Ga0496113_0015361 | |||
| 1193 | Ga0496113_0046180 | |||
| 1194 | Ga0496114_0012648 | |||
| 1195 | Ga0496114_0015571 | |||
| 1196 | Ga0496114_0280195 | |||
| 1197 | Ga0496115_0014093 | |||
| 1198 | Ga0496115_0324180 | |||
| 1199 | Ga0501031_0005364 | |||
| 1200 | Ga0501031_0007015 | |||
| 1201 | Ga0501031_0018815 | |||
| 1202 | Ga0501032_0030221 | |||
| 1203 | Ga0501032_0050504 | |||
| 1204 | Ga0501033_0029934 | |||
| 1205 | Ga0501033_0097300 | |||
| 1206 | Ga0501036_0008841 | |||
| 1207 | Ga0501036_0073801 | |||
| 1208 | Ga0501037_0007155 | |||
| 1209 | Ga0501037_0063001 | |||
| 1210 | Ga0501038_0004352 | |||
| 1211 | Ga0501038_0029908 | |||
| 1212 | Ga0501039_0007649 | |||
| 1213 | Ga0501039_0085398 | |||
| 1214 | Ga0501040_0009636 | |||
| 1215 | Ga0501040_0030782 | |||
| 1216 | Ga0501040_0121395 | |||
| 1217 | Ga0501040_0260997 | |||
| 1218 | Ga0501041_0015393 | |||
| 1219 | Ga0501042_0128958 | |||
| 1220 | Ga0501046_0008189 | |||
| 1221 | Ga0501046_0054041 | |||
| 1222 | Ga0501046_0109881 | |||
| 1223 | Ga0501047_0023201 | |||
| 1224 | Ga0501047_0028024 | |||
| 1225 | Ga0501048_0013462 | |||
| 1226 | Ga0501048_0048234 | |||
| 1227 | Ga0501048_0135331 | |||
| 1228 | Ga0501067_0016161 | |||
| 1229 | Ga0501068_0001354 | |||
| 1230 | Ga0501068_0051552 | |||
| 1231 | Ga0501069_0171598 | |||
| 1232 | Ga0501070_0020855 | |||
| 1233 | Ga0501070_0083465 | |||
| 1234 | Ga0501070_0259672 | |||
| 1235 | Ga0501071_0003541 | |||
| 1236 | Ga0501071_0009471 | |||
| 1237 | Ga0501071_0015098 | |||
| 1238 | Ga0501071_0032762 | |||
| 1239 | Ga0501071_0166129 | |||
| 1240 | Ga0501072_0007825 | |||
| 1241 | Ga0501072_0009404 | |||
| 1242 | Ga0501072_0015793 | |||
| 1243 | Ga0501072_0017765 | |||
| 1244 | Ga0501072_0059036 | |||
| 1245 | Ga0501073_0000628 | |||
| 1246 | Ga0501073_0056903 | |||
| 1247 | Ga0501073_0149629 | |||
| 1248 | Ga0501074_0016439 | |||
| 1249 | Ga0501074_0024114 | |||
| 1250 | Ga0501074_0026160 | |||
| 1251 | Ga0501075_0004487 | |||
| 1252 | Ga0501075_0005137 | |||
| 1253 | Ga0501075_0009095 | |||
| 1254 | Ga0501075_0033610 | |||
| 1255 | Ga0501076_0016152 | |||
| 1256 | Ga0501076_0018581 | |||
| 1257 | Ga0501076_0403881 | |||
| 1258 | Ga0501077_0005536 | |||
| 1259 | Ga0501077_0085168 | |||
| 1260 | Ga0501077_0087425 | |||
| 1261 | Ga0501079_0009620 | |||
| 1262 | Ga0501079_0043082 | |||
| 1263 | Ga0501079_0084643 | |||
| 1264 | Ga0501080_0021157 | |||
| 1265 | Ga0501080_0047098 | |||
| 1266 | Ga0501080_0057448 | |||
| 1267 | Ga0501080_0177867 | |||
| 1268 | Ga0501080_0195937 | |||
| 1269 | Ga0501081_0008239 | |||
| 1270 | Ga0501081_0010371 | |||
| 1271 | Ga0501081_0011177 | |||
| 1272 | Ga0501081_0048945 | |||
| 1273 | Ga0501081_0107923 | |||
| 1274 | Ga0501083_0000739 | |||
| 1275 | Ga0501083_0005244 | |||
| 1276 | Ga0501083_0026654 | |||
| 1277 | Ga0501083_0081442 | |||
| 1278 | Ga0501083_0097001 | |||
| 1279 | Ga0501035_0069067 | |||
| 1280 | Ga0501035_0074745 | |||
| 1281 | Ga0501035_0186357 | |||
| 1282 | Ga0501035_0217616 | |||
| 1283 | Ga0501045_0001564 | |||
| 1284 | Ga0501045_0002762 | |||
| 1285 | Ga0501045_0021776 | |||
| 1286 | Ga0501045_0079954 | |||
| 1287 | Ga0501045_0088558 | |||
| 1288 | nmdc:mga00v17_6163_c1 | |||
| 1289 | nmdc:mga0yw44_68050_c1 | |||
| 1290 | nmdc:mga05p37_17104_c1 | |||
| 1291 | nmdc:mga05p37_39397_c1 | |||
| 1292 | nmdc:mga05p37_406091_c1 | |||
| 1293 | nmdc:mga05p37_64172_c1 | |||
| 1294 | nmdc:mga05p37_885_c1 | |||
| 1295 | nmdc:mga09592_6255_c1 | |||
| 1296 | nmdc:mga06r32_391070_c1 | |||
| 1297 | nmdc:mga08y16_1003_c1 | |||
| 1298 | nmdc:mga08y16_120206_c1 | |||
| 1299 | nmdc:mga08y16_27785_c1 | |||
| 1300 | nmdc:mga08y16_402075_c1 | |||
| 1301 | nmdc:mga08y16_543376_c1 | |||
| 1302 | nmdc:mga0n895_14233_c1 | |||
| 1303 | nmdc:mga0rr50_147108_c1 | |||
| 1304 | nmdc:mga0rr50_20546_c1 | |||
| 1305 | nmdc:mga0rr50_25267_c1 | |||
| 1306 | nmdc:mga0a205_107563_c1 | |||
| 1307 | nmdc:mga0a205_110063_c1 | |||
| 1308 | nmdc:mga0a205_9352_c1 | |||
| 1309 | Ga0495601_0000238 | |||
| 1310 | Ga0495601_0008450 | |||
| 1311 | Ga0495601_0037479 | |||
| 1312 | Ga0495595_0024914 | |||
| 1313 | Ga0495595_0035945 | |||
| 1314 | Ga0495619_0000200 | |||
| 1315 | Ga0495619_0015891 | |||
| 1316 | Ga0495619_0020597 | |||
| 1317 | Ga0495619_0040555 | |||
| 1318 | Ga0501084_0037442 | |||
| 1319 | Ga0501082_0019554 | |||
| 1320 | Ga0501082_0045737 | |||
| 1321 | Ga0501082_0143066 | |||
| 1322 | Ga0466962_0001269 | |||
| 1323 | Ga0530510_0187631 | |||
| 1324 | Ga0530510_0295087 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cer-assembly2.cif.gz_G | human pyruvate dehydrogenase complex e1 component v138m mutation | 0.9599 | 16 | 317 |
| 3exe-assembly2.cif.gz_E | crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex | 0.9564 | 16 | 317 |
| 3exg-assembly4.cif.gz_O | crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex | 0.9548 | 16 | 317 |
| 2ozl-assembly1.cif.gz_C | human pyruvate dehydrogenase s264e variant | 0.9545 | 16 | 324 |
| 3exg-assembly7.cif.gz_1 | crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex | 0.9545 | 16 | 317 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1N1B9_20_344_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9547 | 19 | 295 | 3.40.50.970 |
| af_B4FGJ4_23_381_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9516 | 19 | 325 | 3.40.50.970 |
| af_A4HY08_15_377_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9493 | 13 | 324 | 3.40.50.970 |
| af_Q2FY52_1_330_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.948 | 15 | 317 | 3.40.50.970 |
| af_I1KAH2_90_485_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9404 | 13 | 317 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1NQF7-F1-model_v4 | Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | 0.9798 | 23 | 317 |
GO:0004739
GO:0006086 |
| AF-A0A7V5IDR1-F1-model_v4 | Pyruvate dehydrogenase E1 component subunit alpha (EC 1.2.4.1) | 0.9787 | 16 | 299 |
GO:0004739
GO:0006086 GO:0043231 |
| AF-A0A534AF21-F1-model_v4 | Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | 0.9786 | 21 | 317 |
GO:0004739
GO:0006086 |
| AF-A0A530GFW1-F1-model_v4 | Pyruvate dehydrogenase (Acetyl-transferring) E1 component subunit alpha | 0.9785 | 21 | 124 |
GO:0004739
GO:0006086 |
| AF-A0A7J4FI09-F1-model_v4 | Dehydrogenase | 0.9781 | 16 | 317 |
GO:0006082
GO:0016624 GO:0044272 |