F473504

General Info

Members Datasets Scaffolds Average Seq Length
662 460 1324 231

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0021020|Ga0495684_0021020_2261_3046
Length 261
Sequence MNFRLGVFHISALCLAAGLAANPAHAQKRVGEAAVVKNEVVHVMASATNPLNVGDAVLRDETVRTGLDSAARLVMADSTNLSLGPSATIKLDRTVFNDEHTYRDIAIRLTTGAFRFVTGHSEKTAYKITTTLATIGVRGTILDILAQRGKTTVVLQEGASRVCSTGGECIELTQPGDTAIITSAAGKVTIKKTNNSPWTFAGTCGAAAGLCSTTQYADATPTVTPPVDDDPTGMLCGRHACRVGLVGAGVSNPRVGVGRMF

Samples

Sample ID Description Type Environment
1 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
49 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
74 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
133 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
134 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
135 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
136 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
278 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
279 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
283 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
284 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
287 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
288 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
289 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
290 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
291 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
292 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
293 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
296 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
297 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
298 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
299 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
303 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
304 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
305 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
306 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
307 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
308 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
309 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
313 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
314 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
315 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
316 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
317 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
318 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
319 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
320 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
321 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
322 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
323 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
324 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
325 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
326 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
327 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
328 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
329 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
330 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
331 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
332 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
333 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
334 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
335 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
336 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
337 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
338 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
339 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
340 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
341 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
342 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
343 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
344 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
345 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
346 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
347 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
348 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
349 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
350 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
351 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
352 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
353 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
354 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
355 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
356 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
357 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
358 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
359 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
360 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
361 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
362 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
363 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
364 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
365 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
366 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
367 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
368 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
369 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
370 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
371 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
372 2922368715
373 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
374 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
375 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
376 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
377 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
378 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
379 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
380 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
381 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
382 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
383 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
384 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
385 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
386 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
387 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
388 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
389 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
390 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
391 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
392 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
393 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
394 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
395 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
396 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
397 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
398 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
399 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
400 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
401 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
402 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
403 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
404 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
405 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
406 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
407 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
408 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
409 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
410 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
411 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
412 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
413 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
414 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
415 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
416 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
417 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
418 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
419 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
420 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
421 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
422 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
423 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
424 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
425 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
426 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
427 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
428 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
429 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
430 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
431 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
432 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
433 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
434 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
435 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
436 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
437 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
438 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
439 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
440 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
441 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
442 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
443 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
444 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
445 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
446 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
447 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
448 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
449 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
450 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
451 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
452 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
453 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
454 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
455 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
456 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
457 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
458 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
459 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
460 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.52
Metatranscriptomes 0
Isolates 21.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.26
Nodule 18.73
Rhizoplane 5.29
Rhizosphere 50.91
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495684_0021020 3300047471 Bacteria 5027
2 JGI24740J21852_10019872 3300001979 Bacteria 2357
3 JGI25153J46596_10003471 3300003215 Bacteria 8827
4 JGI25153J46596_10004976 3300003215 Bacteria 7052
5 rootH2_10050078 3300003320 Bacteria 1803
6 rootH1_10143846 3300003323 Bacteria 1653
7 JGI25160J50197_1001390 3300003354 Bacteria 12150
8 Ga0055531_10008672 3300003794 Bacteria 5317
9 Ga0065165_1001118 3300005262 Bacteria 31690
10 Ga0065165_1002611 3300005262 Bacteria 14729
11 Ga0065165_1007857 3300005262 Bacteria 5130
12 Ga0065165_1039387 3300005262 Bacteria 1416
13 Ga0070666_10245392 3300005335 Bacteria 1267
14 Ga0070680_100006621 3300005336 Bacteria 8811
15 Ga0070682_100081269 3300005337 Bacteria 2098
16 Ga0068868_100199358 3300005338 Bacteria 1668
17 Ga0070689_100418007 3300005340 Bacteria 1136
18 Ga0070671_100020375 3300005355 Bacteria 5407
19 Ga0070709_10000261 3300005434 Bacteria 33691
20 Ga0070709_10079626 3300005434 Bacteria 2134
21 Ga0070709_10523847 3300005434 Bacteria 903
22 Ga0070714_100012030 3300005435 Bacteria 6887
23 Ga0070714_101010999 3300005435 Bacteria 809
24 Ga0070713_100006394 3300005436 Bacteria 8160
25 Ga0070713_100504799 3300005436 Bacteria 1141
26 Ga0070710_10000210 3300005437 Bacteria 27444
27 Ga0070710_10065075 3300005437 Bacteria 2087
28 Ga0070711_100001235 3300005439 Bacteria 13816
29 Ga0070711_100075504 3300005439 Bacteria 2387
30 Ga0070711_100142519 3300005439 Bacteria 1798
31 Ga0070700_100444720 3300005441 Bacteria 985
32 Ga0070694_100152761 3300005444 Bacteria 1687
33 Ga0070663_100019847 3300005455 Bacteria 4439
34 Ga0070663_100024198 3300005455 Bacteria 4083
35 Ga0070663_100113835 3300005455 Bacteria 2036
36 Ga0070678_100111846 3300005456 Bacteria 2138
37 Ga0070678_100130616 3300005456 Bacteria 1995
38 Ga0070681_10001681 3300005458 Bacteria 19771
39 Ga0070681_10013715 3300005458 Bacteria 8066
40 Ga0070679_100236816 3300005530 Bacteria 1784
41 Ga0070679_100439767 3300005530 Bacteria 1249
42 Ga0070697_100229002 3300005536 Bacteria 1585
43 Ga0068853_100069429 3300005539 Bacteria 3065
44 Ga0068853_100349184 3300005539 Bacteria 1376
45 Ga0068853_100927796 3300005539 Bacteria 837
46 Ga0070672_100213184 3300005543 Bacteria 1618
47 Ga0068855_100106802 3300005563 Bacteria 3217
48 Ga0068855_100169547 3300005563 Bacteria 2472
49 Ga0068855_100221495 3300005563 Bacteria 2121
50 Ga0068855_100559037 3300005563 Bacteria 1238
51 Ga0068857_100004475 3300005577 Bacteria 11817
52 Ga0068854_100010565 3300005578 Bacteria 5989
53 Ga0068856_100000217 3300005614 Bacteria 61831
54 Ga0068856_100080782 3300005614 Bacteria 3225
55 Ga0068856_100532790 3300005614 Bacteria 1196
56 Ga0068852_100133256 3300005616 Bacteria 2291
57 Ga0068866_10086188 3300005718 Bacteria 1699
58 Ga0068861_100271407 3300005719 Bacteria 1457
59 Ga0068851_10004205 3300005834 Bacteria 6485
60 Ga0068851_10089620 3300005834 Bacteria 1618
61 Ga0068851_10286367 3300005834 Bacteria 944
62 Ga0070717_10090634 3300006028 Bacteria 2580
63 Ga0070717_10119583 3300006028 Bacteria 2255
64 Ga0070717_10183713 3300006028 Bacteria 1824
65 Ga0075365_10030635 3300006038 Bacteria 3447
66 Ga0075365_10131638 3300006038 Bacteria 1731
67 Ga0075368_10007122 3300006042 Bacteria 3937
68 Ga0075363_100047482 3300006048 Bacteria 2280
69 Ga0075363_100269665 3300006048 Bacteria 983
70 Ga0075364_10007872 3300006051 Bacteria 6345
71 Ga0070715_10040238 3300006163 Bacteria 1953
72 Ga0070715_10099488 3300006163 Bacteria 1354
73 Ga0070712_100002869 3300006175 Bacteria 10677
74 Ga0075369_10098161 3300006186 Bacteria 1312
75 Ga0097621_100625430 3300006237 Bacteria 986
76 Ga0068871_100440939 3300006358 Bacteria 1166
77 Ga0068871_100636334 3300006358 Bacteria 973
78 Ga0075434_100047511 3300006871 Bacteria 4260
79 Ga0099824_1018253 3300006942 Bacteria 5810
80 Ga0099823_1023901 3300006944 Bacteria 5560
81 Ga0075435_100088586 3300007076 Bacteria 2551
82 Ga0099794_10004219 3300007265 Bacteria 5611
83 Ga0099794_10020747 3300007265 Bacteria 2977
84 Ga0105240_10002438 3300009093 Bacteria 29910
85 Ga0105240_10063674 3300009093 Bacteria 4585
86 Ga0105240_10084140 3300009093 Bacteria 3901
87 Ga0105240_10255509 3300009093 Bacteria 2024
88 Ga0105241_10002406 3300009174 Bacteria 14054
89 Ga0105241_10049568 3300009174 Bacteria 3198
90 Ga0105241_10235787 3300009174 Bacteria 1544
91 Ga0105242_10127067 3300009176 Bacteria 2195
92 Ga0105248_10225112 3300009177 Bacteria 2111
93 Ga0105248_10349055 3300009177 Bacteria 1666
94 Ga0105237_10006022 3300009545 Bacteria 13569
95 Ga0105238_10000577 3300009551 Bacteria 38524
96 Ga0105238_10285744 3300009551 Bacteria 1631
97 Ga0105249_10420242 3300009553 Bacteria 1370
98 Ga0099796_10055260 3300010159 Bacteria 1390
99 Ga0099796_10092886 3300010159 Bacteria 1124
100 Ga0105239_10002730 3300010375 Bacteria 22163
101 Ga0105239_10027078 3300010375 Bacteria 6311
102 Ga0105239_10073574 3300010375 Bacteria 3756
103 Ga0105239_10089871 3300010375 Bacteria 3388
104 Ga0105239_10090133 3300010375 Bacteria 3383
105 Ga0105239_10099548 3300010375 Bacteria 3214
106 Ga0105239_10295797 3300010375 Bacteria 1823
107 Ga0105246_10048900 3300011119 Bacteria 2893
108 Ga0157370_10074842 3300013104 Bacteria 3194
109 Ga0157369_10612496 3300013105 Bacteria 1124
110 Ga0157374_10041636 3300013296 Bacteria 4234
111 Ga0157378_10011852 3300013297 Bacteria 7632
112 Ga0157378_10160762 3300013297 Bacteria 2100
113 Ga0163162_10279664 3300013306 Bacteria 1801
114 Ga0157375_10085702 3300013308 Bacteria 3200
115 Ga0157375_10101530 3300013308 Bacteria 2960
116 Ga0163163_10273283 3300014325 Bacteria 1741
117 Ga0163163_10348694 3300014325 Bacteria 1536
118 Ga0157380_10299068 3300014326 Bacteria 1481
119 Ga0182008_10164578 3300014497 Bacteria 1118
120 Ga0157379_10169727 3300014968 Bacteria 1969
121 Ga0214542_1000058 3300021321 Bacteria 133923
122 Ga0214545_1000026 3300021324 Bacteria 133811
123 Ga0214543_1002325 3300021327 Bacteria 37311
124 Ga0213873_10002466 3300021358 Bacteria 3201
125 Ga0213874_10021872 3300021377 Bacteria 1768
126 Ga0213876_10093133 3300021384 Bacteria 1596
127 Ga0209563_100416 3300025230 Bacteria 15040
128 Ga0209026_1014823 3300025250 Bacteria 1292
129 Ga0209677_101694 3300025253 Bacteria 9199
130 Ga0209148_1000511 3300025254 Bacteria 39051
131 Ga0209148_1018220 3300025254 Bacteria 1182
132 Ga0209233_1010606 3300025261 Bacteria 2749
133 Ga0209233_1044603 3300025261 Bacteria 937
134 Ga0209455_1001419 3300025272 Bacteria 10854
135 Ga0209564_1008379 3300025295 Bacteria 5108
136 Ga0209758_1000011 3300025297 Bacteria 1049685
137 Ga0209758_1001235 3300025297 Bacteria 31935
138 Ga0209758_1001336 3300025297 Bacteria 29877
139 Ga0209758_1006477 3300025297 Bacteria 8386
140 Ga0209758_1012292 3300025297 Bacteria 4806
141 Ga0209758_1055099 3300025297 Bacteria 1353
142 Ga0209256_1014854 3300025299 Bacteria 2766
143 Ga0207426_1000505 3300025302 Bacteria 57583
144 Ga0207426_1000551 3300025302 Bacteria 51985
145 Ga0207426_1004163 3300025302 Bacteria 7231
146 Ga0207426_1042408 3300025302 Bacteria 1404
147 Ga0209257_1000158 3300025304 Bacteria 180079
148 Ga0209257_1023719 3300025304 Bacteria 2148
149 Ga0207692_10000419 3300025898 Bacteria 14878
150 Ga0207692_10132286 3300025898 Bacteria 1410
151 Ga0207688_10033026 3300025901 Bacteria 2861
152 Ga0207688_10147610 3300025901 Bacteria 1387
153 Ga0207647_10002857 3300025904 Bacteria 13013
154 Ga0207699_10000833 3300025906 Bacteria 14685
155 Ga0207699_10123579 3300025906 Bacteria 1677
156 Ga0207699_10138847 3300025906 Bacteria 1595
157 Ga0207699_10289642 3300025906 Bacteria 1140
158 Ga0207705_10126199 3300025909 Bacteria 1902
159 Ga0207654_10004814 3300025911 Bacteria 6835
160 Ga0207654_10005864 3300025911 Bacteria 6193
161 Ga0207707_10007281 3300025912 Bacteria 9631
162 Ga0207695_10000157 3300025913 Bacteria 204140
163 Ga0207695_10022692 3300025913 Bacteria 7113
164 Ga0207695_10741041 3300025913 Bacteria 863
165 Ga0207671_10004425 3300025914 Bacteria 13458
166 Ga0207671_10028894 3300025914 Bacteria 4142
167 Ga0207671_10080172 3300025914 Bacteria 2447
168 Ga0207671_10090559 3300025914 Bacteria 2304
169 Ga0207693_10004823 3300025915 Bacteria 11341
170 Ga0207663_10008597 3300025916 Bacteria 5353
171 Ga0207663_10050462 3300025916 Bacteria 2585
172 Ga0207663_10271993 3300025916 Bacteria 1255
173 Ga0207660_10092618 3300025917 Bacteria 2243
174 Ga0207649_10263447 3300025920 Bacteria 1246
175 Ga0207652_10287632 3300025921 Bacteria 1483
176 Ga0207681_10211898 3300025923 Bacteria 1494
177 Ga0207694_10000491 3300025924 Bacteria 35820
178 Ga0207694_10009655 3300025924 Bacteria 7276
179 Ga0207694_10266054 3300025924 Bacteria 1405
180 Ga0207687_10099812 3300025927 Bacteria 2134
181 Ga0207700_10007496 3300025928 Bacteria 6674
182 Ga0207664_10002298 3300025929 Bacteria 12611
183 Ga0207644_10263379 3300025931 Bacteria 1379
184 Ga0207690_10215799 3300025932 Bacteria 1465
185 Ga0207706_10036775 3300025933 Bacteria 4348
186 Ga0207686_10050091 3300025934 Bacteria 2596
187 Ga0207669_10194887 3300025937 Bacteria 1465
188 Ga0207704_10161108 3300025938 Bacteria 1596
189 Ga0207665_10061664 3300025939 Bacteria 2543
190 Ga0207691_10111144 3300025940 Bacteria 2437
191 Ga0207691_10267427 3300025940 Bacteria 1473
192 Ga0207711_10125499 3300025941 Bacteria 2295
193 Ga0207689_10668379 3300025942 Bacteria 875
194 Ga0207667_10007711 3300025949 Bacteria 12878
195 Ga0207667_10045305 3300025949 Bacteria 4659
196 Ga0207667_10312011 3300025949 Bacteria 1606
197 Ga0207712_10093409 3300025961 Bacteria 2220
198 Ga0207712_10259199 3300025961 Bacteria 1409
199 Ga0207640_10027816 3300025981 Bacteria 3450
200 Ga0207703_10204118 3300026035 Bacteria 1758
201 Ga0207639_10043881 3300026041 Bacteria 3359
202 Ga0207639_10177549 3300026041 Bacteria 1809
203 Ga0207639_10218529 3300026041 Bacteria 1645
204 Ga0207639_10233524 3300026041 Bacteria 1595
205 Ga0207678_10048972 3300026067 Bacteria 3652
206 Ga0207678_10061105 3300026067 Bacteria 3240
207 Ga0207678_10068215 3300026067 Bacteria 3052
208 Ga0207708_10026588 3300026075 Bacteria 4382
209 Ga0207702_10000003 3300026078 Bacteria 434196
210 Ga0207702_10004131 3300026078 Bacteria 13017
211 Ga0207641_10584624 3300026088 Bacteria 1092
212 Ga0207648_10196750 3300026089 Bacteria 1787
213 Ga0207674_10004441 3300026116 Bacteria 16861
214 Ga0207674_10221797 3300026116 Bacteria 1839
215 Ga0207675_100307305 3300026118 Bacteria 1546
216 Ga0207675_100562487 3300026118 Bacteria 1140
217 Ga0207683_10101087 3300026121 Bacteria 2574
218 Ga0207683_10229654 3300026121 Bacteria 1692
219 Ga0207698_10075562 3300026142 Bacteria 2693
220 Ga0207698_10088529 3300026142 Bacteria 2525
221 Ga0207698_11065740 3300026142 Bacteria 820
222 Ga0209389_1000073 3300027296 Bacteria 94298
223 Ga0209389_1015102 3300027296 Bacteria 7012
224 Ga0209589_1018853 3300027357 Bacteria 7012
225 Ga0209489_100982 3300027361 Bacteria 57399
226 Ga0209489_113228 3300027361 Bacteria 6832
227 Ga0209700_100067 3300027363 Bacteria 144074
228 Ga0209179_1018491 3300027512 Bacteria 1332
229 Ga0209588_1003403 3300027671 Bacteria 4411
230 Ga0268266_10030971 3300028379 Bacteria 4543
231 Ga0268266_10276896 3300028379 Bacteria 1559
232 Ga0268265_10337097 3300028380 Bacteria 1372
233 Ga0265334_10108059 3300028573 Bacteria 1001
234 Ga0307517_10000124 3300028786 Bacteria 115570
235 Ga0307515_10203812 3300028794 Bacteria 1845
236 Ga0265330_10063026 3300031235 Bacteria 1611
237 Ga0265332_10017742 3300031238 Bacteria 3141
238 Ga0265325_10022950 3300031241 Bacteria 3413
239 Ga0265340_10043996 3300031247 Bacteria 2186
240 Ga0265339_10062083 3300031249 Bacteria 2009
241 Ga0265331_10058023 3300031250 Bacteria 1834
242 Ga0307508_10000008 3300031616 Bacteria 265023
243 Ga0307508_10110064 3300031616 Bacteria 2354
244 Ga0265314_10051893 3300031711 Bacteria 2854
245 Ga0265314_10102036 3300031711 Bacteria 1842
246 Ga0265342_10017873 3300031712 Bacteria 4604
247 Ga0265342_10059240 3300031712 Bacteria 2262
248 Ga0265342_10102935 3300031712 Bacteria 1624
249 Ga0307516_10157294 3300031730 Bacteria 2026
250 Ga0307516_10315345 3300031730 Bacteria 1236
251 Ga0307516_10389384 3300031730 Bacteria 1054
252 Ga0307510_10022384 3300033180 Bacteria 7342
253 Ga0307510_10026937 3300033180 Bacteria 6596
254 Ga0373930_0015353 3300034816 Bacteria 1437
255 Ga0373938_0027363 3300034957 Bacteria 1199
256 Ga0373934_0010551 3300035086 Bacteria 3468
257 Ga0373923_0017853 3300035111 Bacteria 2720
258 Ga0373923_0038776 3300035111 Bacteria 1954
259 Ga0373936_0038848 3300035113 Bacteria 1904
260 Ga0373936_0044605 3300035113 Bacteria 1784
261 Ga0373936_0177068 3300035113 Bacteria 934
262 Ga0373939_0084236 3300035114 Bacteria 1062
263 Ga0373945_0041042 3300035116 Bacteria 1672
264 Ga0373953_0002764 3300035117 Bacteria 5331
265 Ga0373956_0006887 3300035119 Bacteria 4565
266 Ga0373957_0002802 3300035120 Bacteria 5027
267 Ga0373943_0022142 3300035170 Bacteria 2941
268 Ga0373943_0193487 3300035170 Bacteria 1123
269 Ga0373946_0037837 3300035171 Bacteria 1963
270 Ga0373946_0096170 3300035171 Bacteria 1320
271 Ga0373955_0005941 3300035172 Bacteria 5527
272 Ga0373955_0024624 3300035172 Bacteria 3080
273 Ga0373924_0067972 3300035410 Bacteria 1499
274 Ga0373931_0038947 3300035691 Bacteria 2489
275 Ga0373935_0039285 3300035692 Bacteria 2967
276 Ga0373927_0004336 3300035695 Bacteria 9949
277 Ga0373927_0038131 3300035695 Bacteria 3121
278 Ga0373927_0050969 3300035695 Bacteria 2677
279 Ga0373947_0005486 3300035725 Bacteria 7401
280 Ga0373947_0542876 3300035725 Bacteria 791
281 Ga0373947_0654208 3300035725 Unclassified 717
282 Ga0373937_0014381 3300036401 Bacteria 6987
283 Ga0373937_0042699 3300036401 Bacteria 4137
284 Ga0395900_0428116 3300037418 Bacteria 1283
285 Ga0395898_0072641 3300037466 Bacteria 3324
286 Ga0395905_0008886 3300037471 Bacteria 9869
287 Ga0395901_0117613 3300038443 Bacteria 2793
288 Ga0436365_0262340 3300039437 Bacteria 4102
289 Ga0436365_0454557 3300039437 Bacteria 996
290 Ga0436365_1905285 3300039437 Bacteria 1213
291 Ga0436361_0494634 3300039447 Bacteria 4394
292 Ga0436361_0550279 3300039447 Bacteria 776
293 Ga0436361_0591932 3300039447 Bacteria 2202
294 Ga0436363_0086578 3300039450 Bacteria 7246
295 Ga0436363_0491147 3300039450 Bacteria 959
296 Ga0436362_0231941 3300039453 Bacteria 6717
297 Ga0436362_0309605 3300039453 Bacteria 4015
298 Ga0451833_1494008 3300041491 Bacteria 1226
299 Ga0451853_2414212 3300041512 Bacteria 1468
300 Ga0466972_0016291 3300044658 Bacteria 3714
301 Ga0466972_0178354 3300044658 Bacteria 996
302 Ga0466965_0017316 3300044683 Bacteria 3443
303 Ga0466965_0110741 3300044683 Bacteria 1411
304 Ga0466966_0001161 3300044684 Bacteria 16930
305 Ga0466961_0000122 3300044693 Bacteria 52002
306 Ga0466963_0014470 3300044694 Bacteria 4865
307 Ga0466968_0002716 3300044735 Bacteria 6534
308 Ga0466970_0035514 3300044765 Bacteria 2640
309 Ga0466960_0045949 3300044901 Bacteria 2088
310 Ga0466960_0105083 3300044901 Bacteria 1459
311 Ga0466959_0065229 3300045049 Bacteria 2642
312 Ga0466967_0015884 3300045976 Bacteria 5917
313 Ga0466967_0186566 3300045976 Bacteria 1958
314 Ga0495592_0002065 3300046454 Bacteria 14148
315 Ga0495592_0006865 3300046454 Bacteria 8499
316 Ga0495603_0002655 3300046455 Bacteria 10541
317 Ga0495603_0112405 3300046455 Bacteria 1588
318 Ga0495603_0210812 3300046455 Bacteria 1122
319 Ga0495629_0000423 3300046459 Bacteria 35258
320 Ga0495629_0003483 3300046459 Bacteria 11899
321 Ga0495629_0003888 3300046459 Bacteria 11251
322 Ga0495638_0004153 3300046460 Bacteria 11048
323 Ga0495641_0004526 3300046461 Bacteria 9774
324 Ga0495651_0024977 3300046462 Bacteria 4648
325 Ga0495653_0031217 3300046463 Bacteria 4236
326 Ga0495653_0160516 3300046463 Bacteria 1561
327 Ga0495580_0033068 3300046472 Bacteria 3727
328 Ga0495582_0002476 3300046473 Bacteria 10283
329 Ga0495582_0034113 3300046473 Bacteria 2798
330 Ga0495605_0036007 3300046474 Bacteria 2498
331 Ga0495639_0005805 3300046475 Bacteria 5311
332 Ga0495639_0085960 3300046475 Unclassified 1470
333 Ga0495662_0001665 3300046476 Bacteria 11071
334 Ga0495664_0004353 3300046477 Bacteria 7739
335 Ga0495664_0083737 3300046477 Bacteria 1914
336 Ga0495594_0012622 3300046499 Bacteria 4404
337 Ga0495606_0007979 3300046507 Bacteria 9314
338 Ga0495606_0266888 3300046507 Bacteria 942
339 Ga0495608_0064960 3300046511 Bacteria 2390
340 Ga0495620_0113921 3300046515 Bacteria 1070
341 Ga0495628_0027900 3300046516 Bacteria 4590
342 Ga0495628_0035770 3300046516 Bacteria 3990
343 Ga0495630_0004457 3300046517 Bacteria 9818
344 Ga0495643_0012461 3300046522 Bacteria 5130
345 Ga0495652_0063695 3300046529 Bacteria 3103
346 Ga0495652_0516994 3300046529 Bacteria 826
347 Ga0495665_0000241 3300046531 Bacteria 27409
348 Ga0495640_0024139 3300046533 Bacteria 4423
349 Ga0495640_0056680 3300046533 Bacteria 2676
350 Ga0495640_0477570 3300046533 Unclassified 760
351 Ga0495587_0013861 3300046536 Bacteria 5063
352 Ga0495645_0141471 3300046543 Bacteria 1678
353 Ga0495622_0010814 3300046557 Bacteria 4211
354 Ga0495622_0117499 3300046557 Bacteria 1215
355 Ga0495667_0017748 3300046559 Bacteria 4806
356 Ga0495667_0030180 3300046559 Bacteria 3645
357 Ga0495634_0001166 3300046642 Bacteria 24340
358 Ga0495634_0022091 3300046642 Bacteria 4486
359 Ga0495611_0096780 3300046648 Bacteria 1367
360 Ga0495635_0011623 3300046663 Bacteria 6170
361 Ga0495635_0014495 3300046663 Bacteria 5515
362 Ga0495635_0028301 3300046663 Bacteria 3895
363 Ga0495588_0034435 3300046674 Bacteria 2563
364 Ga0495657_0027309 3300046675 Bacteria 4030
365 Ga0495657_0105523 3300046675 Bacteria 1790
366 Ga0495599_0010349 3300046678 Bacteria 5703
367 Ga0495623_0000341 3300046679 Bacteria 30684
368 Ga0495623_0222124 3300046679 Bacteria 1076
369 Ga0495646_0010486 3300046680 Bacteria 5886
370 Ga0495646_0010637 3300046680 Bacteria 5844
371 Ga0495647_0001878 3300046681 Bacteria 6536
372 Ga0495658_0003512 3300046683 Bacteria 7758
373 Ga0495613_0032442 3300046689 Bacteria 3880
374 Ga0495613_0062819 3300046689 Bacteria 2717
375 Ga0495624_0001492 3300046690 Bacteria 18164
376 Ga0495624_0039766 3300046690 Bacteria 3014
377 Ga0495624_0149162 3300046690 Bacteria 1431
378 Ga0495670_0356264 3300046691 Bacteria 788
379 Ga0495600_0004899 3300046809 Bacteria 8041
380 Ga0495600_0029683 3300046809 Bacteria 3541
381 Ga0495604_0164781 3300047317 Bacteria 1563
382 Ga0495674_0001007 3300047319 Bacteria 27011
383 Ga0495674_0048288 3300047319 Bacteria 3767
384 Ga0495674_0223917 3300047319 Bacteria 1554
385 Ga0495676_0026625 3300047321 Bacteria 4975
386 Ga0495680_0117228 3300047322 Bacteria 1968
387 Ga0495675_0011478 3300047444 Bacteria 5561
388 Ga0495675_0167073 3300047444 Bacteria 1353
389 Ga0495673_0039003 3300047469 Bacteria 2157
390 Ga0495684_0006898 3300047471 Bacteria 8816
391 Ga0495593_0000612 3300047673 Bacteria 20402
392 Ga0495593_0016729 3300047673 Bacteria 4132
393 Ga0495593_0020486 3300047673 Bacteria 3704
394 Ga0495602_0072834 3300048088 Bacteria 2927
395 Ga0496100_0076250 3300048903 Bacteria 2251
396 Ga0496100_0100315 3300048903 Bacteria 1994
397 Ga0496101_0049802 3300048904 Bacteria 3014
398 Ga0496101_0083055 3300048904 Bacteria 2371
399 Ga0496102_0016946 3300048905 Bacteria 6376
400 Ga0496102_0171596 3300048905 Bacteria 2042
401 Ga0496102_0230464 3300048905 Bacteria 1746
402 Ga0496103_0015918 3300048906 Bacteria 4484
403 Ga0496104_0031236 3300048907 Bacteria 4952
404 Ga0496104_0064543 3300048907 Bacteria 3473
405 Ga0496104_0168332 3300048907 Bacteria 2101
406 Ga0496105_0027771 3300048908 Bacteria 4625
407 Ga0496105_0068605 3300048908 Bacteria 2929
408 Ga0496106_0051074 3300048909 Bacteria 3117
409 Ga0496106_0054839 3300048909 Bacteria 3012
410 Ga0496106_0313997 3300048909 Bacteria 1258
411 Ga0496107_0114118 3300048910 Bacteria 1987
412 Ga0496107_0316456 3300048910 Bacteria 1161
413 Ga0496108_0029800 3300048911 Bacteria 4522
414 Ga0496109_0149416 3300048912 Bacteria 2187
415 Ga0496109_0260790 3300048912 Bacteria 1632
416 Ga0496110_0084161 3300048913 Bacteria 2839
417 Ga0496110_0086957 3300048913 Bacteria 2791
418 Ga0496111_0032021 3300048914 Bacteria 3748
419 Ga0496111_0051278 3300048914 Bacteria 2979
420 Ga0496112_0022731 3300048915 Bacteria 5981
421 Ga0496112_0041669 3300048915 Bacteria 4492
422 Ga0496112_0365040 3300048915 Bacteria 1386
423 Ga0496113_0025679 3300048916 Bacteria 4202
424 Ga0496113_0062045 3300048916 Bacteria 2822
425 Ga0496114_0018046 3300048917 Bacteria 5700
426 Ga0496115_0036018 3300048918 Bacteria 3917
427 Ga0496115_0278890 3300048918 Bacteria 1372
428 Ga0496115_0727451 3300048918 Bacteria 778
429 Ga0496116_0020201 3300048919 Bacteria 5066
430 Ga0496117_0063654 3300048920 Bacteria 2520
431 Ga0496118_0043373 3300048921 Bacteria 3537
432 Ga0496118_0097853 3300048921 Bacteria 1995
433 Ga0496119_0004630 3300048922 Bacteria 13575
434 Ga0496119_0041522 3300048922 Bacteria 2928
435 Ga0496120_0008100 3300048923 Bacteria 7723
436 Ga0496120_0192514 3300048923 Bacteria 993
437 Ga0496121_0010361 3300048924 Bacteria 10528
438 Ga0496121_0051973 3300048924 Bacteria 3446
439 Ga0496121_0271981 3300048924 Bacteria 1164
440 Ga0496121_0383872 3300048924 Bacteria 925
441 Ga0496123_0083402 3300048926 Bacteria 1933
442 Ga0496125_0026115 3300048928 Bacteria 5333
443 Ga0496126_0096948 3300048929 Bacteria 2585
444 Ga0496126_0411476 3300048929 Bacteria 1095
445 Ga0495682_0040660 3300049460 Bacteria 1705
446 nmdc:mga03n38_223722_c1 3300050490 Bacteria 983
447 nmdc:mga00v17_138046_c1 3300050491 Bacteria 1562
448 nmdc:mga00v17_315305_c1 3300050491 Bacteria 1016
449 nmdc:mga0yw44_12135_c1 3300050492 Bacteria 4478
450 nmdc:mga0yw44_146329_c1 3300050492 Bacteria 1539
451 nmdc:mga0yw44_95689_c1 3300050492 Bacteria 1884
452 nmdc:mga0k408_68090_c1 3300050493 Bacteria 2076
453 nmdc:mga07m45_25081_c1 3300050496 Bacteria 3269
454 nmdc:mga0n895_379979_c1 3300050512 Bacteria 1429
455 nmdc:mga0n895_62135_c1 3300050512 Bacteria 3690
456 nmdc:mga0sz30_161073_c1 3300050516 Bacteria 994
457 Ga0495601_0013606 3300053077 Bacteria 4895
458 Ga0495612_0105328 3300053078 Bacteria 1204
459 Ga0500610_0111672 3300053079 Bacteria 1404
460 Ga0500635_0005789 3300053080 Bacteria 3267
461 Ga0500635_0008693 3300053080 Bacteria 2793
462 Ga0495655_0018439 3300053083 Bacteria 1534
463 Ga0495595_0001806 3300053084 Bacteria 8340
464 Ga0495595_0154469 3300053084 Bacteria 1130
465 Ga0495619_0009576 3300053085 Bacteria 6112
466 Ga0495619_0127853 3300053085 Bacteria 1745
467 Ga0500578_0145848 3300053086 Bacteria 1477
468 Ga0500578_0217431 3300053086 Bacteria 1163
469 Ga0500647_0076185 3300053091 Bacteria 1609
470 Ga0500583_0033733 3300053092 Bacteria 2268
471 Ga0500651_0050277 3300053093 Bacteria 2617
472 Ga0500566_0000072 3300053094 Bacteria 48857
473 Ga0500566_0000264 3300053094 Bacteria 28047
474 Ga0500566_0022211 3300053094 Bacteria 3728
475 Ga0500640_015840 3300053095 Bacteria 3168
476 Ga0500554_003465 3300053102 Bacteria 3235
477 Ga0500555_002238 3300053103 Bacteria 5649
478 Ga0500557_000006 3300053105 Bacteria 141252
479 Ga0500562_007788 3300053108 Bacteria 2702
480 Ga0500569_003851 3300053109 Bacteria 3108
481 Ga0500572_013581 3300053111 Bacteria 2018
482 Ga0500595_015774 3300053119 Bacteria 2829
483 Ga0500597_027503 3300053120 Bacteria 2312
484 Ga0500607_105000 3300053121 Bacteria 1395
485 Ga0500614_000392 3300053123 Bacteria 11371
486 Ga0500642_0000068 3300053130 Bacteria 56277
487 Ga0500655_012769 3300053133 Bacteria 1529
488 Ga0500658_0015559 3300053134 Bacteria 2825
489 Ga0500658_0097036 3300053134 Bacteria 1282
490 Ga0500559_0017645 3300053136 Bacteria 3015
491 Ga0500559_0048669 3300053136 Bacteria 1865
492 Ga0500559_0137880 3300053136 Bacteria 1141
493 Ga0500559_0208959 3300053136 Bacteria 920
494 Ga0500590_049415 3300053148 Bacteria 2141
495 Ga0500603_000091 3300053150 Bacteria 21606
496 Ga0500603_001504 3300053150 Bacteria 5311
497 Ga0500619_070146 3300053154 Bacteria 1164
498 Ga0500620_018723 3300053155 Bacteria 2021
499 Ga0500627_0011634 3300053158 Bacteria 3261
500 Ga0500630_000703 3300053159 Bacteria 15308
501 Ga0500638_004644 3300053162 Bacteria 5335
502 Ga0500638_037265 3300053162 Bacteria 2360
503 Ga0500638_118319 3300053162 Bacteria 1215
504 Ga0500639_000478 3300053163 Bacteria 19952
505 Ga0500639_183286 3300053163 Bacteria 922
506 Ga0500636_0021186 3300053177 Bacteria 3848
507 Ga0500636_0064745 3300053177 Bacteria 2129
508 Ga0500637_0000163 3300053178 Bacteria 24481
509 Ga0500637_0000302 3300053178 Bacteria 18681
510 Ga0500637_0012140 3300053178 Bacteria 4482
511 Ga0500637_0032798 3300053178 Bacteria 2897
512 Ga0500576_089058 3300053725 Bacteria 1286
513 Ga0500609_000691 3300053731 Bacteria 5103
514 Ga0500596_000257 3300053735 Bacteria 9332
515 Ga0500599_000247 3300053736 Bacteria 5152
516 Ga0500601_000551 3300053737 Bacteria 5529
517 Ga0500661_000115 3300055283 Bacteria 13149
518 Ga0500661_004270 3300055283 Bacteria 2673
519 Ga0500661_021499 3300055283 Bacteria 1145
520 2507507132 2507262055 Bacteria 8048963
521 2508541183 2508501009 Bacteria 7784016
522 2508693481 2508501042 Bacteria 8719808
523 2511395290 2511231028 Bacteria 8046582
524 2513626308 2513237092 Bacteria 8341956
525 2513637257 2513237094 Bacteria 8789602
526 2513651645 2513237095 Bacteria 8976980
527 2513717389 2513237104 Bacteria 10034502
528 2513876805 2513237139 Bacteria 8737671
529 2513887531 2513237141 Bacteria 8496279
530 2514012157 2513237161 Bacteria 8871253
531 2515628839 2515154112 Bacteria 8294334
532 2517107398 2517093001 Bacteria 9002274
533 2524439522 2524023205 Bacteria 8918781
534 2528850984 2528768022 Bacteria 10457665
535 2617348050 2617270735 Bacteria 9163226
536 2671122131 2667528175 Bacteria 7532676
537 2745081795 2744054633 Bacteria 8678936
538 2793066006 2791355196 Bacteria 7323613
539 2805918785 2802429603 Bacteria 8777136
540 2818243211 2816332527 Bacteria 8933356
541 2824667894 2824661429 Bacteria 9877870
542 2824673945 2824671348 Bacteria 8369588
543 2824690607 2824687955 Bacteria 8360029
544 2824698128 2824696289 Bacteria 8335049
545 2824707466 2824704595 Bacteria 9667483
546 2824759273 2824753945 Bacteria 9787441
547 2824769581 2824763712 Bacteria 9792355
548 2824776161 2824773399 Bacteria 8360218
549 2838126981 2838122688 Bacteria 8803140
550 2841945539 2841941048 Bacteria 8688029
551 2841954755 2841949485 Bacteria 8680857
552 2841972460 2841966195 Bacteria 8673214
553 2841980544 2841974524 Bacteria 8931498
554 2841988715 2841983080 Bacteria 8395090
555 2842045004 2842038055 Bacteria 8002051
556 2842052810 2842045827 Bacteria 8006841
557 2844320553 2844315083 Bacteria 8138177
558 2847940014 2847939898 Bacteria 8606328
559 2849077787 2849076700 Bacteria 7039503
560 2874625884 2874620515 Bacteria 8290088
561 2874633142 2874628541 Bacteria 8630250
562 2876769132 2876761206 Bacteria 10111113
563 2879101104 2879099564 Bacteria 10442239
564 2881669680 2881665667 Bacteria 8175609
565 2885368491 2885366525 Bacteria 8326213
566 2885410076 2885409591 Bacteria 9235467
567 2888386049 2888378607 Bacteria 9652610
568 2888392239 2888388044 Bacteria 7304136
569 2903732844 2903727486 Bacteria 8281579
570 2904673756 2904666416 Bacteria 8226587
571 2904717574 2904711408 Bacteria 9771557
572 2906605644 2906602504 Bacteria 8295279
573 2906628022 2906626472 Bacteria 8826946
574 2922376380
575 2932792656 2932784394 Bacteria 9704911
576 2932797878 2932794094 Bacteria 7915132
577 2932806414 2932801729 Bacteria 7987968
578 2932815251 2932809354 Bacteria 9135765
579 2932824469 2932818245 Bacteria 9955613
580 2932832133 2932828146 Bacteria 9745859
581 2933585935 2933577622 Bacteria 9116884
582 2935610488 2935608549 Bacteria 8203142
583 2935622071 2935616580 Bacteria 9032984
584 2935643918 2935638405 Bacteria 10015038
585 2935654310 2935648319 Bacteria 8801166
586 2935663190 2935656913 Bacteria 8965014
587 2935669166 2935665750 Bacteria 9571747
588 2935683276 2935675223 Bacteria 9928132
589 2935692217 2935684952 Bacteria 9590419
590 2935700612 2935694250 Bacteria 9291695
591 2935708758 2935703347 Bacteria 10242284
592 2935720545 2935713505 Bacteria 9608509
593 2935729826 2935722832 Bacteria 9608746
594 2935739192 2935732158 Bacteria 9706831
595 2935748267 2935741537 Bacteria 9707219
596 2935758470 2935750917 Bacteria 9590372
597 2935766105 2935760218 Bacteria 9817913
598 2935770983 2935769743 Bacteria 7878163
599 2935781150 2935777560 Bacteria 8077691
600 2935786316 2935785616 Bacteria 7962367
601 2935793887 2935793552 Bacteria 8012592
602 2935805882 2935801545 Bacteria 9301974
603 2935815560 2935810662 Bacteria 9401221
604 2935823649 2935819856 Bacteria 8261050
605 2935833170 2935827899 Bacteria 10038562
606 2935843259 2935837841 Bacteria 9454360
607 2935849175 2935847175 Bacteria 8228321
608 2935860318 2935855204 Bacteria 9035059
609 2935867716 2935864058 Bacteria 9784707
610 2935878475 2935873716 Bacteria 9632195
611 2935888420 2935883170 Bacteria 7964738
612 2935912732 2935908558 Bacteria 8568796
613 2935922949 2935916978 Bacteria 9113783
614 2935930374 2935926038 Bacteria 8601059
615 2935939274 2935934488 Bacteria 8602579
616 2935946222 2935942939 Bacteria 8599779
617 2935955559 2935951376 Bacteria 8602333
618 2935972070 2935967501 Bacteria 8603075
619 2935976008 2935975950 Bacteria 8347125
620 2935986502 2935984226 Bacteria 8302647
621 2935998642 2935992306 Bacteria 9802711
622 2936006948 2936002035 Bacteria 9362176
623 2936017346 2936011229 Bacteria 8801034
624 2936025848 2936019824 Bacteria 8804134
625 2936034744 2936028420 Bacteria 8965941
626 2936040798 2936037263 Bacteria 9446081
627 2936052801 2936046547 Bacteria 8903709
628 2936059996 2936055302 Bacteria 8785755
629 2940564374 2940556831 Bacteria 9590747
630 2941531752 2941531003 Bacteria 7653939
631 2941544805 2941538514 Bacteria 9402094
632 3005488387 3005483717 Bacteria 7877331
633 3005512616 3005506211 Bacteria 6943378
634 3005593344 3005587118 Bacteria 7794411
635 3005600947 3005594810 Bacteria 8716512
636 3005723731 3005718088 Bacteria 8283608
637 8006928470 8006926726 Bacteria 6749210
638 8016520030 8016511872 Bacteria 9921665
639 8016527952 8016522445 Bacteria 8156687
640 8016533075 8016530956 Bacteria 8155261
641 8016555820 8016548790 Bacteria 8155074
642 8016564168 8016557553 Bacteria 8154380
643 8016571385 8016566248 Bacteria 8158151
644 8016575648 8016575299 Bacteria 8154085
645 8016601870 8016595262 Bacteria 8149947
646 8016608379 8016603502 Bacteria 8731218
647 8016624650 8016622563 Bacteria 7999408
648 8017065521 8017057580 Bacteria 10023680
649 8019532874 8019530166 Bacteria 8155624
650 8019551691 8019547302 Bacteria 7996444
651 8019584925 8019576017 Bacteria 10049540
652 8019592879 8019586578 Bacteria 10212056
653 8019598579 8019597564 Bacteria 10041141
654 8019609797 8019608314 Bacteria 10042931
655 8019620378 8019619141 Bacteria 9218857
656 8019647205 8019638758 Bacteria 9062356
657 8019655475 8019648815 Bacteria 10014479
658 8019660590 8019659431 Bacteria 8577854
659 8019670011 8019668869 Bacteria 8791617
660 8019692265 8019687851 Bacteria 8712826
661 8055744494 8055742211 Bacteria 9226248
662 8056970460 8056967851 Bacteria 9038162
663 Ga0495684_0021020
664 JGI24740J21852_10019872
665 JGI25153J46596_10003471
666 JGI25153J46596_10004976
667 rootH2_10050078
668 rootH1_10143846
669 JGI25160J50197_1001390
670 Ga0055531_10008672
671 Ga0065165_1001118
672 Ga0065165_1002611
673 Ga0065165_1007857
674 Ga0065165_1039387
675 Ga0070666_10245392
676 Ga0070680_100006621
677 Ga0070682_100081269
678 Ga0068868_100199358
679 Ga0070689_100418007
680 Ga0070671_100020375
681 Ga0070709_10000261
682 Ga0070709_10079626
683 Ga0070709_10523847
684 Ga0070714_100012030
685 Ga0070714_101010999
686 Ga0070713_100006394
687 Ga0070713_100504799
688 Ga0070710_10000210
689 Ga0070710_10065075
690 Ga0070711_100001235
691 Ga0070711_100075504
692 Ga0070711_100142519
693 Ga0070700_100444720
694 Ga0070694_100152761
695 Ga0070663_100019847
696 Ga0070663_100024198
697 Ga0070663_100113835
698 Ga0070678_100111846
699 Ga0070678_100130616
700 Ga0070681_10001681
701 Ga0070681_10013715
702 Ga0070679_100236816
703 Ga0070679_100439767
704 Ga0070697_100229002
705 Ga0068853_100069429
706 Ga0068853_100349184
707 Ga0068853_100927796
708 Ga0070672_100213184
709 Ga0068855_100106802
710 Ga0068855_100169547
711 Ga0068855_100221495
712 Ga0068855_100559037
713 Ga0068857_100004475
714 Ga0068854_100010565
715 Ga0068856_100000217
716 Ga0068856_100080782
717 Ga0068856_100532790
718 Ga0068852_100133256
719 Ga0068866_10086188
720 Ga0068861_100271407
721 Ga0068851_10004205
722 Ga0068851_10089620
723 Ga0068851_10286367
724 Ga0070717_10090634
725 Ga0070717_10119583
726 Ga0070717_10183713
727 Ga0075365_10030635
728 Ga0075365_10131638
729 Ga0075368_10007122
730 Ga0075363_100047482
731 Ga0075363_100269665
732 Ga0075364_10007872
733 Ga0070715_10040238
734 Ga0070715_10099488
735 Ga0070712_100002869
736 Ga0075369_10098161
737 Ga0097621_100625430
738 Ga0068871_100440939
739 Ga0068871_100636334
740 Ga0075434_100047511
741 Ga0099824_1018253
742 Ga0099823_1023901
743 Ga0075435_100088586
744 Ga0099794_10004219
745 Ga0099794_10020747
746 Ga0105240_10002438
747 Ga0105240_10063674
748 Ga0105240_10084140
749 Ga0105240_10255509
750 Ga0105241_10002406
751 Ga0105241_10049568
752 Ga0105241_10235787
753 Ga0105242_10127067
754 Ga0105248_10225112
755 Ga0105248_10349055
756 Ga0105237_10006022
757 Ga0105238_10000577
758 Ga0105238_10285744
759 Ga0105249_10420242
760 Ga0099796_10055260
761 Ga0099796_10092886
762 Ga0105239_10002730
763 Ga0105239_10027078
764 Ga0105239_10073574
765 Ga0105239_10089871
766 Ga0105239_10090133
767 Ga0105239_10099548
768 Ga0105239_10295797
769 Ga0105246_10048900
770 Ga0157370_10074842
771 Ga0157369_10612496
772 Ga0157374_10041636
773 Ga0157378_10011852
774 Ga0157378_10160762
775 Ga0163162_10279664
776 Ga0157375_10085702
777 Ga0157375_10101530
778 Ga0163163_10273283
779 Ga0163163_10348694
780 Ga0157380_10299068
781 Ga0182008_10164578
782 Ga0157379_10169727
783 Ga0214542_1000058
784 Ga0214545_1000026
785 Ga0214543_1002325
786 Ga0213873_10002466
787 Ga0213874_10021872
788 Ga0213876_10093133
789 Ga0209563_100416
790 Ga0209026_1014823
791 Ga0209677_101694
792 Ga0209148_1000511
793 Ga0209148_1018220
794 Ga0209233_1010606
795 Ga0209233_1044603
796 Ga0209455_1001419
797 Ga0209564_1008379
798 Ga0209758_1000011
799 Ga0209758_1001235
800 Ga0209758_1001336
801 Ga0209758_1006477
802 Ga0209758_1012292
803 Ga0209758_1055099
804 Ga0209256_1014854
805 Ga0207426_1000505
806 Ga0207426_1000551
807 Ga0207426_1004163
808 Ga0207426_1042408
809 Ga0209257_1000158
810 Ga0209257_1023719
811 Ga0207692_10000419
812 Ga0207692_10132286
813 Ga0207688_10033026
814 Ga0207688_10147610
815 Ga0207647_10002857
816 Ga0207699_10000833
817 Ga0207699_10123579
818 Ga0207699_10138847
819 Ga0207699_10289642
820 Ga0207705_10126199
821 Ga0207654_10004814
822 Ga0207654_10005864
823 Ga0207707_10007281
824 Ga0207695_10000157
825 Ga0207695_10022692
826 Ga0207695_10741041
827 Ga0207671_10004425
828 Ga0207671_10028894
829 Ga0207671_10080172
830 Ga0207671_10090559
831 Ga0207693_10004823
832 Ga0207663_10008597
833 Ga0207663_10050462
834 Ga0207663_10271993
835 Ga0207660_10092618
836 Ga0207649_10263447
837 Ga0207652_10287632
838 Ga0207681_10211898
839 Ga0207694_10000491
840 Ga0207694_10009655
841 Ga0207694_10266054
842 Ga0207687_10099812
843 Ga0207700_10007496
844 Ga0207664_10002298
845 Ga0207644_10263379
846 Ga0207690_10215799
847 Ga0207706_10036775
848 Ga0207686_10050091
849 Ga0207669_10194887
850 Ga0207704_10161108
851 Ga0207665_10061664
852 Ga0207691_10111144
853 Ga0207691_10267427
854 Ga0207711_10125499
855 Ga0207689_10668379
856 Ga0207667_10007711
857 Ga0207667_10045305
858 Ga0207667_10312011
859 Ga0207712_10093409
860 Ga0207712_10259199
861 Ga0207640_10027816
862 Ga0207703_10204118
863 Ga0207639_10043881
864 Ga0207639_10177549
865 Ga0207639_10218529
866 Ga0207639_10233524
867 Ga0207678_10048972
868 Ga0207678_10061105
869 Ga0207678_10068215
870 Ga0207708_10026588
871 Ga0207702_10000003
872 Ga0207702_10004131
873 Ga0207641_10584624
874 Ga0207648_10196750
875 Ga0207674_10004441
876 Ga0207674_10221797
877 Ga0207675_100307305
878 Ga0207675_100562487
879 Ga0207683_10101087
880 Ga0207683_10229654
881 Ga0207698_10075562
882 Ga0207698_10088529
883 Ga0207698_11065740
884 Ga0209389_1000073
885 Ga0209389_1015102
886 Ga0209589_1018853
887 Ga0209489_100982
888 Ga0209489_113228
889 Ga0209700_100067
890 Ga0209179_1018491
891 Ga0209588_1003403
892 Ga0268266_10030971
893 Ga0268266_10276896
894 Ga0268265_10337097
895 Ga0265334_10108059
896 Ga0307517_10000124
897 Ga0307515_10203812
898 Ga0265330_10063026
899 Ga0265332_10017742
900 Ga0265325_10022950
901 Ga0265340_10043996
902 Ga0265339_10062083
903 Ga0265331_10058023
904 Ga0307508_10000008
905 Ga0307508_10110064
906 Ga0265314_10051893
907 Ga0265314_10102036
908 Ga0265342_10017873
909 Ga0265342_10059240
910 Ga0265342_10102935
911 Ga0307516_10157294
912 Ga0307516_10315345
913 Ga0307516_10389384
914 Ga0307510_10022384
915 Ga0307510_10026937
916 Ga0373930_0015353
917 Ga0373938_0027363
918 Ga0373934_0010551
919 Ga0373923_0017853
920 Ga0373923_0038776
921 Ga0373936_0038848
922 Ga0373936_0044605
923 Ga0373936_0177068
924 Ga0373939_0084236
925 Ga0373945_0041042
926 Ga0373953_0002764
927 Ga0373956_0006887
928 Ga0373957_0002802
929 Ga0373943_0022142
930 Ga0373943_0193487
931 Ga0373946_0037837
932 Ga0373946_0096170
933 Ga0373955_0005941
934 Ga0373955_0024624
935 Ga0373924_0067972
936 Ga0373931_0038947
937 Ga0373935_0039285
938 Ga0373927_0004336
939 Ga0373927_0038131
940 Ga0373927_0050969
941 Ga0373947_0005486
942 Ga0373947_0542876
943 Ga0373947_0654208
944 Ga0373937_0014381
945 Ga0373937_0042699
946 Ga0395900_0428116
947 Ga0395898_0072641
948 Ga0395905_0008886
949 Ga0395901_0117613
950 Ga0436365_0262340
951 Ga0436365_0454557
952 Ga0436365_1905285
953 Ga0436361_0494634
954 Ga0436361_0550279
955 Ga0436361_0591932
956 Ga0436363_0086578
957 Ga0436363_0491147
958 Ga0436362_0231941
959 Ga0436362_0309605
960 Ga0451833_1494008
961 Ga0451853_2414212
962 Ga0466972_0016291
963 Ga0466972_0178354
964 Ga0466965_0017316
965 Ga0466965_0110741
966 Ga0466966_0001161
967 Ga0466961_0000122
968 Ga0466963_0014470
969 Ga0466968_0002716
970 Ga0466970_0035514
971 Ga0466960_0045949
972 Ga0466960_0105083
973 Ga0466959_0065229
974 Ga0466967_0015884
975 Ga0466967_0186566
976 Ga0495592_0002065
977 Ga0495592_0006865
978 Ga0495603_0002655
979 Ga0495603_0112405
980 Ga0495603_0210812
981 Ga0495629_0000423
982 Ga0495629_0003483
983 Ga0495629_0003888
984 Ga0495638_0004153
985 Ga0495641_0004526
986 Ga0495651_0024977
987 Ga0495653_0031217
988 Ga0495653_0160516
989 Ga0495580_0033068
990 Ga0495582_0002476
991 Ga0495582_0034113
992 Ga0495605_0036007
993 Ga0495639_0005805
994 Ga0495639_0085960
995 Ga0495662_0001665
996 Ga0495664_0004353
997 Ga0495664_0083737
998 Ga0495594_0012622
999 Ga0495606_0007979
1000 Ga0495606_0266888
1001 Ga0495608_0064960
1002 Ga0495620_0113921
1003 Ga0495628_0027900
1004 Ga0495628_0035770
1005 Ga0495630_0004457
1006 Ga0495643_0012461
1007 Ga0495652_0063695
1008 Ga0495652_0516994
1009 Ga0495665_0000241
1010 Ga0495640_0024139
1011 Ga0495640_0056680
1012 Ga0495640_0477570
1013 Ga0495587_0013861
1014 Ga0495645_0141471
1015 Ga0495622_0010814
1016 Ga0495622_0117499
1017 Ga0495667_0017748
1018 Ga0495667_0030180
1019 Ga0495634_0001166
1020 Ga0495634_0022091
1021 Ga0495611_0096780
1022 Ga0495635_0011623
1023 Ga0495635_0014495
1024 Ga0495635_0028301
1025 Ga0495588_0034435
1026 Ga0495657_0027309
1027 Ga0495657_0105523
1028 Ga0495599_0010349
1029 Ga0495623_0000341
1030 Ga0495623_0222124
1031 Ga0495646_0010486
1032 Ga0495646_0010637
1033 Ga0495647_0001878
1034 Ga0495658_0003512
1035 Ga0495613_0032442
1036 Ga0495613_0062819
1037 Ga0495624_0001492
1038 Ga0495624_0039766
1039 Ga0495624_0149162
1040 Ga0495670_0356264
1041 Ga0495600_0004899
1042 Ga0495600_0029683
1043 Ga0495604_0164781
1044 Ga0495674_0001007
1045 Ga0495674_0048288
1046 Ga0495674_0223917
1047 Ga0495676_0026625
1048 Ga0495680_0117228
1049 Ga0495675_0011478
1050 Ga0495675_0167073
1051 Ga0495673_0039003
1052 Ga0495684_0006898
1053 Ga0495593_0000612
1054 Ga0495593_0016729
1055 Ga0495593_0020486
1056 Ga0495602_0072834
1057 Ga0496100_0076250
1058 Ga0496100_0100315
1059 Ga0496101_0049802
1060 Ga0496101_0083055
1061 Ga0496102_0016946
1062 Ga0496102_0171596
1063 Ga0496102_0230464
1064 Ga0496103_0015918
1065 Ga0496104_0031236
1066 Ga0496104_0064543
1067 Ga0496104_0168332
1068 Ga0496105_0027771
1069 Ga0496105_0068605
1070 Ga0496106_0051074
1071 Ga0496106_0054839
1072 Ga0496106_0313997
1073 Ga0496107_0114118
1074 Ga0496107_0316456
1075 Ga0496108_0029800
1076 Ga0496109_0149416
1077 Ga0496109_0260790
1078 Ga0496110_0084161
1079 Ga0496110_0086957
1080 Ga0496111_0032021
1081 Ga0496111_0051278
1082 Ga0496112_0022731
1083 Ga0496112_0041669
1084 Ga0496112_0365040
1085 Ga0496113_0025679
1086 Ga0496113_0062045
1087 Ga0496114_0018046
1088 Ga0496115_0036018
1089 Ga0496115_0278890
1090 Ga0496115_0727451
1091 Ga0496116_0020201
1092 Ga0496117_0063654
1093 Ga0496118_0043373
1094 Ga0496118_0097853
1095 Ga0496119_0004630
1096 Ga0496119_0041522
1097 Ga0496120_0008100
1098 Ga0496120_0192514
1099 Ga0496121_0010361
1100 Ga0496121_0051973
1101 Ga0496121_0271981
1102 Ga0496121_0383872
1103 Ga0496123_0083402
1104 Ga0496125_0026115
1105 Ga0496126_0096948
1106 Ga0496126_0411476
1107 Ga0495682_0040660
1108 nmdc:mga03n38_223722_c1
1109 nmdc:mga00v17_138046_c1
1110 nmdc:mga00v17_315305_c1
1111 nmdc:mga0yw44_12135_c1
1112 nmdc:mga0yw44_146329_c1
1113 nmdc:mga0yw44_95689_c1
1114 nmdc:mga0k408_68090_c1
1115 nmdc:mga07m45_25081_c1
1116 nmdc:mga0n895_379979_c1
1117 nmdc:mga0n895_62135_c1
1118 nmdc:mga0sz30_161073_c1
1119 Ga0495601_0013606
1120 Ga0495612_0105328
1121 Ga0500610_0111672
1122 Ga0500635_0005789
1123 Ga0500635_0008693
1124 Ga0495655_0018439
1125 Ga0495595_0001806
1126 Ga0495595_0154469
1127 Ga0495619_0009576
1128 Ga0495619_0127853
1129 Ga0500578_0145848
1130 Ga0500578_0217431
1131 Ga0500647_0076185
1132 Ga0500583_0033733
1133 Ga0500651_0050277
1134 Ga0500566_0000072
1135 Ga0500566_0000264
1136 Ga0500566_0022211
1137 Ga0500640_015840
1138 Ga0500554_003465
1139 Ga0500555_002238
1140 Ga0500557_000006
1141 Ga0500562_007788
1142 Ga0500569_003851
1143 Ga0500572_013581
1144 Ga0500595_015774
1145 Ga0500597_027503
1146 Ga0500607_105000
1147 Ga0500614_000392
1148 Ga0500642_0000068
1149 Ga0500655_012769
1150 Ga0500658_0015559
1151 Ga0500658_0097036
1152 Ga0500559_0017645
1153 Ga0500559_0048669
1154 Ga0500559_0137880
1155 Ga0500559_0208959
1156 Ga0500590_049415
1157 Ga0500603_000091
1158 Ga0500603_001504
1159 Ga0500619_070146
1160 Ga0500620_018723
1161 Ga0500627_0011634
1162 Ga0500630_000703
1163 Ga0500638_004644
1164 Ga0500638_037265
1165 Ga0500638_118319
1166 Ga0500639_000478
1167 Ga0500639_183286
1168 Ga0500636_0021186
1169 Ga0500636_0064745
1170 Ga0500637_0000163
1171 Ga0500637_0000302
1172 Ga0500637_0012140
1173 Ga0500637_0032798
1174 Ga0500576_089058
1175 Ga0500609_000691
1176 Ga0500596_000257
1177 Ga0500599_000247
1178 Ga0500601_000551
1179 Ga0500661_000115
1180 Ga0500661_004270
1181 Ga0500661_021499
1182 2507507132
1183 2508541183
1184 2508693481
1185 2511395290
1186 2513626308
1187 2513637257
1188 2513651645
1189 2513717389
1190 2513876805
1191 2513887531
1192 2514012157
1193 2515628839
1194 2517107398
1195 2524439522
1196 2528850984
1197 2617348050
1198 2671122131
1199 2745081795
1200 2793066006
1201 2805918785
1202 2818243211
1203 2824667894
1204 2824673945
1205 2824690607
1206 2824698128
1207 2824707466
1208 2824759273
1209 2824769581
1210 2824776161
1211 2838126981
1212 2841945539
1213 2841954755
1214 2841972460
1215 2841980544
1216 2841988715
1217 2842045004
1218 2842052810
1219 2844320553
1220 2847940014
1221 2849077787
1222 2874625884
1223 2874633142
1224 2876769132
1225 2879101104
1226 2881669680
1227 2885368491
1228 2885410076
1229 2888386049
1230 2888392239
1231 2903732844
1232 2904673756
1233 2904717574
1234 2906605644
1235 2906628022
1236 2922376380
1237 2932792656
1238 2932797878
1239 2932806414
1240 2932815251
1241 2932824469
1242 2932832133
1243 2933585935
1244 2935610488
1245 2935622071
1246 2935643918
1247 2935654310
1248 2935663190
1249 2935669166
1250 2935683276
1251 2935692217
1252 2935700612
1253 2935708758
1254 2935720545
1255 2935729826
1256 2935739192
1257 2935748267
1258 2935758470
1259 2935766105
1260 2935770983
1261 2935781150
1262 2935786316
1263 2935793887
1264 2935805882
1265 2935815560
1266 2935823649
1267 2935833170
1268 2935843259
1269 2935849175
1270 2935860318
1271 2935867716
1272 2935878475
1273 2935888420
1274 2935912732
1275 2935922949
1276 2935930374
1277 2935939274
1278 2935946222
1279 2935955559
1280 2935972070
1281 2935976008
1282 2935986502
1283 2935998642
1284 2936006948
1285 2936017346
1286 2936025848
1287 2936034744
1288 2936040798
1289 2936052801
1290 2936059996
1291 2940564374
1292 2941531752
1293 2941544805
1294 3005488387
1295 3005512616
1296 3005593344
1297 3005600947
1298 3005723731
1299 8006928470
1300 8016520030
1301 8016527952
1302 8016533075
1303 8016555820
1304 8016564168
1305 8016571385
1306 8016575648
1307 8016601870
1308 8016608379
1309 8016624650
1310 8017065521
1311 8019532874
1312 8019551691
1313 8019584925
1314 8019592879
1315 8019598579
1316 8019609797
1317 8019620378
1318 8019647205
1319 8019655475
1320 8019660590
1321 8019670011
1322 8019692265
1323 8055744494
1324 8056970460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04773

FecR

FecR protein

61

161

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ix9-assembly1.cif.gz_A cell surface anchoring domain 0.8323 28 99
5ix9-assembly1.cif.gz_A cell surface anchoring domain 0.7836 28 99
6ovm-assembly1.cif.gz_R crystal structure of the pseudomonas capeferrum anti-sigma regulator pupr c-terminal cell-surface signaling domain in complex with the outer membrane transporter pupb n-terminal signaling domain (semet) 0.7395 60 165
4m0n-assembly1.cif.gz_A crystal structure of a putative anti-sigma factor (bdi_1681) from parabacteroides distasonis atcc 8503 at 1.65 a resolution 0.5397 60 177
4m0h-assembly2.cif.gz_B crystal structure of a putative anti-sigma factor (bdi_1681) from parabacteroides distasonis atcc 8503 at 2.50 a resolution 0.5371 60 168
ID Description Score Start End Superfamily
af_P23485_97_238_2.60.120.1440 Mainly Beta;Sandwich;Jelly Rolls; 0.7884 62 165 2.60.120.1440
af_Q58269_2_88_2.40.128.400 Mainly Beta;Beta Barrel;Lipocalin; 0.6463 150 168 2.40.128.400
2kknA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.5399 138 167 3.60.21.10
af_Q4E3Y3_321_666_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.5219 152 170 3.60.21.10
af_A0A1D8PLY1_1_294_3.30.230.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.5212 64 89 3.30.230.70
ID Description Score Start End GO Terms
AF-T0SMR7-F1-model_v4 Uncharacterized protein 0.8532 27 118
AF-A0A661L272-F1-model_v4 Uncharacterized protein 0.8467 29 117
AF-A0A2S6T9A5-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.842 21 165 GO:0003755
AF-A0A2P8EXB3-F1-model_v4 FecR family protein 0.8094 23 165
AF-A0A3D4ZT05-F1-model_v4 FecR protein domain-containing protein 0.8085 31 164 GO:0016020

Map