F473506

General Info

Members Datasets Scaffolds Average Seq Length
662 313 1324 323

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0032245|Ga0496101_0032245_1688_2725
Length 345
Sequence MSDVGSTESPRSEGTGFAGAGAGISRTGARVLDDVELYTLIYRQMLLIRGFEELVQSLFLKGEVYGTTHLYSGQEAVATGVASLLEERDRVAATYRGHGHALALGVDPQALLDEMLGRETGVNGGRAGSMNVTSPADRLIGSFGIVGGSIAAATGAALALSRTTGGVAVAYFGDGAMNQGYVFECLNFAQVQKLPLVLVCENNGYGEYTPFRSVTAGEIRSRAEVMEVPAETVDGMSVWTVREAAARAIDHARAGDGPAFVEALTYRYFGHSRSDPGAYRPEGELDEWKTRDPIVVLRAQLEEEGTGASTLDELERDVSDELERMRERGLAAPFPSTLDVGEFKD

Samples

Sample ID Description Type Environment
1 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
160 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
197 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 8.31
Rhizosphere 90.63
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496101_0032245 3300048904 Bacteria 3686
2 Ga0070658_10181782 3300005327 Bacteria 1769
3 Ga0070676_10022878 3300005328 Bacteria 3508
4 Ga0070683_100052919 3300005329 Bacteria 3762
5 Ga0070683_100074926 3300005329 Bacteria 3161
6 Ga0070683_100092440 3300005329 Bacteria 2842
7 Ga0070683_100107201 3300005329 Bacteria 2634
8 Ga0070683_100410263 3300005329 Unclassified 1292
9 Ga0070670_100025282 3300005331 Bacteria 5109
10 Ga0070670_100063240 3300005331 Bacteria 3176
11 Ga0068869_100189681 3300005334 Bacteria 1616
12 Ga0070682_100013359 3300005337 Bacteria 4722
13 Ga0068868_100057126 3300005338 Bacteria 3083
14 Ga0070660_100006183 3300005339 Bacteria 8284
15 Ga0070660_100083443 3300005339 Bacteria 2510
16 Ga0070660_100142995 3300005339 Bacteria 1920
17 Ga0070691_10120273 3300005341 Bacteria 1322
18 Ga0070661_100053041 3300005344 Bacteria 2967
19 Ga0070692_10019780 3300005345 Bacteria 3255
20 Ga0070668_100072282 3300005347 Bacteria 2688
21 Ga0070669_100011579 3300005353 Bacteria 6258
22 Ga0070675_100070588 3300005354 Bacteria 2895
23 Ga0070671_100285656 3300005355 Unclassified 1404
24 Ga0070674_100153850 3300005356 Bacteria 1738
25 Ga0070673_100256706 3300005364 Bacteria 1525
26 Ga0070659_100000071 3300005366 Bacteria 79797
27 Ga0070659_100103273 3300005366 Bacteria 2296
28 Ga0070667_100000521 3300005367 Bacteria 38631
29 Ga0070667_100018523 3300005367 Bacteria 5776
30 Ga0070709_10120623 3300005434 Bacteria 1777
31 Ga0070714_100000342 3300005435 Bacteria 35053
32 Ga0070714_100089007 3300005435 Bacteria 2702
33 Ga0070714_100388094 3300005435 Bacteria 1317
34 Ga0070713_100069530 3300005436 Bacteria 2969
35 Ga0070713_100448072 3300005436 Bacteria 1212
36 Ga0070710_10070269 3300005437 Bacteria 2016
37 Ga0070710_10200643 3300005437 Bacteria 1259
38 Ga0070711_100021417 3300005439 Bacteria 4180
39 Ga0070711_100392332 3300005439 Unclassified 1125
40 Ga0070700_100193601 3300005441 Bacteria 1423
41 Ga0070708_100033219 3300005445 Bacteria 4483
42 Ga0070708_100080435 3300005445 Bacteria 2949
43 Ga0070663_100011213 3300005455 Bacteria 5615
44 Ga0070678_100015365 3300005456 Bacteria 4864
45 Ga0070678_100015655 3300005456 Bacteria 4827
46 Ga0070662_100032079 3300005457 Bacteria 3691
47 Ga0070662_100129924 3300005457 Bacteria 1941
48 Ga0070681_10096947 3300005458 Bacteria 2896
49 Ga0070681_10231390 3300005458 Bacteria 1763
50 Ga0070685_10022590 3300005466 Bacteria 3431
51 Ga0070685_10141079 3300005466 Bacteria 1517
52 Ga0070706_100000823 3300005467 Bacteria 34270
53 Ga0070706_100057572 3300005467 Bacteria 3587
54 Ga0070707_100002811 3300005468 Bacteria 16548
55 Ga0070698_100000805 3300005471 Bacteria 34234
56 Ga0070698_100044298 3300005471 Bacteria 4558
57 Ga0070698_100120026 3300005471 Unclassified 2590
58 Ga0070679_100099050 3300005530 Bacteria 2902
59 Ga0070679_100102811 3300005530 Bacteria 2843
60 Ga0070679_100175502 3300005530 Bacteria 2115
61 Ga0070684_100032864 3300005535 Bacteria 4427
62 Ga0070684_100035945 3300005535 Bacteria 4243
63 Ga0070684_100121212 3300005535 Bacteria 2353
64 Ga0070684_100240393 3300005535 Bacteria 1654
65 Ga0070684_100252936 3300005535 Bacteria 1611
66 Ga0070684_100352787 3300005535 Bacteria 1353
67 Ga0070697_100379840 3300005536 Bacteria 1224
68 Ga0068853_100061002 3300005539 Bacteria 3261
69 Ga0068853_100307895 3300005539 Bacteria 1466
70 Ga0070672_100059327 3300005543 Bacteria 3010
71 Ga0070672_100174845 3300005543 Bacteria 1787
72 Ga0070696_100044154 3300005546 Bacteria 3086
73 Ga0070696_100072476 3300005546 Bacteria 2426
74 Ga0070693_100077116 3300005547 Bacteria 1977
75 Ga0070665_100004920 3300005548 Bacteria 13860
76 Ga0070665_100335740 3300005548 Bacteria 1516
77 Ga0070704_100071693 3300005549 Unclassified 2518
78 Ga0070704_100084762 3300005549 Bacteria 2343
79 Ga0070704_100224083 3300005549 Bacteria 1530
80 Ga0068855_100023638 3300005563 Bacteria 7360
81 Ga0068855_100110665 3300005563 Bacteria 3153
82 Ga0068855_100137556 3300005563 Bacteria 2786
83 Ga0068855_100209444 3300005563 Bacteria 2191
84 Ga0068855_100283822 3300005563 Bacteria 1837
85 Ga0070664_100206715 3300005564 Bacteria 1753
86 Ga0068857_100150700 3300005577 Bacteria 2107
87 Ga0068857_100151545 3300005577 Bacteria 2101
88 Ga0068856_100006059 3300005614 Bacteria 11883
89 Ga0068856_100114058 3300005614 Bacteria 2701
90 Ga0070702_100097959 3300005615 Unclassified 1793
91 Ga0068852_100071670 3300005616 Bacteria 3043
92 Ga0068852_100156419 3300005616 Bacteria 2124
93 Ga0068864_100273198 3300005618 Unclassified 1575
94 Ga0068866_10100059 3300005718 Bacteria 1598
95 Ga0068861_100292494 3300005719 Bacteria 1407
96 Ga0068870_10022120 3300005840 Bacteria 3121
97 Ga0068870_10028295 3300005840 Bacteria 2813
98 Ga0068863_100531790 3300005841 Bacteria 1160
99 Ga0068858_100435189 3300005842 Bacteria 1263
100 Ga0068860_100393501 3300005843 Bacteria 1370
101 Ga0068862_100000772 3300005844 Bacteria 31885
102 Ga0081455_10101779 3300005937 Bacteria 2305
103 Ga0081455_10127874 3300005937 Bacteria 1991
104 Ga0081455_10251523 3300005937 Bacteria 1292
105 Ga0081538_10026632 3300005981 Bacteria 4037
106 Ga0081540_1004204 3300005983 Bacteria 11064
107 Ga0081540_1019924 3300005983 Bacteria 4054
108 Ga0070717_10002940 3300006028 Bacteria 12103
109 Ga0070717_10016455 3300006028 Bacteria 5734
110 Ga0075365_10100543 3300006038 Bacteria 1979
111 Ga0075364_10039922 3300006051 Bacteria 3043
112 Ga0075432_10001987 3300006058 Bacteria 6795
113 Ga0070715_10085318 3300006163 Bacteria 1442
114 Ga0070712_100199675 3300006175 Bacteria 1570
115 Ga0097621_100028225 3300006237 Bacteria 4422
116 Ga0075370_10032801 3300006353 Bacteria 2905
117 Ga0068871_100363214 3300006358 Bacteria 1283
118 Ga0075428_100000211 3300006844 Bacteria 56062
119 Ga0075428_100101291 3300006844 Bacteria 3140
120 Ga0075433_10012759 3300006852 Bacteria 6803
121 Ga0075433_10169894 3300006852 Bacteria 1940
122 Ga0075434_100043521 3300006871 Bacteria 4454
123 Ga0075434_100071241 3300006871 Bacteria 3467
124 Ga0075429_100005341 3300006880 Bacteria 11052
125 Ga0068865_100015100 3300006881 Bacteria 4920
126 Ga0068865_100312832 3300006881 Bacteria 1261
127 Ga0075436_100006476 3300006914 Bacteria 8021
128 Ga0075435_100155573 3300007076 Bacteria 1923
129 Ga0105240_10160060 3300009093 Bacteria 2675
130 Ga0105240_10586883 3300009093 Bacteria 1229
131 Ga0111539_10003281 3300009094 Bacteria 21391
132 Ga0111539_10103504 3300009094 Bacteria 3341
133 Ga0111539_10169415 3300009094 Bacteria 2552
134 Ga0111539_10195746 3300009094 Bacteria 2358
135 Ga0111539_10701644 3300009094 Bacteria 1178
136 Ga0105245_10001672 3300009098 Bacteria 20188
137 Ga0105245_10023674 3300009098 Bacteria 5391
138 Ga0105245_10208538 3300009098 Bacteria 1880
139 Ga0105247_10124185 3300009101 Bacteria 1676
140 Ga0114129_10002058 3300009147 Bacteria 27627
141 Ga0114129_10011553 3300009147 Bacteria 12574
142 Ga0114129_10227574 3300009147 Bacteria 2512
143 Ga0114129_10260844 3300009147 Bacteria 2323
144 Ga0114129_10448329 3300009147 Bacteria 1693
145 Ga0105243_10119698 3300009148 Bacteria 2218
146 Ga0105243_10277364 3300009148 Bacteria 1508
147 Ga0105242_10018143 3300009176 Bacteria 5497
148 Ga0105242_10101880 3300009176 Unclassified 2434
149 Ga0105242_10176057 3300009176 Unclassified 1884
150 Ga0105242_10227184 3300009176 Bacteria 1671
151 Ga0105248_10304657 3300009177 Bacteria 1794
152 Ga0105237_10101507 3300009545 Bacteria 2869
153 Ga0105237_10415324 3300009545 Bacteria 1351
154 Ga0105238_10010169 3300009551 Bacteria 9437
155 Ga0105238_10046758 3300009551 Bacteria 4365
156 Ga0105238_10275082 3300009551 Bacteria 1664
157 Ga0105249_10010169 3300009553 Bacteria 8262
158 Ga0105249_10156441 3300009553 Bacteria 2199
159 Ga0105239_10054676 3300010375 Bacteria 4379
160 Ga0105239_10228885 3300010375 Bacteria 2086
161 Ga0105239_10584398 3300010375 Bacteria 1273
162 Ga0105246_10015910 3300011119 Bacteria 4757
163 Ga0105246_10042671 3300011119 Bacteria 3072
164 Ga0105246_10073261 3300011119 Bacteria 2417
165 Ga0157370_10026174 3300013104 Bacteria 5762
166 Ga0157370_10033161 3300013104 Bacteria 5035
167 Ga0157370_10054870 3300013104 Bacteria 3798
168 Ga0157369_10022942 3300013105 Bacteria 6960
169 Ga0157369_10221769 3300013105 Bacteria 1979
170 Ga0157374_10076623 3300013296 Bacteria 3162
171 Ga0157378_10346514 3300013297 Bacteria 1450
172 Ga0163162_10606949 3300013306 Bacteria 1220
173 Ga0157372_10072238 3300013307 Bacteria 3888
174 Ga0157372_10119470 3300013307 Bacteria 3026
175 Ga0157372_10358312 3300013307 Bacteria 1699
176 Ga0157372_10488001 3300013307 Bacteria 1436
177 Ga0157375_10059076 3300013308 Bacteria 3797
178 Ga0157375_10344250 3300013308 Bacteria 1656
179 Ga0157375_10594092 3300013308 Bacteria 1267
180 Ga0163163_10039202 3300014325 Bacteria 4622
181 Ga0182008_10015027 3300014497 Bacteria 4047
182 Ga0182008_10087434 3300014497 Bacteria 1535
183 Ga0182008_10189682 3300014497 Bacteria 1043
184 Ga0157377_10006166 3300014745 Bacteria 5697
185 Ga0157379_10254688 3300014968 Bacteria 1594
186 Ga0157376_10523823 3300014969 Unclassified 1169
187 Ga0163161_10168797 3300017792 Bacteria 1672
188 Ga0206356_10221095 3300020070 Unclassified 2062
189 Ga0206356_10397882 3300020070 Bacteria 1720
190 Ga0206353_10556283 3300020082 Bacteria 4449
191 Ga0206353_10581081 3300020082 Bacteria 2175
192 Ga0207692_10009347 3300025898 Bacteria 4090
193 Ga0207642_10042592 3300025899 Unclassified 1997
194 Ga0207688_10009635 3300025901 Bacteria 5260
195 Ga0207685_10006858 3300025905 Bacteria 3134
196 Ga0207643_10003002 3300025908 Bacteria 9098
197 Ga0207643_10029234 3300025908 Bacteria 3065
198 Ga0207643_10080409 3300025908 Bacteria 1888
199 Ga0207705_10016247 3300025909 Bacteria 5337
200 Ga0207684_10000008 3300025910 Bacteria 601602
201 Ga0207684_10071765 3300025910 Bacteria 2941
202 Ga0207707_10143212 3300025912 Bacteria 2089
203 Ga0207707_10173526 3300025912 Bacteria 1884
204 Ga0207671_10022752 3300025914 Bacteria 4736
205 Ga0207693_10000919 3300025915 Bacteria 26430
206 Ga0207663_10116131 3300025916 Bacteria 1824
207 Ga0207663_10313550 3300025916 Unclassified 1176
208 Ga0207660_10017196 3300025917 Bacteria 4799
209 Ga0207660_10032251 3300025917 Bacteria 3615
210 Ga0207657_10005718 3300025919 Bacteria 12973
211 Ga0207657_10008090 3300025919 Bacteria 10721
212 Ga0207657_10044056 3300025919 Bacteria 3925
213 Ga0207657_10054299 3300025919 Bacteria 3465
214 Ga0207649_10006826 3300025920 Bacteria 6203
215 Ga0207652_10202468 3300025921 Bacteria 1787
216 Ga0207652_10279687 3300025921 Bacteria 1505
217 Ga0207646_10000763 3300025922 Bacteria 41723
218 Ga0207681_10008373 3300025923 Bacteria 6324
219 Ga0207694_10140519 3300025924 Bacteria 1942
220 Ga0207650_10016445 3300025925 Bacteria 5171
221 Ga0207650_10088839 3300025925 Bacteria 2357
222 Ga0207659_10052897 3300025926 Bacteria 2895
223 Ga0207659_10237639 3300025926 Unclassified 1472
224 Ga0207687_10019191 3300025927 Bacteria 4527
225 Ga0207687_10066899 3300025927 Bacteria 2555
226 Ga0207687_10125728 3300025927 Bacteria 1925
227 Ga0207687_10276304 3300025927 Bacteria 1345
228 Ga0207700_10092550 3300025928 Bacteria 2390
229 Ga0207700_10278790 3300025928 Bacteria 1437
230 Ga0207700_10305522 3300025928 Bacteria 1375
231 Ga0207664_10000617 3300025929 Bacteria 24668
232 Ga0207664_10014782 3300025929 Bacteria 5650
233 Ga0207664_10038374 3300025929 Bacteria 3714
234 Ga0207664_10085867 3300025929 Bacteria 2569
235 Ga0207690_10000188 3300025932 Bacteria 47744
236 Ga0207690_10021370 3300025932 Bacteria 4013
237 Ga0207690_10048138 3300025932 Bacteria 2833
238 Ga0207706_10018226 3300025933 Bacteria 6316
239 Ga0207706_10061523 3300025933 Bacteria 3306
240 Ga0207686_10110530 3300025934 Bacteria 1853
241 Ga0207709_10192918 3300025935 Bacteria 1448
242 Ga0207709_10240395 3300025935 Bacteria 1317
243 Ga0207669_10018564 3300025937 Bacteria 3599
244 Ga0207669_10044410 3300025937 Bacteria 2610
245 Ga0207669_10298135 3300025937 Bacteria 1224
246 Ga0207704_10043766 3300025938 Bacteria 2647
247 Ga0207704_10145281 3300025938 Bacteria 1665
248 Ga0207704_10151300 3300025938 Unclassified 1638
249 Ga0207665_10000603 3300025939 Bacteria 24124
250 Ga0207691_10039180 3300025940 Bacteria 4384
251 Ga0207691_10266120 3300025940 Bacteria 1477
252 Ga0207689_10054974 3300025942 Bacteria 3277
253 Ga0207661_10000463 3300025944 Bacteria 26200
254 Ga0207661_10124436 3300025944 Unclassified 2200
255 Ga0207661_10206626 3300025944 Unclassified 1729
256 Ga0207661_10247820 3300025944 Bacteria 1582
257 Ga0207667_10113428 3300025949 Bacteria 2794
258 Ga0207667_10172599 3300025949 Bacteria 2222
259 Ga0207667_10217722 3300025949 Bacteria 1956
260 Ga0207712_10002284 3300025961 Bacteria 12449
261 Ga0207668_10126321 3300025972 Bacteria 1945
262 Ga0207640_10202294 3300025981 Bacteria 1506
263 Ga0207640_10278195 3300025981 Bacteria 1313
264 Ga0207658_10002483 3300025986 Bacteria 13439
265 Ga0207658_10004120 3300025986 Bacteria 10138
266 Ga0207677_10126729 3300026023 Bacteria 1931
267 Ga0207677_10247999 3300026023 Bacteria 1444
268 Ga0207677_10268469 3300026023 Bacteria 1394
269 Ga0207703_10016991 3300026035 Bacteria 5674
270 Ga0207639_10157039 3300026041 Bacteria 1912
271 Ga0207639_10270405 3300026041 Bacteria 1490
272 Ga0207678_10008989 3300026067 Bacteria 8792
273 Ga0207708_10021885 3300026075 Bacteria 4824
274 Ga0207708_10052203 3300026075 Bacteria 3114
275 Ga0207702_10028487 3300026078 Bacteria 4643
276 Ga0207702_10154015 3300026078 Bacteria 2094
277 Ga0207702_10320031 3300026078 Bacteria 1477
278 Ga0207648_10043497 3300026089 Bacteria 3942
279 Ga0207674_10028849 3300026116 Bacteria 5850
280 Ga0207674_10324096 3300026116 Bacteria 1490
281 Ga0207675_100001496 3300026118 Bacteria 23416
282 Ga0207683_10002515 3300026121 Bacteria 16003
283 Ga0207683_10060153 3300026121 Bacteria 3339
284 Ga0207683_10293028 3300026121 Bacteria 1488
285 Ga0209813_10063924 3300027866 Bacteria 1181
286 Ga0207428_10000315 3300027907 Bacteria 63531
287 Ga0207428_10070484 3300027907 Bacteria 2747
288 Ga0268266_10047771 3300028379 Bacteria 3668
289 Ga0268265_10000736 3300028380 Bacteria 31918
290 Ga0268264_10132049 3300028381 Bacteria 2215
291 Ga0265319_1009539 3300028563 Bacteria 4126
292 Ga0265322_10028651 3300028654 Bacteria 1591
293 Ga0265338_10015737 3300028800 Bacteria 8285
294 Ga0265338_10042393 3300028800 Bacteria 4239
295 Ga0265339_10007410 3300031249 Bacteria 7094
296 Ga0265316_10020436 3300031344 Bacteria 5634
297 Ga0265313_10026781 3300031595 Bacteria 3030
298 Ga0265314_10006777 3300031711 Bacteria 10049
299 Ga0265342_10031976 3300031712 Bacteria 3248
300 Ga0307407_10148648 3300031903 Bacteria 1520
301 Ga0307409_100309189 3300031995 Bacteria 1474
302 Ga0307416_100420378 3300032002 Bacteria 1381
303 Ga0307415_100046294 3300032126 Bacteria 2921
304 Ga0307415_100175914 3300032126 Bacteria 1674
305 Ga0373934_0042171 3300035086 Bacteria 1802
306 Ga0373944_0012216 3300035089 Bacteria 2364
307 Ga0373923_0053976 3300035111 Bacteria 1691
308 Ga0373932_0039895 3300035112 Bacteria 1349
309 Ga0373936_0015399 3300035113 Unclassified 2931
310 Ga0373939_0048414 3300035114 Bacteria 1310
311 Ga0373956_0017042 3300035119 Bacteria 3058
312 Ga0373943_0001514 3300035170 Bacteria 10514
313 Ga0373946_0000684 3300035171 Bacteria 11397
314 Ga0373955_0142115 3300035172 Bacteria 1408
315 Ga0373942_0007075 3300035207 Bacteria 2595
316 Ga0373961_0047784 3300035241 Bacteria 1259
317 Ga0373931_0027133 3300035691 Bacteria 2920
318 Ga0373935_0035974 3300035692 Bacteria 3093
319 Ga0373927_0006434 3300035695 Bacteria 8004
320 Ga0373947_0001551 3300035725 Bacteria 14082
321 Ga0373947_0049242 3300035725 Bacteria 2529
322 Ga0373937_0001462 3300036401 Bacteria 19776
323 Ga0373937_0013260 3300036401 Bacteria 7259
324 Ga0373937_0143624 3300036401 Bacteria 2233
325 Ga0373925_0016109 3300037068 Bacteria 5413
326 Ga0373925_0050590 3300037068 Unclassified 3099
327 Ga0395899_0023938 3300037312 Bacteria 4620
328 Ga0395899_0140247 3300037312 Bacteria 1720
329 Ga0395900_0052762 3300037418 Bacteria 4185
330 Ga0395900_0151455 3300037418 Unclassified 2369
331 Ga0395900_0345941 3300037418 Bacteria 1461
332 Ga0395900_0421275 3300037418 Bacteria 1296
333 Ga0395898_0027962 3300037466 Bacteria 5655
334 Ga0395898_0056257 3300037466 Bacteria 3835
335 Ga0395898_0087418 3300037466 Bacteria 3002
336 Ga0395898_0088670 3300037466 Bacteria 2978
337 Ga0395898_0207892 3300037466 Bacteria 1868
338 Ga0395905_0048403 3300037471 Bacteria 3984
339 Ga0395905_0056453 3300037471 Bacteria 3673
340 Ga0395905_0235523 3300037471 Bacteria 1711
341 Ga0395901_0009918 3300038443 Bacteria 9655
342 Ga0395901_0047081 3300038443 Bacteria 4478
343 Ga0395901_0069625 3300038443 Bacteria 3664
344 Ga0395901_0127304 3300038443 Bacteria 2676
345 Ga0395901_0180943 3300038443 Bacteria 2211
346 Ga0395901_0182516 3300038443 Bacteria 2201
347 Ga0395901_0280089 3300038443 Bacteria 1732
348 Ga0436365_1220139 3300039437 Bacteria 17807
349 Ga0439448_0030166 3300042005 Bacteria 1719
350 Ga0450920_001235 3300042122 Bacteria 4198
351 Ga0439458_0005864 3300042157 Bacteria 2752
352 Ga0466969_0004436 3300044656 Bacteria 7463
353 Ga0466961_0009894 3300044693 Bacteria 6077
354 Ga0466961_0017102 3300044693 Bacteria 4657
355 Ga0466961_0046450 3300044693 Bacteria 2777
356 Ga0466963_0000205 3300044694 Bacteria 25099
357 Ga0466963_0004431 3300044694 Bacteria 8159
358 Ga0466963_0064968 3300044694 Bacteria 2446
359 Ga0466963_0065471 3300044694 Bacteria 2437
360 Ga0466963_0073009 3300044694 Bacteria 2312
361 Ga0466963_0192045 3300044694 Bacteria 1427
362 Ga0466964_0002840 3300044706 Bacteria 6244
363 Ga0466964_0025065 3300044706 Bacteria 2328
364 Ga0466971_0002531 3300044719 Bacteria 7726
365 Ga0466971_0010508 3300044719 Bacteria 4047
366 Ga0466968_0017563 3300044735 Bacteria 2861
367 Ga0466957_0000280 3300044842 Bacteria 24823
368 Ga0451576_0039636 3300045051 Bacteria 4986
369 Ga0466967_0003679 3300045976 Bacteria 10093
370 Ga0466967_0004529 3300045976 Bacteria 9400
371 Ga0466967_0005081 3300045976 Bacteria 9031
372 Ga0466967_0016123 3300045976 Bacteria 5881
373 Ga0466967_0028944 3300045976 Bacteria 4631
374 Ga0466967_0051112 3300045976 Bacteria 3621
375 Ga0466967_0104251 3300045976 Bacteria 2596
376 Ga0466967_0119679 3300045976 Bacteria 2431
377 Ga0466967_0121901 3300045976 Bacteria 2410
378 Ga0466967_0253316 3300045976 Bacteria 1682
379 Ga0466967_0281866 3300045976 Bacteria 1595
380 Ga0466967_0325252 3300045976 Bacteria 1484
381 Ga0466967_0326837 3300045976 Bacteria 1480
382 Ga0466967_0337819 3300045976 Bacteria 1456
383 Ga0495592_0000207 3300046454 Bacteria 50220
384 Ga0495603_0000445 3300046455 Bacteria 22677
385 Ga0495603_0043771 3300046455 Bacteria 2672
386 Ga0495603_0052970 3300046455 Bacteria 2408
387 Ga0495603_0157149 3300046455 Bacteria 1319
388 Ga0495629_0003295 3300046459 Bacteria 12198
389 Ga0495629_0014228 3300046459 Bacteria 5730
390 Ga0495638_0013119 3300046460 Bacteria 5657
391 Ga0495641_0052952 3300046461 Bacteria 1848
392 Ga0495641_0084546 3300046461 Bacteria 1421
393 Ga0495651_0000106 3300046462 Bacteria 61363
394 Ga0495651_0141969 3300046462 Unclassified 1740
395 Ga0495653_0000290 3300046463 Bacteria 40612
396 Ga0495653_0008918 3300046463 Bacteria 8201
397 Ga0495582_0000516 3300046473 Bacteria 21253
398 Ga0495582_0007912 3300046473 Bacteria 5875
399 Ga0495582_0059933 3300046473 Bacteria 2100
400 Ga0495582_0059973 3300046473 Bacteria 2099
401 Ga0495639_0001552 3300046475 Bacteria 10257
402 Ga0495639_0087559 3300046475 Bacteria 1458
403 Ga0495662_0013779 3300046476 Bacteria 3936
404 Ga0495662_0084873 3300046476 Bacteria 1542
405 Ga0495664_0014036 3300046477 Bacteria 4539
406 Ga0495584_0048069 3300046491 Bacteria 2152
407 Ga0495594_0107374 3300046499 Bacteria 1572
408 Ga0495596_0031975 3300046500 Bacteria 2100
409 Ga0495608_0001216 3300046511 Bacteria 18231
410 Ga0495608_0099334 3300046511 Unclassified 1877
411 Ga0495618_0000561 3300046514 Bacteria 26461
412 Ga0495618_0017961 3300046514 Bacteria 4340
413 Ga0495618_0118676 3300046514 Bacteria 1694
414 Ga0495628_0000185 3300046516 Bacteria 54717
415 Ga0495630_0022437 3300046517 Bacteria 4661
416 Ga0495630_0086588 3300046517 Bacteria 2366
417 Ga0495630_0186036 3300046517 Unclassified 1584
418 Ga0495652_0000466 3300046529 Bacteria 47387
419 Ga0495652_0050989 3300046529 Bacteria 3536
420 Ga0495652_0222935 3300046529 Bacteria 1416
421 Ga0495665_0000240 3300046531 Bacteria 27586
422 Ga0495586_0076559 3300046535 Bacteria 1833
423 Ga0495587_0000537 3300046536 Bacteria 26275
424 Ga0495587_0048521 3300046536 Unclassified 2514
425 Ga0495645_0000115 3300046543 Bacteria 54956
426 Ga0495667_0011033 3300046559 Bacteria 6109
427 Ga0495667_0041285 3300046559 Bacteria 3060
428 Ga0495667_0041925 3300046559 Unclassified 3034
429 Ga0495634_0023328 3300046642 Bacteria 4351
430 Ga0495634_0028372 3300046642 Bacteria 3885
431 Ga0495634_0033135 3300046642 Bacteria 3551
432 Ga0495634_0159985 3300046642 Unclassified 1420
433 Ga0495635_0016636 3300046663 Bacteria 5138
434 Ga0495635_0094057 3300046663 Unclassified 2049
435 Ga0495588_0004083 3300046674 Bacteria 6425
436 Ga0495657_0010467 3300046675 Bacteria 6978
437 Ga0495657_0029004 3300046675 Bacteria 3884
438 Ga0495657_0050638 3300046675 Bacteria 2792
439 Ga0495599_0000135 3300046678 Bacteria 47515
440 Ga0495599_0082408 3300046678 Unclassified 2009
441 Ga0495623_0000350 3300046679 Bacteria 30436
442 Ga0495623_0065819 3300046679 Unclassified 2265
443 Ga0495646_0000351 3300046680 Bacteria 23709
444 Ga0495647_0008629 3300046681 Unclassified 3429
445 Ga0495647_0029843 3300046681 Bacteria 2019
446 Ga0495658_0000691 3300046683 Bacteria 18249
447 Ga0495658_0049340 3300046683 Bacteria 2377
448 Ga0495613_0011438 3300046689 Bacteria 6597
449 Ga0495613_0029805 3300046689 Bacteria 4056
450 Ga0495613_0072645 3300046689 Bacteria 2508
451 Ga0495613_0114778 3300046689 Bacteria 1938
452 Ga0495624_0008806 3300046690 Bacteria 7016
453 Ga0495600_0006098 3300046809 Bacteria 7302
454 Ga0495600_0018844 3300046809 Bacteria 4403
455 Ga0495600_0090125 3300046809 Bacteria 2000
456 Ga0495581_0000481 3300047315 Bacteria 20285
457 Ga0495581_0197045 3300047315 Bacteria 1178
458 Ga0495604_0000060 3300047317 Bacteria 95444
459 Ga0495604_0031932 3300047317 Bacteria 4175
460 Ga0495674_0015172 3300047319 Bacteria 7206
461 Ga0495674_0022505 3300047319 Bacteria 5814
462 Ga0495674_0027758 3300047319 Bacteria 5168
463 Ga0495674_0053092 3300047319 Bacteria 3565
464 Ga0495674_0076611 3300047319 Bacteria 2876
465 Ga0495674_0148938 3300047319 Bacteria 1963
466 Ga0495676_0000654 3300047321 Bacteria 28845
467 Ga0495676_0010451 3300047321 Bacteria 8416
468 Ga0495676_0018380 3300047321 Bacteria 6162
469 Ga0495680_0002435 3300047322 Bacteria 19040
470 Ga0495680_0003818 3300047322 Bacteria 14626
471 Ga0495680_0014000 3300047322 Bacteria 6973
472 Ga0495680_0024176 3300047322 Bacteria 5042
473 Ga0495680_0035391 3300047322 Bacteria 4022
474 Ga0495675_0000223 3300047444 Bacteria 41211
475 Ga0495675_0027064 3300047444 Bacteria 3655
476 Ga0495684_0011766 3300047471 Bacteria 6754
477 Ga0495684_0014714 3300047471 Bacteria 6023
478 Ga0495684_0022572 3300047471 Bacteria 4839
479 Ga0495593_0011508 3300047673 Bacteria 5079
480 Ga0495602_0000197 3300048088 Bacteria 56557
481 Ga0495602_0302952 3300048088 Bacteria 1169
482 Ga0495614_0035273 3300048089 Unclassified 2149
483 Ga0496100_0073543 3300048903 Bacteria 2288
484 Ga0496100_0165700 3300048903 Bacteria 1587
485 Ga0496101_0052217 3300048904 Bacteria 2947
486 Ga0496101_0052593 3300048904 Bacteria 2937
487 Ga0496101_0069443 3300048904 Bacteria 2578
488 Ga0496101_0161313 3300048904 Bacteria 1719
489 Ga0496101_0198706 3300048904 Bacteria 1549
490 Ga0496101_0417252 3300048904 Bacteria 1058
491 Ga0496102_0007328 3300048905 Bacteria 9419
492 Ga0496102_0035871 3300048905 Bacteria 4466
493 Ga0496102_0221979 3300048905 Bacteria 1782
494 Ga0496103_0013037 3300048906 Bacteria 4928
495 Ga0496104_0001809 3300048907 Bacteria 18537
496 Ga0496104_0067297 3300048907 Bacteria 3402
497 Ga0496105_0001748 3300048908 Bacteria 15536
498 Ga0496105_0010299 3300048908 Bacteria 7349
499 Ga0496105_0015684 3300048908 Bacteria 6045
500 Ga0496105_0141815 3300048908 Bacteria 1978
501 Ga0496106_0019107 3300048909 Bacteria 5079
502 Ga0496106_0024124 3300048909 Bacteria 4521
503 Ga0496106_0108857 3300048909 Bacteria 2155
504 Ga0496106_0195296 3300048909 Bacteria 1610
505 Ga0496107_0007667 3300048910 Bacteria 7452
506 Ga0496107_0051018 3300048910 Bacteria 2983
507 Ga0496107_0168321 3300048910 Bacteria 1625
508 Ga0496107_0179271 3300048910 Bacteria 1573
509 Ga0496108_0005376 3300048911 Bacteria 10353
510 Ga0496108_0025258 3300048911 Bacteria 4895
511 Ga0496108_0065698 3300048911 Bacteria 3058
512 Ga0496108_0299002 3300048911 Bacteria 1402
513 Ga0496109_0000613 3300048912 Bacteria 29798
514 Ga0496109_0013078 3300048912 Bacteria 7179
515 Ga0496109_0078028 3300048912 Bacteria 3049
516 Ga0496109_0310916 3300048912 Bacteria 1487
517 Ga0496110_0000227 3300048913 Bacteria 36597
518 Ga0496110_0010434 3300048913 Bacteria 7554
519 Ga0496110_0031403 3300048913 Bacteria 4583
520 Ga0496110_0060744 3300048913 Bacteria 3334
521 Ga0496110_0176732 3300048913 Unclassified 1938
522 Ga0496110_0408361 3300048913 Bacteria 1238
523 Ga0496111_0019990 3300048914 Bacteria 4658
524 Ga0496111_0027506 3300048914 Bacteria 4023
525 Ga0496111_0047140 3300048914 Bacteria 3103
526 Ga0496111_0225639 3300048914 Bacteria 1391
527 Ga0496112_0013398 3300048915 Bacteria 7568
528 Ga0496112_0021015 3300048915 Bacteria 6200
529 Ga0496113_0010346 3300048916 Bacteria 6162
530 Ga0496113_0015361 3300048916 Bacteria 5260
531 Ga0496113_0046180 3300048916 Bacteria 3233
532 Ga0496114_0012648 3300048917 Bacteria 6760
533 Ga0496114_0015571 3300048917 Bacteria 6114
534 Ga0496114_0280195 3300048917 Bacteria 1470
535 Ga0496115_0014093 3300048918 Bacteria 6053
536 Ga0496115_0324180 3300048918 Bacteria 1259
537 Ga0501031_0005364 3300049568 Bacteria 8347
538 Ga0501031_0007015 3300049568 Bacteria 7354
539 Ga0501031_0018815 3300049568 Bacteria 4497
540 Ga0501032_0030221 3300049569 Bacteria 3717
541 Ga0501032_0050504 3300049569 Bacteria 2805
542 Ga0501033_0029934 3300049570 Bacteria 4092
543 Ga0501033_0097300 3300049570 Bacteria 2150
544 Ga0501036_0008841 3300049572 Bacteria 8269
545 Ga0501036_0073801 3300049572 Bacteria 2884
546 Ga0501037_0007155 3300049573 Bacteria 8156
547 Ga0501037_0063001 3300049573 Bacteria 2703
548 Ga0501038_0004352 3300049574 Bacteria 13177
549 Ga0501038_0029908 3300049574 Bacteria 4824
550 Ga0501039_0007649 3300049575 Bacteria 8249
551 Ga0501039_0085398 3300049575 Bacteria 2458
552 Ga0501040_0009636 3300049576 Bacteria 6304
553 Ga0501040_0030782 3300049576 Bacteria 3626
554 Ga0501040_0121395 3300049576 Bacteria 1833
555 Ga0501040_0260997 3300049576 Bacteria 1236
556 Ga0501041_0015393 3300049577 Bacteria 4541
557 Ga0501042_0128958 3300049578 Bacteria 1822
558 Ga0501046_0008189 3300049580 Bacteria 9132
559 Ga0501046_0054041 3300049580 Bacteria 3161
560 Ga0501046_0109881 3300049580 Bacteria 2107
561 Ga0501047_0023201 3300049581 Bacteria 5958
562 Ga0501047_0028024 3300049581 Bacteria 5428
563 Ga0501048_0013462 3300049582 Bacteria 6070
564 Ga0501048_0048234 3300049582 Bacteria 3038
565 Ga0501048_0135331 3300049582 Bacteria 1741
566 Ga0501067_0016161 3300049583 Bacteria 4126
567 Ga0501068_0001354 3300049584 Bacteria 12993
568 Ga0501068_0051552 3300049584 Bacteria 2489
569 Ga0501069_0171598 3300049585 Bacteria 1251
570 Ga0501070_0020855 3300049586 Bacteria 5497
571 Ga0501070_0083465 3300049586 Bacteria 2645
572 Ga0501070_0259672 3300049586 Bacteria 1420
573 Ga0501071_0003541 3300049587 Bacteria 9770
574 Ga0501071_0009471 3300049587 Bacteria 6489
575 Ga0501071_0015098 3300049587 Bacteria 5296
576 Ga0501071_0032762 3300049587 Bacteria 3691
577 Ga0501071_0166129 3300049587 Bacteria 1651
578 Ga0501072_0007825 3300049588 Bacteria 8116
579 Ga0501072_0009404 3300049588 Bacteria 7433
580 Ga0501072_0015793 3300049588 Bacteria 5788
581 Ga0501072_0017765 3300049588 Bacteria 5469
582 Ga0501072_0059036 3300049588 Bacteria 3024
583 Ga0501073_0000628 3300049589 Bacteria 24828
584 Ga0501073_0056903 3300049589 Bacteria 2734
585 Ga0501073_0149629 3300049589 Bacteria 1618
586 Ga0501074_0016439 3300049590 Bacteria 5372
587 Ga0501074_0024114 3300049590 Bacteria 4421
588 Ga0501074_0026160 3300049590 Bacteria 4231
589 Ga0501075_0004487 3300049591 Bacteria 9454
590 Ga0501075_0005137 3300049591 Bacteria 8950
591 Ga0501075_0009095 3300049591 Bacteria 6939
592 Ga0501075_0033610 3300049591 Bacteria 3815
593 Ga0501076_0016152 3300049592 Bacteria 5652
594 Ga0501076_0018581 3300049592 Bacteria 5302
595 Ga0501076_0403881 3300049592 Bacteria 1123
596 Ga0501077_0005536 3300049593 Bacteria 7687
597 Ga0501077_0085168 3300049593 Bacteria 2003
598 Ga0501077_0087425 3300049593 Bacteria 1975
599 Ga0501079_0009620 3300049741 Bacteria 7331
600 Ga0501079_0043082 3300049741 Bacteria 3483
601 Ga0501079_0084643 3300049741 Bacteria 2453
602 Ga0501080_0021157 3300049742 Bacteria 6020
603 Ga0501080_0047098 3300049742 Bacteria 4013
604 Ga0501080_0057448 3300049742 Bacteria 3623
605 Ga0501080_0177867 3300049742 Bacteria 1959
606 Ga0501080_0195937 3300049742 Bacteria 1855
607 Ga0501081_0008239 3300049743 Bacteria 6766
608 Ga0501081_0010371 3300049743 Bacteria 6078
609 Ga0501081_0011177 3300049743 Bacteria 5871
610 Ga0501081_0048945 3300049743 Bacteria 2909
611 Ga0501081_0107923 3300049743 Bacteria 1974
612 Ga0501083_0000739 3300049744 Bacteria 21326
613 Ga0501083_0005244 3300049744 Bacteria 9166
614 Ga0501083_0026654 3300049744 Bacteria 3993
615 Ga0501083_0081442 3300049744 Bacteria 2146
616 Ga0501083_0097001 3300049744 Bacteria 1945
617 Ga0501035_0069067 3300049822 Bacteria 3132
618 Ga0501035_0074745 3300049822 Bacteria 2997
619 Ga0501035_0186357 3300049822 Bacteria 1786
620 Ga0501035_0217616 3300049822 Bacteria 1632
621 Ga0501045_0001564 3300049824 Bacteria 15240
622 Ga0501045_0002762 3300049824 Bacteria 11982
623 Ga0501045_0021776 3300049824 Bacteria 4588
624 Ga0501045_0079954 3300049824 Bacteria 2410
625 Ga0501045_0088558 3300049824 Bacteria 2286
626 nmdc:mga00v17_6163_c1 3300050491 Bacteria 2665
627 nmdc:mga0yw44_68050_c1 3300050492 Bacteria 2202
628 nmdc:mga05p37_17104_c1 3300050507 Bacteria 8748
629 nmdc:mga05p37_39397_c1 3300050507 Bacteria 5802
630 nmdc:mga05p37_406091_c1 3300050507 Bacteria 1589
631 nmdc:mga05p37_64172_c1 3300050507 Bacteria 4519
632 nmdc:mga05p37_885_c1 3300050507 Bacteria 33780
633 nmdc:mga09592_6255_c1 3300050508 Bacteria 9696
634 nmdc:mga06r32_391070_c1 3300050510 Bacteria 1373
635 nmdc:mga08y16_1003_c1 3300050511 Bacteria 27574
636 nmdc:mga08y16_120206_c1 3300050511 Bacteria 2734
637 nmdc:mga08y16_27785_c1 3300050511 Bacteria 5962
638 nmdc:mga08y16_402075_c1 3300050511 Bacteria 1401
639 nmdc:mga08y16_543376_c1 3300050511 Bacteria 1177
640 nmdc:mga0n895_14233_c1 3300050512 Bacteria 7216
641 nmdc:mga0rr50_147108_c1 3300050513 Bacteria 1901
642 nmdc:mga0rr50_20546_c1 3300050513 Bacteria 4489
643 nmdc:mga0rr50_25267_c1 3300050513 Bacteria 4127
644 nmdc:mga0a205_107563_c1 3300050515 Bacteria 2687
645 nmdc:mga0a205_110063_c1 3300050515 Bacteria 2653
646 nmdc:mga0a205_9352_c1 3300050515 Bacteria 8955
647 Ga0495601_0000238 3300053077 Bacteria 29363
648 Ga0495601_0008450 3300053077 Bacteria 6081
649 Ga0495601_0037479 3300053077 Bacteria 3031
650 Ga0495595_0024914 3300053084 Unclassified 2645
651 Ga0495595_0035945 3300053084 Bacteria 2246
652 Ga0495619_0000200 3300053085 Bacteria 43823
653 Ga0495619_0015891 3300053085 Bacteria 4766
654 Ga0495619_0020597 3300053085 Bacteria 4203
655 Ga0495619_0040555 3300053085 Bacteria 3044
656 Ga0501084_0037442 3300054114 Bacteria 4052
657 Ga0501082_0019554 3300060353 Bacteria 5840
658 Ga0501082_0045737 3300060353 Bacteria 3774
659 Ga0501082_0143066 3300060353 Bacteria 2075
660 Ga0466962_0001269 3300061719 Bacteria 11653
661 Ga0530510_0187631 3300061734 Bacteria 1534
662 Ga0530510_0295087 3300061734 Bacteria 1212
663 Ga0496101_0032245
664 Ga0070658_10181782
665 Ga0070676_10022878
666 Ga0070683_100052919
667 Ga0070683_100074926
668 Ga0070683_100092440
669 Ga0070683_100107201
670 Ga0070683_100410263
671 Ga0070670_100025282
672 Ga0070670_100063240
673 Ga0068869_100189681
674 Ga0070682_100013359
675 Ga0068868_100057126
676 Ga0070660_100006183
677 Ga0070660_100083443
678 Ga0070660_100142995
679 Ga0070691_10120273
680 Ga0070661_100053041
681 Ga0070692_10019780
682 Ga0070668_100072282
683 Ga0070669_100011579
684 Ga0070675_100070588
685 Ga0070671_100285656
686 Ga0070674_100153850
687 Ga0070673_100256706
688 Ga0070659_100000071
689 Ga0070659_100103273
690 Ga0070667_100000521
691 Ga0070667_100018523
692 Ga0070709_10120623
693 Ga0070714_100000342
694 Ga0070714_100089007
695 Ga0070714_100388094
696 Ga0070713_100069530
697 Ga0070713_100448072
698 Ga0070710_10070269
699 Ga0070710_10200643
700 Ga0070711_100021417
701 Ga0070711_100392332
702 Ga0070700_100193601
703 Ga0070708_100033219
704 Ga0070708_100080435
705 Ga0070663_100011213
706 Ga0070678_100015365
707 Ga0070678_100015655
708 Ga0070662_100032079
709 Ga0070662_100129924
710 Ga0070681_10096947
711 Ga0070681_10231390
712 Ga0070685_10022590
713 Ga0070685_10141079
714 Ga0070706_100000823
715 Ga0070706_100057572
716 Ga0070707_100002811
717 Ga0070698_100000805
718 Ga0070698_100044298
719 Ga0070698_100120026
720 Ga0070679_100099050
721 Ga0070679_100102811
722 Ga0070679_100175502
723 Ga0070684_100032864
724 Ga0070684_100035945
725 Ga0070684_100121212
726 Ga0070684_100240393
727 Ga0070684_100252936
728 Ga0070684_100352787
729 Ga0070697_100379840
730 Ga0068853_100061002
731 Ga0068853_100307895
732 Ga0070672_100059327
733 Ga0070672_100174845
734 Ga0070696_100044154
735 Ga0070696_100072476
736 Ga0070693_100077116
737 Ga0070665_100004920
738 Ga0070665_100335740
739 Ga0070704_100071693
740 Ga0070704_100084762
741 Ga0070704_100224083
742 Ga0068855_100023638
743 Ga0068855_100110665
744 Ga0068855_100137556
745 Ga0068855_100209444
746 Ga0068855_100283822
747 Ga0070664_100206715
748 Ga0068857_100150700
749 Ga0068857_100151545
750 Ga0068856_100006059
751 Ga0068856_100114058
752 Ga0070702_100097959
753 Ga0068852_100071670
754 Ga0068852_100156419
755 Ga0068864_100273198
756 Ga0068866_10100059
757 Ga0068861_100292494
758 Ga0068870_10022120
759 Ga0068870_10028295
760 Ga0068863_100531790
761 Ga0068858_100435189
762 Ga0068860_100393501
763 Ga0068862_100000772
764 Ga0081455_10101779
765 Ga0081455_10127874
766 Ga0081455_10251523
767 Ga0081538_10026632
768 Ga0081540_1004204
769 Ga0081540_1019924
770 Ga0070717_10002940
771 Ga0070717_10016455
772 Ga0075365_10100543
773 Ga0075364_10039922
774 Ga0075432_10001987
775 Ga0070715_10085318
776 Ga0070712_100199675
777 Ga0097621_100028225
778 Ga0075370_10032801
779 Ga0068871_100363214
780 Ga0075428_100000211
781 Ga0075428_100101291
782 Ga0075433_10012759
783 Ga0075433_10169894
784 Ga0075434_100043521
785 Ga0075434_100071241
786 Ga0075429_100005341
787 Ga0068865_100015100
788 Ga0068865_100312832
789 Ga0075436_100006476
790 Ga0075435_100155573
791 Ga0105240_10160060
792 Ga0105240_10586883
793 Ga0111539_10003281
794 Ga0111539_10103504
795 Ga0111539_10169415
796 Ga0111539_10195746
797 Ga0111539_10701644
798 Ga0105245_10001672
799 Ga0105245_10023674
800 Ga0105245_10208538
801 Ga0105247_10124185
802 Ga0114129_10002058
803 Ga0114129_10011553
804 Ga0114129_10227574
805 Ga0114129_10260844
806 Ga0114129_10448329
807 Ga0105243_10119698
808 Ga0105243_10277364
809 Ga0105242_10018143
810 Ga0105242_10101880
811 Ga0105242_10176057
812 Ga0105242_10227184
813 Ga0105248_10304657
814 Ga0105237_10101507
815 Ga0105237_10415324
816 Ga0105238_10010169
817 Ga0105238_10046758
818 Ga0105238_10275082
819 Ga0105249_10010169
820 Ga0105249_10156441
821 Ga0105239_10054676
822 Ga0105239_10228885
823 Ga0105239_10584398
824 Ga0105246_10015910
825 Ga0105246_10042671
826 Ga0105246_10073261
827 Ga0157370_10026174
828 Ga0157370_10033161
829 Ga0157370_10054870
830 Ga0157369_10022942
831 Ga0157369_10221769
832 Ga0157374_10076623
833 Ga0157378_10346514
834 Ga0163162_10606949
835 Ga0157372_10072238
836 Ga0157372_10119470
837 Ga0157372_10358312
838 Ga0157372_10488001
839 Ga0157375_10059076
840 Ga0157375_10344250
841 Ga0157375_10594092
842 Ga0163163_10039202
843 Ga0182008_10015027
844 Ga0182008_10087434
845 Ga0182008_10189682
846 Ga0157377_10006166
847 Ga0157379_10254688
848 Ga0157376_10523823
849 Ga0163161_10168797
850 Ga0206356_10221095
851 Ga0206356_10397882
852 Ga0206353_10556283
853 Ga0206353_10581081
854 Ga0207692_10009347
855 Ga0207642_10042592
856 Ga0207688_10009635
857 Ga0207685_10006858
858 Ga0207643_10003002
859 Ga0207643_10029234
860 Ga0207643_10080409
861 Ga0207705_10016247
862 Ga0207684_10000008
863 Ga0207684_10071765
864 Ga0207707_10143212
865 Ga0207707_10173526
866 Ga0207671_10022752
867 Ga0207693_10000919
868 Ga0207663_10116131
869 Ga0207663_10313550
870 Ga0207660_10017196
871 Ga0207660_10032251
872 Ga0207657_10005718
873 Ga0207657_10008090
874 Ga0207657_10044056
875 Ga0207657_10054299
876 Ga0207649_10006826
877 Ga0207652_10202468
878 Ga0207652_10279687
879 Ga0207646_10000763
880 Ga0207681_10008373
881 Ga0207694_10140519
882 Ga0207650_10016445
883 Ga0207650_10088839
884 Ga0207659_10052897
885 Ga0207659_10237639
886 Ga0207687_10019191
887 Ga0207687_10066899
888 Ga0207687_10125728
889 Ga0207687_10276304
890 Ga0207700_10092550
891 Ga0207700_10278790
892 Ga0207700_10305522
893 Ga0207664_10000617
894 Ga0207664_10014782
895 Ga0207664_10038374
896 Ga0207664_10085867
897 Ga0207690_10000188
898 Ga0207690_10021370
899 Ga0207690_10048138
900 Ga0207706_10018226
901 Ga0207706_10061523
902 Ga0207686_10110530
903 Ga0207709_10192918
904 Ga0207709_10240395
905 Ga0207669_10018564
906 Ga0207669_10044410
907 Ga0207669_10298135
908 Ga0207704_10043766
909 Ga0207704_10145281
910 Ga0207704_10151300
911 Ga0207665_10000603
912 Ga0207691_10039180
913 Ga0207691_10266120
914 Ga0207689_10054974
915 Ga0207661_10000463
916 Ga0207661_10124436
917 Ga0207661_10206626
918 Ga0207661_10247820
919 Ga0207667_10113428
920 Ga0207667_10172599
921 Ga0207667_10217722
922 Ga0207712_10002284
923 Ga0207668_10126321
924 Ga0207640_10202294
925 Ga0207640_10278195
926 Ga0207658_10002483
927 Ga0207658_10004120
928 Ga0207677_10126729
929 Ga0207677_10247999
930 Ga0207677_10268469
931 Ga0207703_10016991
932 Ga0207639_10157039
933 Ga0207639_10270405
934 Ga0207678_10008989
935 Ga0207708_10021885
936 Ga0207708_10052203
937 Ga0207702_10028487
938 Ga0207702_10154015
939 Ga0207702_10320031
940 Ga0207648_10043497
941 Ga0207674_10028849
942 Ga0207674_10324096
943 Ga0207675_100001496
944 Ga0207683_10002515
945 Ga0207683_10060153
946 Ga0207683_10293028
947 Ga0209813_10063924
948 Ga0207428_10000315
949 Ga0207428_10070484
950 Ga0268266_10047771
951 Ga0268265_10000736
952 Ga0268264_10132049
953 Ga0265319_1009539
954 Ga0265322_10028651
955 Ga0265338_10015737
956 Ga0265338_10042393
957 Ga0265339_10007410
958 Ga0265316_10020436
959 Ga0265313_10026781
960 Ga0265314_10006777
961 Ga0265342_10031976
962 Ga0307407_10148648
963 Ga0307409_100309189
964 Ga0307416_100420378
965 Ga0307415_100046294
966 Ga0307415_100175914
967 Ga0373934_0042171
968 Ga0373944_0012216
969 Ga0373923_0053976
970 Ga0373932_0039895
971 Ga0373936_0015399
972 Ga0373939_0048414
973 Ga0373956_0017042
974 Ga0373943_0001514
975 Ga0373946_0000684
976 Ga0373955_0142115
977 Ga0373942_0007075
978 Ga0373961_0047784
979 Ga0373931_0027133
980 Ga0373935_0035974
981 Ga0373927_0006434
982 Ga0373947_0001551
983 Ga0373947_0049242
984 Ga0373937_0001462
985 Ga0373937_0013260
986 Ga0373937_0143624
987 Ga0373925_0016109
988 Ga0373925_0050590
989 Ga0395899_0023938
990 Ga0395899_0140247
991 Ga0395900_0052762
992 Ga0395900_0151455
993 Ga0395900_0345941
994 Ga0395900_0421275
995 Ga0395898_0027962
996 Ga0395898_0056257
997 Ga0395898_0087418
998 Ga0395898_0088670
999 Ga0395898_0207892
1000 Ga0395905_0048403
1001 Ga0395905_0056453
1002 Ga0395905_0235523
1003 Ga0395901_0009918
1004 Ga0395901_0047081
1005 Ga0395901_0069625
1006 Ga0395901_0127304
1007 Ga0395901_0180943
1008 Ga0395901_0182516
1009 Ga0395901_0280089
1010 Ga0436365_1220139
1011 Ga0439448_0030166
1012 Ga0450920_001235
1013 Ga0439458_0005864
1014 Ga0466969_0004436
1015 Ga0466961_0009894
1016 Ga0466961_0017102
1017 Ga0466961_0046450
1018 Ga0466963_0000205
1019 Ga0466963_0004431
1020 Ga0466963_0064968
1021 Ga0466963_0065471
1022 Ga0466963_0073009
1023 Ga0466963_0192045
1024 Ga0466964_0002840
1025 Ga0466964_0025065
1026 Ga0466971_0002531
1027 Ga0466971_0010508
1028 Ga0466968_0017563
1029 Ga0466957_0000280
1030 Ga0451576_0039636
1031 Ga0466967_0003679
1032 Ga0466967_0004529
1033 Ga0466967_0005081
1034 Ga0466967_0016123
1035 Ga0466967_0028944
1036 Ga0466967_0051112
1037 Ga0466967_0104251
1038 Ga0466967_0119679
1039 Ga0466967_0121901
1040 Ga0466967_0253316
1041 Ga0466967_0281866
1042 Ga0466967_0325252
1043 Ga0466967_0326837
1044 Ga0466967_0337819
1045 Ga0495592_0000207
1046 Ga0495603_0000445
1047 Ga0495603_0043771
1048 Ga0495603_0052970
1049 Ga0495603_0157149
1050 Ga0495629_0003295
1051 Ga0495629_0014228
1052 Ga0495638_0013119
1053 Ga0495641_0052952
1054 Ga0495641_0084546
1055 Ga0495651_0000106
1056 Ga0495651_0141969
1057 Ga0495653_0000290
1058 Ga0495653_0008918
1059 Ga0495582_0000516
1060 Ga0495582_0007912
1061 Ga0495582_0059933
1062 Ga0495582_0059973
1063 Ga0495639_0001552
1064 Ga0495639_0087559
1065 Ga0495662_0013779
1066 Ga0495662_0084873
1067 Ga0495664_0014036
1068 Ga0495584_0048069
1069 Ga0495594_0107374
1070 Ga0495596_0031975
1071 Ga0495608_0001216
1072 Ga0495608_0099334
1073 Ga0495618_0000561
1074 Ga0495618_0017961
1075 Ga0495618_0118676
1076 Ga0495628_0000185
1077 Ga0495630_0022437
1078 Ga0495630_0086588
1079 Ga0495630_0186036
1080 Ga0495652_0000466
1081 Ga0495652_0050989
1082 Ga0495652_0222935
1083 Ga0495665_0000240
1084 Ga0495586_0076559
1085 Ga0495587_0000537
1086 Ga0495587_0048521
1087 Ga0495645_0000115
1088 Ga0495667_0011033
1089 Ga0495667_0041285
1090 Ga0495667_0041925
1091 Ga0495634_0023328
1092 Ga0495634_0028372
1093 Ga0495634_0033135
1094 Ga0495634_0159985
1095 Ga0495635_0016636
1096 Ga0495635_0094057
1097 Ga0495588_0004083
1098 Ga0495657_0010467
1099 Ga0495657_0029004
1100 Ga0495657_0050638
1101 Ga0495599_0000135
1102 Ga0495599_0082408
1103 Ga0495623_0000350
1104 Ga0495623_0065819
1105 Ga0495646_0000351
1106 Ga0495647_0008629
1107 Ga0495647_0029843
1108 Ga0495658_0000691
1109 Ga0495658_0049340
1110 Ga0495613_0011438
1111 Ga0495613_0029805
1112 Ga0495613_0072645
1113 Ga0495613_0114778
1114 Ga0495624_0008806
1115 Ga0495600_0006098
1116 Ga0495600_0018844
1117 Ga0495600_0090125
1118 Ga0495581_0000481
1119 Ga0495581_0197045
1120 Ga0495604_0000060
1121 Ga0495604_0031932
1122 Ga0495674_0015172
1123 Ga0495674_0022505
1124 Ga0495674_0027758
1125 Ga0495674_0053092
1126 Ga0495674_0076611
1127 Ga0495674_0148938
1128 Ga0495676_0000654
1129 Ga0495676_0010451
1130 Ga0495676_0018380
1131 Ga0495680_0002435
1132 Ga0495680_0003818
1133 Ga0495680_0014000
1134 Ga0495680_0024176
1135 Ga0495680_0035391
1136 Ga0495675_0000223
1137 Ga0495675_0027064
1138 Ga0495684_0011766
1139 Ga0495684_0014714
1140 Ga0495684_0022572
1141 Ga0495593_0011508
1142 Ga0495602_0000197
1143 Ga0495602_0302952
1144 Ga0495614_0035273
1145 Ga0496100_0073543
1146 Ga0496100_0165700
1147 Ga0496101_0052217
1148 Ga0496101_0052593
1149 Ga0496101_0069443
1150 Ga0496101_0161313
1151 Ga0496101_0198706
1152 Ga0496101_0417252
1153 Ga0496102_0007328
1154 Ga0496102_0035871
1155 Ga0496102_0221979
1156 Ga0496103_0013037
1157 Ga0496104_0001809
1158 Ga0496104_0067297
1159 Ga0496105_0001748
1160 Ga0496105_0010299
1161 Ga0496105_0015684
1162 Ga0496105_0141815
1163 Ga0496106_0019107
1164 Ga0496106_0024124
1165 Ga0496106_0108857
1166 Ga0496106_0195296
1167 Ga0496107_0007667
1168 Ga0496107_0051018
1169 Ga0496107_0168321
1170 Ga0496107_0179271
1171 Ga0496108_0005376
1172 Ga0496108_0025258
1173 Ga0496108_0065698
1174 Ga0496108_0299002
1175 Ga0496109_0000613
1176 Ga0496109_0013078
1177 Ga0496109_0078028
1178 Ga0496109_0310916
1179 Ga0496110_0000227
1180 Ga0496110_0010434
1181 Ga0496110_0031403
1182 Ga0496110_0060744
1183 Ga0496110_0176732
1184 Ga0496110_0408361
1185 Ga0496111_0019990
1186 Ga0496111_0027506
1187 Ga0496111_0047140
1188 Ga0496111_0225639
1189 Ga0496112_0013398
1190 Ga0496112_0021015
1191 Ga0496113_0010346
1192 Ga0496113_0015361
1193 Ga0496113_0046180
1194 Ga0496114_0012648
1195 Ga0496114_0015571
1196 Ga0496114_0280195
1197 Ga0496115_0014093
1198 Ga0496115_0324180
1199 Ga0501031_0005364
1200 Ga0501031_0007015
1201 Ga0501031_0018815
1202 Ga0501032_0030221
1203 Ga0501032_0050504
1204 Ga0501033_0029934
1205 Ga0501033_0097300
1206 Ga0501036_0008841
1207 Ga0501036_0073801
1208 Ga0501037_0007155
1209 Ga0501037_0063001
1210 Ga0501038_0004352
1211 Ga0501038_0029908
1212 Ga0501039_0007649
1213 Ga0501039_0085398
1214 Ga0501040_0009636
1215 Ga0501040_0030782
1216 Ga0501040_0121395
1217 Ga0501040_0260997
1218 Ga0501041_0015393
1219 Ga0501042_0128958
1220 Ga0501046_0008189
1221 Ga0501046_0054041
1222 Ga0501046_0109881
1223 Ga0501047_0023201
1224 Ga0501047_0028024
1225 Ga0501048_0013462
1226 Ga0501048_0048234
1227 Ga0501048_0135331
1228 Ga0501067_0016161
1229 Ga0501068_0001354
1230 Ga0501068_0051552
1231 Ga0501069_0171598
1232 Ga0501070_0020855
1233 Ga0501070_0083465
1234 Ga0501070_0259672
1235 Ga0501071_0003541
1236 Ga0501071_0009471
1237 Ga0501071_0015098
1238 Ga0501071_0032762
1239 Ga0501071_0166129
1240 Ga0501072_0007825
1241 Ga0501072_0009404
1242 Ga0501072_0015793
1243 Ga0501072_0017765
1244 Ga0501072_0059036
1245 Ga0501073_0000628
1246 Ga0501073_0056903
1247 Ga0501073_0149629
1248 Ga0501074_0016439
1249 Ga0501074_0024114
1250 Ga0501074_0026160
1251 Ga0501075_0004487
1252 Ga0501075_0005137
1253 Ga0501075_0009095
1254 Ga0501075_0033610
1255 Ga0501076_0016152
1256 Ga0501076_0018581
1257 Ga0501076_0403881
1258 Ga0501077_0005536
1259 Ga0501077_0085168
1260 Ga0501077_0087425
1261 Ga0501079_0009620
1262 Ga0501079_0043082
1263 Ga0501079_0084643
1264 Ga0501080_0021157
1265 Ga0501080_0047098
1266 Ga0501080_0057448
1267 Ga0501080_0177867
1268 Ga0501080_0195937
1269 Ga0501081_0008239
1270 Ga0501081_0010371
1271 Ga0501081_0011177
1272 Ga0501081_0048945
1273 Ga0501081_0107923
1274 Ga0501083_0000739
1275 Ga0501083_0005244
1276 Ga0501083_0026654
1277 Ga0501083_0081442
1278 Ga0501083_0097001
1279 Ga0501035_0069067
1280 Ga0501035_0074745
1281 Ga0501035_0186357
1282 Ga0501035_0217616
1283 Ga0501045_0001564
1284 Ga0501045_0002762
1285 Ga0501045_0021776
1286 Ga0501045_0079954
1287 Ga0501045_0088558
1288 nmdc:mga00v17_6163_c1
1289 nmdc:mga0yw44_68050_c1
1290 nmdc:mga05p37_17104_c1
1291 nmdc:mga05p37_39397_c1
1292 nmdc:mga05p37_406091_c1
1293 nmdc:mga05p37_64172_c1
1294 nmdc:mga05p37_885_c1
1295 nmdc:mga09592_6255_c1
1296 nmdc:mga06r32_391070_c1
1297 nmdc:mga08y16_1003_c1
1298 nmdc:mga08y16_120206_c1
1299 nmdc:mga08y16_27785_c1
1300 nmdc:mga08y16_402075_c1
1301 nmdc:mga08y16_543376_c1
1302 nmdc:mga0n895_14233_c1
1303 nmdc:mga0rr50_147108_c1
1304 nmdc:mga0rr50_20546_c1
1305 nmdc:mga0rr50_25267_c1
1306 nmdc:mga0a205_107563_c1
1307 nmdc:mga0a205_110063_c1
1308 nmdc:mga0a205_9352_c1
1309 Ga0495601_0000238
1310 Ga0495601_0008450
1311 Ga0495601_0037479
1312 Ga0495595_0024914
1313 Ga0495595_0035945
1314 Ga0495619_0000200
1315 Ga0495619_0015891
1316 Ga0495619_0020597
1317 Ga0495619_0040555
1318 Ga0501084_0037442
1319 Ga0501082_0019554
1320 Ga0501082_0045737
1321 Ga0501082_0143066
1322 Ga0466962_0001269
1323 Ga0530510_0187631
1324 Ga0530510_0295087

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00676

E1_dh

Dehydrogenase E1 component

43

335

0.91

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

125

263

0.74

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

125

273

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cer-assembly2.cif.gz_G human pyruvate dehydrogenase complex e1 component v138m mutation 0.9599 16 317
3exe-assembly2.cif.gz_E crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex 0.9564 16 317
3exg-assembly4.cif.gz_O crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex 0.9548 16 317
2ozl-assembly1.cif.gz_C human pyruvate dehydrogenase s264e variant 0.9545 16 324
3exg-assembly7.cif.gz_1 crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex 0.9545 16 317
ID Description Score Start End Superfamily
af_I1N1B9_20_344_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9547 19 295 3.40.50.970
af_B4FGJ4_23_381_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9516 19 325 3.40.50.970
af_A4HY08_15_377_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9493 13 324 3.40.50.970
af_Q2FY52_1_330_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.948 15 317 3.40.50.970
af_I1KAH2_90_485_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9404 13 317 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7W1NQF7-F1-model_v4 Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha 0.9798 23 317 GO:0004739
GO:0006086
AF-A0A7V5IDR1-F1-model_v4 Pyruvate dehydrogenase E1 component subunit alpha (EC 1.2.4.1) 0.9787 16 299 GO:0004739
GO:0006086
GO:0043231
AF-A0A534AF21-F1-model_v4 Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha 0.9786 21 317 GO:0004739
GO:0006086
AF-A0A530GFW1-F1-model_v4 Pyruvate dehydrogenase (Acetyl-transferring) E1 component subunit alpha 0.9785 21 124 GO:0004739
GO:0006086
AF-A0A7J4FI09-F1-model_v4 Dehydrogenase 0.9781 16 317 GO:0006082
GO:0016624
GO:0044272

Map