F473455
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 662 | 258 | 658 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100126239|Ga0068868_1001262392 |
| Length | 227 |
| Sequence | VIRRVGPAFRSSEDTMKLWSDSWPNGERIPARYACGRLDGADGTAFSDNVNPHLAWSELPPATQSLVLVCHDFDVPSRGDDVNQAGREIPADLPRVDFFHWLLADVPVSARSIEEGALSKGFSPRGKPGPAVTVPGLERARQGINDFTGWFAGNPALAGDYYGYDGPYPPWNDSLVHHYVFTLYALSVARAPVEGRFGGAELRKAIDGHVLAEAMHSGTYTLNRRLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 2 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 3 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 4 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 158 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 172 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 173 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 174 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 188 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 189 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 190 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 191 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 192 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 193 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 230 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 232 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 233 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 245 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 246 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 247 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 248 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 253 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 254 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0.15 |
| Isolates | 0.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.63 |
| Nodule | 0.6 |
| Rhizoplane | 3.78 |
| Rhizosphere | 90.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000137 | 3300003187 | Bacteria | 96370 |
| 2 | rootL2_10176069 | 3300003322 | Bacteria | 2021 |
| 3 | Ga0055524_1000139 | 3300003775 | Bacteria | 86430 |
| 4 | Ga0055530_10001259 | 3300003791 | Bacteria | 19200 |
| 5 | Ga0055540_1000090 | 3300003792 | Bacteria | 99454 |
| 6 | Ga0055540_1000091 | 3300003792 | Bacteria | 99089 |
| 7 | Ga0055531_10014159 | 3300003794 | Bacteria | 3615 |
| 8 | Ga0065707_10083353 | 3300005295 | Bacteria | 9453 |
| 9 | Ga0070658_10006609 | 3300005327 | Bacteria | 9401 |
| 10 | Ga0070658_10098024 | 3300005327 | Bacteria | 2421 |
| 11 | Ga0070676_10007521 | 3300005328 | Bacteria | 5850 |
| 12 | Ga0070676_10010297 | 3300005328 | Bacteria | 5070 |
| 13 | Ga0070676_10257501 | 3300005328 | Bacteria | 1167 |
| 14 | Ga0070676_10259763 | 3300005328 | Bacteria | 1162 |
| 15 | Ga0070683_100018476 | 3300005329 | Bacteria | 6176 |
| 16 | Ga0070683_100582306 | 3300005329 | Bacteria | 1070 |
| 17 | Ga0070683_100808641 | 3300005329 | Bacteria | 899 |
| 18 | Ga0070690_100193669 | 3300005330 | Bacteria | 1411 |
| 19 | Ga0070670_100000527 | 3300005331 | Bacteria | 30691 |
| 20 | Ga0070670_100038384 | 3300005331 | Bacteria | 4118 |
| 21 | Ga0070670_100107954 | 3300005331 | Bacteria | 2398 |
| 22 | Ga0070670_100138295 | 3300005331 | Bacteria | 2105 |
| 23 | Ga0070670_100157782 | 3300005331 | Bacteria | 1966 |
| 24 | Ga0070670_100213390 | 3300005331 | Bacteria | 1678 |
| 25 | Ga0070670_100296994 | 3300005331 | Bacteria | 1412 |
| 26 | Ga0070677_10039324 | 3300005333 | Bacteria | 1856 |
| 27 | Ga0070677_10048834 | 3300005333 | Bacteria | 1702 |
| 28 | Ga0070677_10064905 | 3300005333 | Bacteria | 1518 |
| 29 | Ga0068869_100004440 | 3300005334 | Bacteria | 8721 |
| 30 | Ga0068869_100012807 | 3300005334 | Bacteria | 5549 |
| 31 | Ga0068869_100020181 | 3300005334 | Bacteria | 4566 |
| 32 | Ga0068869_100217947 | 3300005334 | Bacteria | 1511 |
| 33 | Ga0068869_100375644 | 3300005334 | Bacteria | 1164 |
| 34 | Ga0070666_10002033 | 3300005335 | Bacteria | 12294 |
| 35 | Ga0070666_10185178 | 3300005335 | Bacteria | 1462 |
| 36 | Ga0070680_100006667 | 3300005336 | Bacteria | 8787 |
| 37 | Ga0068868_100001810 | 3300005338 | Bacteria | 14685 |
| 38 | Ga0068868_100007261 | 3300005338 | Bacteria | 7882 |
| 39 | Ga0068868_100072102 | 3300005338 | Bacteria | 2755 |
| 40 | Ga0068868_100126239 | 3300005338 | Bacteria | 2090 |
| 41 | Ga0068868_100129245 | 3300005338 | Bacteria | 2066 |
| 42 | Ga0068868_100161654 | 3300005338 | Bacteria | 1850 |
| 43 | Ga0068868_100183562 | 3300005338 | Bacteria | 1737 |
| 44 | Ga0068868_100955561 | 3300005338 | Bacteria | 782 |
| 45 | Ga0070660_100022549 | 3300005339 | Bacteria | 4657 |
| 46 | Ga0070689_100093357 | 3300005340 | Bacteria | 2375 |
| 47 | Ga0070687_100007199 | 3300005343 | Bacteria | 4617 |
| 48 | Ga0070661_100005399 | 3300005344 | Bacteria | 8811 |
| 49 | Ga0070661_100055228 | 3300005344 | Bacteria | 2908 |
| 50 | Ga0070661_100093101 | 3300005344 | Bacteria | 2233 |
| 51 | Ga0070661_100659701 | 3300005344 | Bacteria | 850 |
| 52 | Ga0070692_10139895 | 3300005345 | Bacteria | 1369 |
| 53 | Ga0070668_100004185 | 3300005347 | Bacteria | 10693 |
| 54 | Ga0070668_100010936 | 3300005347 | Bacteria | 6752 |
| 55 | Ga0070668_100044298 | 3300005347 | Bacteria | 3414 |
| 56 | Ga0070669_100063158 | 3300005353 | Bacteria | 2725 |
| 57 | Ga0070669_100186002 | 3300005353 | Bacteria | 1627 |
| 58 | Ga0070669_100319221 | 3300005353 | Bacteria | 1254 |
| 59 | Ga0070675_100002331 | 3300005354 | Bacteria | 14118 |
| 60 | Ga0070675_100011552 | 3300005354 | Bacteria | 6917 |
| 61 | Ga0070675_100013401 | 3300005354 | Bacteria | 6443 |
| 62 | Ga0070675_100190348 | 3300005354 | Bacteria | 1777 |
| 63 | Ga0070675_100257834 | 3300005354 | Bacteria | 1527 |
| 64 | Ga0070675_100277368 | 3300005354 | Bacteria | 1472 |
| 65 | Ga0070671_100004867 | 3300005355 | Bacteria | 10682 |
| 66 | Ga0070671_100006569 | 3300005355 | Bacteria | 9298 |
| 67 | Ga0070671_100038919 | 3300005355 | Bacteria | 3947 |
| 68 | Ga0070671_100176529 | 3300005355 | Bacteria | 1808 |
| 69 | Ga0070671_100314287 | 3300005355 | Bacteria | 1335 |
| 70 | Ga0070674_100001965 | 3300005356 | Bacteria | 11241 |
| 71 | Ga0070674_100113475 | 3300005356 | Bacteria | 1994 |
| 72 | Ga0070674_100208739 | 3300005356 | Bacteria | 1512 |
| 73 | Ga0070673_100009152 | 3300005364 | Bacteria | 6635 |
| 74 | Ga0070673_100109832 | 3300005364 | Bacteria | 2285 |
| 75 | Ga0070673_100212439 | 3300005364 | Bacteria | 1672 |
| 76 | Ga0070673_100225610 | 3300005364 | Bacteria | 1623 |
| 77 | Ga0070673_100886691 | 3300005364 | Bacteria | 827 |
| 78 | Ga0070688_100038594 | 3300005365 | Bacteria | 2918 |
| 79 | Ga0070688_100477381 | 3300005365 | Bacteria | 937 |
| 80 | Ga0070659_100021242 | 3300005366 | Bacteria | 4939 |
| 81 | Ga0070659_100022737 | 3300005366 | Bacteria | 4789 |
| 82 | Ga0070659_100185871 | 3300005366 | Bacteria | 1707 |
| 83 | Ga0070667_100007789 | 3300005367 | Bacteria | 8881 |
| 84 | Ga0070667_100009094 | 3300005367 | Bacteria | 8219 |
| 85 | Ga0070667_100016258 | 3300005367 | Bacteria | 6154 |
| 86 | Ga0070700_100014555 | 3300005441 | Bacteria | 4443 |
| 87 | Ga0070700_100039713 | 3300005441 | Bacteria | 2877 |
| 88 | Ga0070700_100120998 | 3300005441 | Bacteria | 1754 |
| 89 | Ga0070663_100002951 | 3300005455 | Bacteria | 9688 |
| 90 | Ga0070663_100059788 | 3300005455 | Bacteria | 2739 |
| 91 | Ga0070663_100079636 | 3300005455 | Bacteria | 2404 |
| 92 | Ga0070678_100007587 | 3300005456 | Bacteria | 6443 |
| 93 | Ga0070678_100090304 | 3300005456 | Bacteria | 2347 |
| 94 | Ga0070678_100097700 | 3300005456 | Bacteria | 2269 |
| 95 | Ga0070678_100102186 | 3300005456 | Bacteria | 2224 |
| 96 | Ga0070678_100139566 | 3300005456 | Bacteria | 1937 |
| 97 | Ga0070678_100359330 | 3300005456 | Bacteria | 1254 |
| 98 | Ga0070678_100497193 | 3300005456 | Bacteria | 1075 |
| 99 | Ga0070678_100958460 | 3300005456 | Bacteria | 785 |
| 100 | Ga0070662_100004754 | 3300005457 | Bacteria | 8600 |
| 101 | Ga0070662_100021079 | 3300005457 | Bacteria | 4446 |
| 102 | Ga0070662_100048266 | 3300005457 | Bacteria | 3066 |
| 103 | Ga0070662_100069085 | 3300005457 | Bacteria | 2599 |
| 104 | Ga0070662_100374633 | 3300005457 | Bacteria | 1171 |
| 105 | Ga0068867_100004555 | 3300005459 | Bacteria | 9747 |
| 106 | Ga0068867_100020712 | 3300005459 | Bacteria | 4687 |
| 107 | Ga0068867_100111341 | 3300005459 | Bacteria | 2103 |
| 108 | Ga0068867_100236353 | 3300005459 | Bacteria | 1480 |
| 109 | Ga0070679_100017999 | 3300005530 | Bacteria | 6848 |
| 110 | Ga0070684_100275307 | 3300005535 | Bacteria | 1541 |
| 111 | Ga0070684_100727427 | 3300005535 | Bacteria | 926 |
| 112 | Ga0068853_100038341 | 3300005539 | Bacteria | 4081 |
| 113 | Ga0068853_100078421 | 3300005539 | Bacteria | 2887 |
| 114 | Ga0068853_100224810 | 3300005539 | Bacteria | 1715 |
| 115 | Ga0068853_100377449 | 3300005539 | Bacteria | 1323 |
| 116 | Ga0070672_100001982 | 3300005543 | Bacteria | 12830 |
| 117 | Ga0070672_100004824 | 3300005543 | Bacteria | 8860 |
| 118 | Ga0070672_100008163 | 3300005543 | Bacteria | 7156 |
| 119 | Ga0070672_100028822 | 3300005543 | Bacteria | 4157 |
| 120 | Ga0070672_100073815 | 3300005543 | Bacteria | 2719 |
| 121 | Ga0070672_100084070 | 3300005543 | Bacteria | 2555 |
| 122 | Ga0070672_100105115 | 3300005543 | Bacteria | 2295 |
| 123 | Ga0070672_100137927 | 3300005543 | Bacteria | 2010 |
| 124 | Ga0070672_100275152 | 3300005543 | Bacteria | 1422 |
| 125 | Ga0070672_100367085 | 3300005543 | Bacteria | 1229 |
| 126 | Ga0070672_100688434 | 3300005543 | Bacteria | 895 |
| 127 | Ga0070693_100005436 | 3300005547 | Bacteria | 6120 |
| 128 | Ga0070693_100006153 | 3300005547 | Bacteria | 5815 |
| 129 | Ga0070693_100070902 | 3300005547 | Bacteria | 2052 |
| 130 | Ga0068855_100018722 | 3300005563 | Bacteria | 8325 |
| 131 | Ga0068855_100410942 | 3300005563 | Bacteria | 1482 |
| 132 | Ga0068855_100851532 | 3300005563 | Bacteria | 966 |
| 133 | Ga0070664_100008904 | 3300005564 | Bacteria | 8133 |
| 134 | Ga0070664_100228096 | 3300005564 | Bacteria | 1669 |
| 135 | Ga0070664_100282262 | 3300005564 | Bacteria | 1498 |
| 136 | Ga0070664_100296020 | 3300005564 | Bacteria | 1461 |
| 137 | Ga0068857_100013495 | 3300005577 | Bacteria | 7117 |
| 138 | Ga0068854_100058976 | 3300005578 | Bacteria | 2772 |
| 139 | Ga0068854_100067551 | 3300005578 | Bacteria | 2604 |
| 140 | Ga0068856_100021431 | 3300005614 | Bacteria | 6283 |
| 141 | Ga0068856_100617867 | 3300005614 | Bacteria | 1105 |
| 142 | Ga0070702_100028970 | 3300005615 | Bacteria | 3006 |
| 143 | Ga0070702_100084844 | 3300005615 | Bacteria | 1906 |
| 144 | Ga0070702_100235883 | 3300005615 | Bacteria | 1232 |
| 145 | Ga0070702_100763831 | 3300005615 | Bacteria | 744 |
| 146 | Ga0068852_100003024 | 3300005616 | Bacteria | 11700 |
| 147 | Ga0068852_100006821 | 3300005616 | Bacteria | 8293 |
| 148 | Ga0068852_100028674 | 3300005616 | Bacteria | 4561 |
| 149 | Ga0068852_100030751 | 3300005616 | Bacteria | 4424 |
| 150 | Ga0068852_100129301 | 3300005616 | Bacteria | 2324 |
| 151 | Ga0068852_100423490 | 3300005616 | Bacteria | 1313 |
| 152 | Ga0068859_100029554 | 3300005617 | Bacteria | 5500 |
| 153 | Ga0068859_100042793 | 3300005617 | Bacteria | 4550 |
| 154 | Ga0068859_100115004 | 3300005617 | Bacteria | 2755 |
| 155 | Ga0068859_100175376 | 3300005617 | Bacteria | 2225 |
| 156 | Ga0068864_100001527 | 3300005618 | Bacteria | 19051 |
| 157 | Ga0068864_100018338 | 3300005618 | Bacteria | 5846 |
| 158 | Ga0068864_100018933 | 3300005618 | Bacteria | 5756 |
| 159 | Ga0068864_100029588 | 3300005618 | Bacteria | 4640 |
| 160 | Ga0068864_100051719 | 3300005618 | Bacteria | 3539 |
| 161 | Ga0068864_100084251 | 3300005618 | Bacteria | 2793 |
| 162 | Ga0068866_10002740 | 3300005718 | Bacteria | 7264 |
| 163 | Ga0068866_10181765 | 3300005718 | Bacteria | 1243 |
| 164 | Ga0068861_100001789 | 3300005719 | Bacteria | 13833 |
| 165 | Ga0068861_100005508 | 3300005719 | Bacteria | 8577 |
| 166 | Ga0068861_100046617 | 3300005719 | Bacteria | 3268 |
| 167 | Ga0068851_10008824 | 3300005834 | Bacteria | 4672 |
| 168 | Ga0068851_10008978 | 3300005834 | Bacteria | 4637 |
| 169 | Ga0068851_10025597 | 3300005834 | Bacteria | 2895 |
| 170 | Ga0068851_10037992 | 3300005834 | Bacteria | 2414 |
| 171 | Ga0068851_10063620 | 3300005834 | Bacteria | 1895 |
| 172 | Ga0068851_10113053 | 3300005834 | Bacteria | 1451 |
| 173 | Ga0068870_10092273 | 3300005840 | Bacteria | 1696 |
| 174 | Ga0068863_100007547 | 3300005841 | Bacteria | 10637 |
| 175 | Ga0068863_100016334 | 3300005841 | Bacteria | 7123 |
| 176 | Ga0068863_100387218 | 3300005841 | Bacteria | 1366 |
| 177 | Ga0068863_100389591 | 3300005841 | Bacteria | 1361 |
| 178 | Ga0068863_100390450 | 3300005841 | Bacteria | 1360 |
| 179 | Ga0068858_100002470 | 3300005842 | Bacteria | 18659 |
| 180 | Ga0068858_100005840 | 3300005842 | Bacteria | 12023 |
| 181 | Ga0068858_100008215 | 3300005842 | Bacteria | 10036 |
| 182 | Ga0068858_100018020 | 3300005842 | Bacteria | 6613 |
| 183 | Ga0068858_100019820 | 3300005842 | Bacteria | 6288 |
| 184 | Ga0068858_100387342 | 3300005842 | Bacteria | 1342 |
| 185 | Ga0068860_100001365 | 3300005843 | Bacteria | 26507 |
| 186 | Ga0068860_100011663 | 3300005843 | Bacteria | 8664 |
| 187 | Ga0068860_100017835 | 3300005843 | Bacteria | 6913 |
| 188 | Ga0068860_100198116 | 3300005843 | Bacteria | 1945 |
| 189 | Ga0068860_101230384 | 3300005843 | Bacteria | 769 |
| 190 | Ga0068862_100002626 | 3300005844 | Bacteria | 15828 |
| 191 | Ga0068862_100025242 | 3300005844 | Bacteria | 4989 |
| 192 | Ga0068862_100032603 | 3300005844 | Bacteria | 4402 |
| 193 | Ga0068862_100035259 | 3300005844 | Bacteria | 4235 |
| 194 | Ga0068862_100116699 | 3300005844 | Bacteria | 2348 |
| 195 | Ga0068862_100166779 | 3300005844 | Bacteria | 1969 |
| 196 | Ga0068862_100491130 | 3300005844 | Bacteria | 1164 |
| 197 | Ga0075364_10001290 | 3300006051 | Bacteria | 13499 |
| 198 | Ga0075366_10010694 | 3300006195 | Bacteria | 5158 |
| 199 | Ga0075366_10025447 | 3300006195 | Bacteria | 3457 |
| 200 | Ga0097621_100015141 | 3300006237 | Bacteria | 5795 |
| 201 | Ga0097621_100026287 | 3300006237 | Bacteria | 4564 |
| 202 | Ga0097621_100085384 | 3300006237 | Bacteria | 2633 |
| 203 | Ga0097621_100114484 | 3300006237 | Bacteria | 2282 |
| 204 | Ga0097621_100338545 | 3300006237 | Bacteria | 1336 |
| 205 | Ga0097621_100919178 | 3300006237 | Bacteria | 816 |
| 206 | Ga0097621_101015610 | 3300006237 | Bacteria | 776 |
| 207 | Ga0068871_100003520 | 3300006358 | Bacteria | 10774 |
| 208 | Ga0068871_100048486 | 3300006358 | Bacteria | 3429 |
| 209 | Ga0068871_100279766 | 3300006358 | Bacteria | 1459 |
| 210 | Ga0075434_100042080 | 3300006871 | Bacteria | 4529 |
| 211 | Ga0068865_100006734 | 3300006881 | Bacteria | 7030 |
| 212 | Ga0068865_100089552 | 3300006881 | Bacteria | 2229 |
| 213 | Ga0068865_100257112 | 3300006881 | Bacteria | 1381 |
| 214 | Ga0068865_100270221 | 3300006881 | Bacteria | 1350 |
| 215 | Ga0097620_100029554 | 3300006931 | Bacteria | 5500 |
| 216 | Ga0097620_100042793 | 3300006931 | Bacteria | 4550 |
| 217 | Ga0097620_100114998 | 3300006931 | Bacteria | 2755 |
| 218 | Ga0097620_100175378 | 3300006931 | Bacteria | 2225 |
| 219 | Ga0079104_1000916 | 3300006946 | Bacteria | 23741 |
| 220 | Ga0105240_10328268 | 3300009093 | Bacteria | 1742 |
| 221 | Ga0105240_10908394 | 3300009093 | Bacteria | 947 |
| 222 | Ga0111539_10581631 | 3300009094 | Bacteria | 1304 |
| 223 | Ga0105245_10016431 | 3300009098 | Bacteria | 6456 |
| 224 | Ga0105245_10255931 | 3300009098 | Bacteria | 1702 |
| 225 | Ga0105245_10746472 | 3300009098 | Bacteria | 1014 |
| 226 | Ga0105247_10130196 | 3300009101 | Bacteria | 1639 |
| 227 | Ga0114129_10084121 | 3300009147 | Bacteria | 4418 |
| 228 | Ga0114129_11688650 | 3300009147 | Bacteria | 773 |
| 229 | Ga0105243_10020108 | 3300009148 | Bacteria | 5061 |
| 230 | Ga0105243_10040884 | 3300009148 | Bacteria | 3624 |
| 231 | Ga0105243_10353300 | 3300009148 | Bacteria | 1350 |
| 232 | Ga0105243_10648309 | 3300009148 | Bacteria | 1023 |
| 233 | Ga0105242_10058845 | 3300009176 | Bacteria | 3152 |
| 234 | Ga0105242_10337409 | 3300009176 | Bacteria | 1388 |
| 235 | Ga0105242_10350864 | 3300009176 | Bacteria | 1363 |
| 236 | Ga0105248_10011287 | 3300009177 | Bacteria | 9853 |
| 237 | Ga0105248_10039414 | 3300009177 | Bacteria | 5291 |
| 238 | Ga0105248_10047396 | 3300009177 | Bacteria | 4819 |
| 239 | Ga0105248_10083807 | 3300009177 | Bacteria | 3586 |
| 240 | Ga0105248_10186381 | 3300009177 | Bacteria | 2338 |
| 241 | Ga0105248_10339087 | 3300009177 | Bacteria | 1692 |
| 242 | Ga0105248_10473151 | 3300009177 | Bacteria | 1412 |
| 243 | Ga0105248_10522602 | 3300009177 | Bacteria | 1338 |
| 244 | Ga0105237_10031046 | 3300009545 | Bacteria | 5420 |
| 245 | Ga0105238_10093334 | 3300009551 | Bacteria | 2998 |
| 246 | Ga0105249_10010587 | 3300009553 | Bacteria | 8103 |
| 247 | Ga0105249_10015417 | 3300009553 | Bacteria | 6764 |
| 248 | Ga0105249_10017892 | 3300009553 | Bacteria | 6297 |
| 249 | Ga0105249_10293441 | 3300009553 | Bacteria | 1628 |
| 250 | Ga0105239_10196056 | 3300010375 | Bacteria | 2262 |
| 251 | Ga0157327_1003471 | 3300012512 | Bacteria | 1165 |
| 252 | Ga0157373_10007411 | 3300013100 | Bacteria | 8160 |
| 253 | Ga0157371_10130018 | 3300013102 | Bacteria | 1791 |
| 254 | Ga0157370_10439805 | 3300013104 | Bacteria | 1199 |
| 255 | Ga0157369_10049712 | 3300013105 | Bacteria | 4544 |
| 256 | Ga0157369_10213729 | 3300013105 | Bacteria | 2021 |
| 257 | Ga0157374_10006173 | 3300013296 | Bacteria | 10156 |
| 258 | Ga0157374_10389084 | 3300013296 | Bacteria | 1390 |
| 259 | Ga0157374_10709016 | 3300013296 | Bacteria | 1020 |
| 260 | Ga0157378_10003330 | 3300013297 | Bacteria | 14290 |
| 261 | Ga0157378_10748716 | 3300013297 | Bacteria | 1000 |
| 262 | Ga0163162_10005003 | 3300013306 | Bacteria | 12767 |
| 263 | Ga0163162_10006647 | 3300013306 | Bacteria | 11210 |
| 264 | Ga0163162_10012295 | 3300013306 | Bacteria | 8356 |
| 265 | Ga0163162_10019368 | 3300013306 | Bacteria | 6674 |
| 266 | Ga0163162_10098355 | 3300013306 | Bacteria | 3015 |
| 267 | Ga0163162_10193774 | 3300013306 | Bacteria | 2160 |
| 268 | Ga0163162_10232968 | 3300013306 | Bacteria | 1972 |
| 269 | Ga0157372_10008138 | 3300013307 | Bacteria | 11151 |
| 270 | Ga0157372_10024157 | 3300013307 | Bacteria | 6597 |
| 271 | Ga0157375_10011278 | 3300013308 | Bacteria | 7889 |
| 272 | Ga0157375_10024455 | 3300013308 | Bacteria | 5590 |
| 273 | Ga0157375_10040792 | 3300013308 | Bacteria | 4478 |
| 274 | Ga0157375_10062210 | 3300013308 | Bacteria | 3708 |
| 275 | Ga0157375_10239374 | 3300013308 | Bacteria | 1974 |
| 276 | Ga0157375_10522370 | 3300013308 | Bacteria | 1350 |
| 277 | Ga0157375_10966194 | 3300013308 | Bacteria | 993 |
| 278 | Ga0163163_10001523 | 3300014325 | Bacteria | 19551 |
| 279 | Ga0163163_10077224 | 3300014325 | Bacteria | 3326 |
| 280 | Ga0157380_10011942 | 3300014326 | Bacteria | 6283 |
| 281 | Ga0157380_10036620 | 3300014326 | Bacteria | 3797 |
| 282 | Ga0157380_10061404 | 3300014326 | Bacteria | 3007 |
| 283 | Ga0157380_10063579 | 3300014326 | Bacteria | 2960 |
| 284 | Ga0157380_10328842 | 3300014326 | Bacteria | 1420 |
| 285 | Ga0157380_10487300 | 3300014326 | Bacteria | 1194 |
| 286 | Ga0157377_10002400 | 3300014745 | Bacteria | 8267 |
| 287 | Ga0157379_10002555 | 3300014968 | Bacteria | 15267 |
| 288 | Ga0157379_10003481 | 3300014968 | Bacteria | 13328 |
| 289 | Ga0157379_10004289 | 3300014968 | Bacteria | 12180 |
| 290 | Ga0157379_10007487 | 3300014968 | Bacteria | 9453 |
| 291 | Ga0157379_10014842 | 3300014968 | Bacteria | 6832 |
| 292 | Ga0157379_10029042 | 3300014968 | Bacteria | 4917 |
| 293 | Ga0157379_10052764 | 3300014968 | Bacteria | 3631 |
| 294 | Ga0157379_10141241 | 3300014968 | Bacteria | 2171 |
| 295 | Ga0157379_10372931 | 3300014968 | Bacteria | 1309 |
| 296 | Ga0157376_10003563 | 3300014969 | Bacteria | 10736 |
| 297 | Ga0157376_10005881 | 3300014969 | Bacteria | 8606 |
| 298 | Ga0157376_10068596 | 3300014969 | Bacteria | 3003 |
| 299 | Ga0157376_10171775 | 3300014969 | Bacteria | 1975 |
| 300 | Ga0157376_10261357 | 3300014969 | Bacteria | 1622 |
| 301 | Ga0157376_10385587 | 3300014969 | Bacteria | 1351 |
| 302 | Ga0163161_10020312 | 3300017792 | Bacteria | 4660 |
| 303 | Ga0163161_10042513 | 3300017792 | Bacteria | 3269 |
| 304 | Ga0163161_10044600 | 3300017792 | Bacteria | 3194 |
| 305 | Ga0163161_10080670 | 3300017792 | Bacteria | 2395 |
| 306 | Ga0163161_10144445 | 3300017792 | Bacteria | 1804 |
| 307 | Ga0163161_10712424 | 3300017792 | Bacteria | 837 |
| 308 | Ga0207666_1002213 | 3300025271 | Bacteria | 2332 |
| 309 | Ga0209025_1000071 | 3300025294 | Bacteria | 287297 |
| 310 | Ga0209050_1000326 | 3300025298 | Bacteria | 95495 |
| 311 | Ga0209050_1000967 | 3300025298 | Bacteria | 36985 |
| 312 | Ga0209050_1001375 | 3300025298 | Bacteria | 26556 |
| 313 | Ga0209050_1036330 | 3300025298 | Bacteria | 1440 |
| 314 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 315 | Ga0209051_1000133 | 3300025303 | Bacteria | 139014 |
| 316 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 317 | Ga0207697_10013496 | 3300025315 | Bacteria | 3408 |
| 318 | Ga0207697_10145965 | 3300025315 | Bacteria | 1028 |
| 319 | Ga0207656_10008357 | 3300025321 | Bacteria | 3806 |
| 320 | Ga0207656_10009070 | 3300025321 | Bacteria | 3687 |
| 321 | Ga0207656_10192548 | 3300025321 | Bacteria | 982 |
| 322 | Ga0207682_10005021 | 3300025893 | Bacteria | 5426 |
| 323 | Ga0207682_10019663 | 3300025893 | Bacteria | 2645 |
| 324 | Ga0207682_10032538 | 3300025893 | Bacteria | 2096 |
| 325 | Ga0207682_10036448 | 3300025893 | Bacteria | 1990 |
| 326 | Ga0207682_10194352 | 3300025893 | Bacteria | 931 |
| 327 | Ga0207642_10002738 | 3300025899 | Bacteria | 5505 |
| 328 | Ga0207642_10016280 | 3300025899 | Bacteria | 2796 |
| 329 | Ga0207688_10007645 | 3300025901 | Bacteria | 5886 |
| 330 | Ga0207688_10018395 | 3300025901 | Bacteria | 3802 |
| 331 | Ga0207688_10199000 | 3300025901 | Bacteria | 1200 |
| 332 | Ga0207680_10003179 | 3300025903 | Bacteria | 7715 |
| 333 | Ga0207680_10169734 | 3300025903 | Bacteria | 1468 |
| 334 | Ga0207645_10007079 | 3300025907 | Bacteria | 7978 |
| 335 | Ga0207645_10017927 | 3300025907 | Bacteria | 4668 |
| 336 | Ga0207645_10184291 | 3300025907 | Bacteria | 1370 |
| 337 | Ga0207645_10270625 | 3300025907 | Bacteria | 1126 |
| 338 | Ga0207705_10132723 | 3300025909 | Bacteria | 1854 |
| 339 | Ga0207654_10037247 | 3300025911 | Bacteria | 2721 |
| 340 | Ga0207707_10069401 | 3300025912 | Bacteria | 3071 |
| 341 | Ga0207695_10184325 | 3300025913 | Bacteria | 2007 |
| 342 | Ga0207671_10080690 | 3300025914 | Bacteria | 2439 |
| 343 | Ga0207660_10013406 | 3300025917 | Bacteria | 5372 |
| 344 | Ga0207662_10802386 | 3300025918 | Bacteria | 663 |
| 345 | Ga0207657_10061349 | 3300025919 | Bacteria | 3224 |
| 346 | Ga0207657_10112825 | 3300025919 | Bacteria | 2243 |
| 347 | Ga0207649_10023850 | 3300025920 | Bacteria | 3548 |
| 348 | Ga0207649_10038984 | 3300025920 | Bacteria | 2879 |
| 349 | Ga0207649_10172645 | 3300025920 | Bacteria | 1507 |
| 350 | Ga0207652_10030599 | 3300025921 | Bacteria | 4509 |
| 351 | Ga0207681_10003817 | 3300025923 | Bacteria | 9343 |
| 352 | Ga0207681_10364662 | 3300025923 | Bacteria | 1159 |
| 353 | Ga0207694_10015426 | 3300025924 | Bacteria | 5762 |
| 354 | Ga0207694_10019601 | 3300025924 | Bacteria | 5115 |
| 355 | Ga0207650_10000382 | 3300025925 | Bacteria | 41562 |
| 356 | Ga0207650_10017187 | 3300025925 | Bacteria | 5063 |
| 357 | Ga0207650_10055425 | 3300025925 | Bacteria | 2943 |
| 358 | Ga0207650_10072514 | 3300025925 | Bacteria | 2592 |
| 359 | Ga0207650_10286547 | 3300025925 | Bacteria | 1342 |
| 360 | Ga0207650_10379448 | 3300025925 | Bacteria | 1167 |
| 361 | Ga0207650_10522543 | 3300025925 | Bacteria | 993 |
| 362 | Ga0207659_10002417 | 3300025926 | Bacteria | 11122 |
| 363 | Ga0207659_10006243 | 3300025926 | Bacteria | 7290 |
| 364 | Ga0207659_10007553 | 3300025926 | Bacteria | 6696 |
| 365 | Ga0207659_10017327 | 3300025926 | Bacteria | 4705 |
| 366 | Ga0207659_10023241 | 3300025926 | Bacteria | 4134 |
| 367 | Ga0207659_10027687 | 3300025926 | Bacteria | 3841 |
| 368 | Ga0207659_10183021 | 3300025926 | Bacteria | 1662 |
| 369 | Ga0207687_10017347 | 3300025927 | Bacteria | 4739 |
| 370 | Ga0207687_10032593 | 3300025927 | Bacteria | 3529 |
| 371 | Ga0207687_10210725 | 3300025927 | Bacteria | 1524 |
| 372 | Ga0207644_10009179 | 3300025931 | Bacteria | 6485 |
| 373 | Ga0207644_10010498 | 3300025931 | Bacteria | 6105 |
| 374 | Ga0207644_10042039 | 3300025931 | Bacteria | 3237 |
| 375 | Ga0207644_10186631 | 3300025931 | Bacteria | 1628 |
| 376 | Ga0207644_10367443 | 3300025931 | Bacteria | 1171 |
| 377 | Ga0207644_10403898 | 3300025931 | Bacteria | 1117 |
| 378 | Ga0207690_10005702 | 3300025932 | Bacteria | 7355 |
| 379 | Ga0207690_10178692 | 3300025932 | Bacteria | 1596 |
| 380 | Ga0207706_10001995 | 3300025933 | Bacteria | 19971 |
| 381 | Ga0207706_10009005 | 3300025933 | Bacteria | 9185 |
| 382 | Ga0207706_10075908 | 3300025933 | Bacteria | 2956 |
| 383 | Ga0207706_10245012 | 3300025933 | Bacteria | 1566 |
| 384 | Ga0207706_10340536 | 3300025933 | Bacteria | 1305 |
| 385 | Ga0207706_10544722 | 3300025933 | Bacteria | 999 |
| 386 | Ga0207686_10024985 | 3300025934 | Bacteria | 3469 |
| 387 | Ga0207686_10211559 | 3300025934 | Bacteria | 1394 |
| 388 | Ga0207686_11031600 | 3300025934 | Bacteria | 668 |
| 389 | Ga0207709_10010409 | 3300025935 | Bacteria | 5120 |
| 390 | Ga0207709_10229289 | 3300025935 | Bacteria | 1344 |
| 391 | Ga0207669_10011790 | 3300025937 | Bacteria | 4270 |
| 392 | Ga0207669_10090965 | 3300025937 | Bacteria | 1986 |
| 393 | Ga0207669_10217933 | 3300025937 | Bacteria | 1398 |
| 394 | Ga0207704_10002822 | 3300025938 | Bacteria | 7837 |
| 395 | Ga0207704_10003481 | 3300025938 | Bacteria | 7159 |
| 396 | Ga0207704_10061980 | 3300025938 | Bacteria | 2323 |
| 397 | Ga0207704_10111635 | 3300025938 | Bacteria | 1849 |
| 398 | Ga0207691_10004985 | 3300025940 | Bacteria | 12806 |
| 399 | Ga0207691_10010603 | 3300025940 | Bacteria | 8839 |
| 400 | Ga0207691_10035897 | 3300025940 | Bacteria | 4596 |
| 401 | Ga0207691_10044864 | 3300025940 | Bacteria | 4067 |
| 402 | Ga0207691_10098585 | 3300025940 | Bacteria | 2610 |
| 403 | Ga0207691_10134093 | 3300025940 | Bacteria | 2186 |
| 404 | Ga0207691_10138439 | 3300025940 | Bacteria | 2146 |
| 405 | Ga0207691_10273601 | 3300025940 | Bacteria | 1454 |
| 406 | Ga0207691_10295161 | 3300025940 | Bacteria | 1393 |
| 407 | Ga0207691_10599137 | 3300025940 | Bacteria | 933 |
| 408 | Ga0207711_10015498 | 3300025941 | Bacteria | 6326 |
| 409 | Ga0207711_10043131 | 3300025941 | Bacteria | 3846 |
| 410 | Ga0207711_10058166 | 3300025941 | Bacteria | 3326 |
| 411 | Ga0207711_10084520 | 3300025941 | Bacteria | 2778 |
| 412 | Ga0207711_10106031 | 3300025941 | Bacteria | 2493 |
| 413 | Ga0207711_10127103 | 3300025941 | Bacteria | 2282 |
| 414 | Ga0207711_10261101 | 3300025941 | Bacteria | 1592 |
| 415 | Ga0207711_10536062 | 3300025941 | Bacteria | 1092 |
| 416 | Ga0207689_10000996 | 3300025942 | Bacteria | 27158 |
| 417 | Ga0207689_10005866 | 3300025942 | Bacteria | 10886 |
| 418 | Ga0207689_10019786 | 3300025942 | Bacteria | 5670 |
| 419 | Ga0207661_10119681 | 3300025944 | Bacteria | 2240 |
| 420 | Ga0207661_10617496 | 3300025944 | Bacteria | 995 |
| 421 | Ga0207679_10023086 | 3300025945 | Bacteria | 4247 |
| 422 | Ga0207679_10274027 | 3300025945 | Bacteria | 1444 |
| 423 | Ga0207679_10281902 | 3300025945 | Bacteria | 1425 |
| 424 | Ga0207679_10352500 | 3300025945 | Bacteria | 1283 |
| 425 | Ga0207679_10366783 | 3300025945 | Bacteria | 1259 |
| 426 | Ga0207679_10571510 | 3300025945 | Bacteria | 1016 |
| 427 | Ga0207651_10005465 | 3300025960 | Bacteria | 6527 |
| 428 | Ga0207651_10032421 | 3300025960 | Bacteria | 3355 |
| 429 | Ga0207651_10033408 | 3300025960 | Bacteria | 3318 |
| 430 | Ga0207651_10122313 | 3300025960 | Bacteria | 1976 |
| 431 | Ga0207712_10002952 | 3300025961 | Bacteria | 10857 |
| 432 | Ga0207712_10087613 | 3300025961 | Bacteria | 2284 |
| 433 | Ga0207712_10165533 | 3300025961 | Bacteria | 1723 |
| 434 | Ga0207668_10018678 | 3300025972 | Bacteria | 4369 |
| 435 | Ga0207668_10028532 | 3300025972 | Bacteria | 3650 |
| 436 | Ga0207668_10172783 | 3300025972 | Bacteria | 1696 |
| 437 | Ga0207668_10390918 | 3300025972 | Bacteria | 1173 |
| 438 | Ga0207640_10005754 | 3300025981 | Bacteria | 6757 |
| 439 | Ga0207640_10055919 | 3300025981 | Bacteria | 2587 |
| 440 | Ga0207640_10057330 | 3300025981 | Bacteria | 2561 |
| 441 | Ga0207658_10000181 | 3300025986 | Bacteria | 67700 |
| 442 | Ga0207658_10007082 | 3300025986 | Bacteria | 7640 |
| 443 | Ga0207658_10030504 | 3300025986 | Bacteria | 3818 |
| 444 | Ga0207658_10137721 | 3300025986 | Bacteria | 1971 |
| 445 | Ga0207677_10000853 | 3300026023 | Bacteria | 17454 |
| 446 | Ga0207677_10016079 | 3300026023 | Bacteria | 4421 |
| 447 | Ga0207677_10035612 | 3300026023 | Bacteria | 3235 |
| 448 | Ga0207677_10057068 | 3300026023 | Bacteria | 2679 |
| 449 | Ga0207677_10591141 | 3300026023 | Bacteria | 973 |
| 450 | Ga0207703_10000907 | 3300026035 | Bacteria | 28985 |
| 451 | Ga0207703_10002895 | 3300026035 | Bacteria | 14618 |
| 452 | Ga0207703_10003620 | 3300026035 | Bacteria | 12891 |
| 453 | Ga0207703_10026824 | 3300026035 | Bacteria | 4537 |
| 454 | Ga0207639_10051155 | 3300026041 | Bacteria | 3141 |
| 455 | Ga0207639_10553653 | 3300026041 | Bacteria | 1056 |
| 456 | Ga0207639_10825815 | 3300026041 | Bacteria | 864 |
| 457 | Ga0207678_10003624 | 3300026067 | Bacteria | 13877 |
| 458 | Ga0207678_10072781 | 3300026067 | Bacteria | 2945 |
| 459 | Ga0207678_10126976 | 3300026067 | Bacteria | 2175 |
| 460 | Ga0207678_10150777 | 3300026067 | Bacteria | 1985 |
| 461 | Ga0207708_10013014 | 3300026075 | Bacteria | 6207 |
| 462 | Ga0207708_10030177 | 3300026075 | Bacteria | 4112 |
| 463 | Ga0207708_10096148 | 3300026075 | Bacteria | 2288 |
| 464 | Ga0207702_10011735 | 3300026078 | Bacteria | 7298 |
| 465 | Ga0207702_10268091 | 3300026078 | Bacteria | 1610 |
| 466 | Ga0207702_10551717 | 3300026078 | Bacteria | 1127 |
| 467 | Ga0207702_10561089 | 3300026078 | Bacteria | 1118 |
| 468 | Ga0207641_10005494 | 3300026088 | Bacteria | 10811 |
| 469 | Ga0207641_10006799 | 3300026088 | Bacteria | 9582 |
| 470 | Ga0207641_10076167 | 3300026088 | Bacteria | 2899 |
| 471 | Ga0207641_10563026 | 3300026088 | Bacteria | 1112 |
| 472 | Ga0207641_10777422 | 3300026088 | Bacteria | 946 |
| 473 | Ga0207648_10000419 | 3300026089 | Bacteria | 46680 |
| 474 | Ga0207648_10018549 | 3300026089 | Bacteria | 6297 |
| 475 | Ga0207648_10051037 | 3300026089 | Bacteria | 3616 |
| 476 | Ga0207648_10306586 | 3300026089 | Bacteria | 1425 |
| 477 | Ga0207676_10002438 | 3300026095 | Bacteria | 13252 |
| 478 | Ga0207676_10012441 | 3300026095 | Bacteria | 6098 |
| 479 | Ga0207676_10013882 | 3300026095 | Bacteria | 5783 |
| 480 | Ga0207676_10016864 | 3300026095 | Bacteria | 5288 |
| 481 | Ga0207676_10064169 | 3300026095 | Bacteria | 2919 |
| 482 | Ga0207676_10081670 | 3300026095 | Bacteria | 2626 |
| 483 | Ga0207676_10294065 | 3300026095 | Bacteria | 1480 |
| 484 | Ga0207674_10066252 | 3300026116 | Bacteria | 3638 |
| 485 | Ga0207675_100000693 | 3300026118 | Bacteria | 33301 |
| 486 | Ga0207675_100002360 | 3300026118 | Bacteria | 18687 |
| 487 | Ga0207675_100002486 | 3300026118 | Bacteria | 18250 |
| 488 | Ga0207675_100358152 | 3300026118 | Bacteria | 1431 |
| 489 | Ga0207683_10002157 | 3300026121 | Bacteria | 17286 |
| 490 | Ga0207683_10055151 | 3300026121 | Bacteria | 3485 |
| 491 | Ga0207683_10084574 | 3300026121 | Bacteria | 2820 |
| 492 | Ga0207683_10093009 | 3300026121 | Bacteria | 2687 |
| 493 | Ga0207683_10124817 | 3300026121 | Bacteria | 2313 |
| 494 | Ga0207683_10196292 | 3300026121 | Bacteria | 1834 |
| 495 | Ga0207683_10200619 | 3300026121 | Bacteria | 1813 |
| 496 | Ga0207683_10440416 | 3300026121 | Bacteria | 1201 |
| 497 | Ga0207698_10007978 | 3300026142 | Bacteria | 6669 |
| 498 | Ga0207698_10046432 | 3300026142 | Bacteria | 3280 |
| 499 | Ga0207698_10104525 | 3300026142 | Bacteria | 2357 |
| 500 | Ga0207698_10180043 | 3300026142 | Bacteria | 1871 |
| 501 | Ga0207698_10253516 | 3300026142 | Bacteria | 1612 |
| 502 | Ga0207698_10291483 | 3300026142 | Bacteria | 1515 |
| 503 | Ga0207698_10535431 | 3300026142 | Bacteria | 1145 |
| 504 | Ga0209281_1000935 | 3300027111 | Bacteria | 24025 |
| 505 | Ga0209974_10002440 | 3300027876 | Bacteria | 6719 |
| 506 | Ga0268265_10012152 | 3300028380 | Bacteria | 5831 |
| 507 | Ga0268265_10013134 | 3300028380 | Bacteria | 5626 |
| 508 | Ga0268265_10014510 | 3300028380 | Bacteria | 5370 |
| 509 | Ga0268265_10058457 | 3300028380 | Bacteria | 2944 |
| 510 | Ga0268265_10163438 | 3300028380 | Bacteria | 1894 |
| 511 | Ga0268265_10474119 | 3300028380 | Bacteria | 1174 |
| 512 | Ga0268264_10001738 | 3300028381 | Bacteria | 20024 |
| 513 | Ga0268264_10007941 | 3300028381 | Bacteria | 8832 |
| 514 | Ga0268264_10039249 | 3300028381 | Bacteria | 3912 |
| 515 | Ga0268264_10102470 | 3300028381 | Bacteria | 2491 |
| 516 | Ga0268264_10134746 | 3300028381 | Bacteria | 2194 |
| 517 | Ga0268264_10291303 | 3300028381 | Bacteria | 1533 |
| 518 | Ga0307515_10018987 | 3300028794 | Bacteria | 12405 |
| 519 | Ga0265327_10164121 | 3300031251 | Bacteria | 1024 |
| 520 | Ga0307408_100075271 | 3300031548 | Bacteria | 2508 |
| 521 | Ga0307408_100221485 | 3300031548 | Bacteria | 1544 |
| 522 | Ga0307408_100336262 | 3300031548 | Bacteria | 1277 |
| 523 | Ga0307408_100353273 | 3300031548 | Bacteria | 1248 |
| 524 | Ga0307410_10204103 | 3300031852 | Bacteria | 1511 |
| 525 | Ga0307406_10019969 | 3300031901 | Bacteria | 3938 |
| 526 | Ga0307406_10178724 | 3300031901 | Bacteria | 1543 |
| 527 | Ga0307412_10026713 | 3300031911 | Bacteria | 3592 |
| 528 | Ga0307412_10236052 | 3300031911 | Bacteria | 1411 |
| 529 | Ga0307409_100003223 | 3300031995 | Bacteria | 8789 |
| 530 | Ga0307416_100001157 | 3300032002 | Bacteria | 14184 |
| 531 | Ga0307416_100090220 | 3300032002 | Bacteria | 2627 |
| 532 | Ga0307416_101177055 | 3300032002 | Bacteria | 872 |
| 533 | Ga0307411_10022265 | 3300032005 | Bacteria | 3727 |
| 534 | Ga0307411_10212681 | 3300032005 | Bacteria | 1494 |
| 535 | Ga0307411_10878749 | 3300032005 | Bacteria | 795 |
| 536 | Ga0307415_100135773 | 3300032126 | Bacteria | 1870 |
| 537 | Ga0307415_100323282 | 3300032126 | Bacteria | 1287 |
| 538 | Ga0373948_0019368 | 3300034817 | Bacteria | 1287 |
| 539 | Ga0373938_0004404 | 3300034957 | Bacteria | 2352 |
| 540 | Ga0373952_0062208 | 3300035092 | Bacteria | 915 |
| 541 | Ga0373923_0108112 | 3300035111 | Bacteria | 1233 |
| 542 | Ga0373939_0074949 | 3300035114 | Bacteria | 1111 |
| 543 | Ga0373945_0026236 | 3300035116 | Bacteria | 2029 |
| 544 | Ga0373945_0193126 | 3300035116 | Bacteria | 842 |
| 545 | Ga0373960_0023822 | 3300035121 | Bacteria | 1651 |
| 546 | Ga0373943_0033638 | 3300035170 | Bacteria | 2443 |
| 547 | Ga0373943_0225334 | 3300035170 | Bacteria | 1045 |
| 548 | Ga0373931_0018622 | 3300035691 | Bacteria | 3455 |
| 549 | Ga0373927_0183986 | 3300035695 | Bacteria | 1371 |
| 550 | Ga0373947_0063240 | 3300035725 | Bacteria | 2254 |
| 551 | Ga0373937_0067765 | 3300036401 | Bacteria | 3289 |
| 552 | Ga0373937_0778759 | 3300036401 | Bacteria | 904 |
| 553 | Ga0373925_0046026 | 3300037068 | Bacteria | 3243 |
| 554 | Ga0395905_0043213 | 3300037471 | Bacteria | 4228 |
| 555 | Ga0395905_0083762 | 3300037471 | Bacteria | 2987 |
| 556 | Ga0395905_0294763 | 3300037471 | Bacteria | 1509 |
| 557 | Ga0436365_1317424 | 3300039437 | Bacteria | 3014 |
| 558 | Ga0436363_0116538 | 3300039450 | Bacteria | 2399 |
| 559 | Ga0439465_0022571 | 3300041413 | Bacteria | 1978 |
| 560 | Ga0439431_0014206 | 3300041997 | Bacteria | 1844 |
| 561 | Ga0439441_017087 | 3300042001 | Bacteria | 1299 |
| 562 | Ga0439462_0056101 | 3300042015 | Bacteria | 1063 |
| 563 | Ga0450919_000090 | 3300042121 | Bacteria | 8867 |
| 564 | Ga0450894_005548 | 3300042131 | Bacteria | 1632 |
| 565 | Ga0450898_021514 | 3300042134 | Bacteria | 1137 |
| 566 | Ga0451577_0019505 | 3300042876 | Bacteria | 6234 |
| 567 | Ga0451577_0138750 | 3300042876 | Bacteria | 2184 |
| 568 | Ga0466969_0000042 | 3300044656 | Bacteria | 69271 |
| 569 | Ga0466972_0126098 | 3300044658 | Bacteria | 1206 |
| 570 | Ga0466966_0060949 | 3300044684 | Bacteria | 2380 |
| 571 | Ga0466961_0016008 | 3300044693 | Bacteria | 4814 |
| 572 | Ga0453684_0126138 | 3300044712 | Bacteria | 3080 |
| 573 | Ga0451576_0063338 | 3300045051 | Bacteria | 3854 |
| 574 | Ga0451576_0317817 | 3300045051 | Bacteria | 1629 |
| 575 | Ga0495629_0028744 | 3300046459 | Bacteria | 3947 |
| 576 | Ga0495580_0422237 | 3300046472 | Bacteria | 897 |
| 577 | Ga0495606_0001756 | 3300046507 | Bacteria | 27822 |
| 578 | Ga0495628_0422893 | 3300046516 | Bacteria | 971 |
| 579 | Ga0495586_0170313 | 3300046535 | Bacteria | 1230 |
| 580 | Ga0495598_0039809 | 3300046537 | Bacteria | 1368 |
| 581 | Ga0495598_0056259 | 3300046537 | Bacteria | 1200 |
| 582 | Ga0495645_0013570 | 3300046543 | Bacteria | 5766 |
| 583 | Ga0495645_0131443 | 3300046543 | Bacteria | 1753 |
| 584 | Ga0495622_0000548 | 3300046557 | Bacteria | 22559 |
| 585 | Ga0495647_0145359 | 3300046681 | Bacteria | 1013 |
| 586 | Ga0495658_0014662 | 3300046683 | Bacteria | 4009 |
| 587 | Ga0495658_0028575 | 3300046683 | Bacteria | 3012 |
| 588 | Ga0495658_0106316 | 3300046683 | Bacteria | 1682 |
| 589 | Ga0495658_0358347 | 3300046683 | Bacteria | 927 |
| 590 | Ga0495613_0209940 | 3300046689 | Bacteria | 1370 |
| 591 | Ga0495673_0000074 | 3300047469 | Bacteria | 210788 |
| 592 | Ga0495681_0050673 | 3300047470 | Bacteria | 1956 |
| 593 | Ga0495684_0011588 | 3300047471 | Bacteria | 6808 |
| 594 | Ga0495684_0530748 | 3300047471 | Bacteria | 804 |
| 595 | Ga0495615_0018856 | 3300048090 | Bacteria | 1525 |
| 596 | Ga0496100_0056827 | 3300048903 | Bacteria | 2561 |
| 597 | Ga0496100_0238573 | 3300048903 | Bacteria | 1341 |
| 598 | Ga0496101_0009418 | 3300048904 | Bacteria | 6420 |
| 599 | Ga0496102_0027006 | 3300048905 | Bacteria | 5126 |
| 600 | Ga0496104_0170815 | 3300048907 | Bacteria | 2085 |
| 601 | Ga0496105_0115513 | 3300048908 | Bacteria | 2214 |
| 602 | Ga0496106_0005857 | 3300048909 | Bacteria | 9092 |
| 603 | Ga0496107_0027177 | 3300048910 | Bacteria | 4063 |
| 604 | Ga0496107_0690777 | 3300048910 | Bacteria | 751 |
| 605 | Ga0496108_0021455 | 3300048911 | Bacteria | 5310 |
| 606 | Ga0496108_0064837 | 3300048911 | Bacteria | 3078 |
| 607 | Ga0496108_0221191 | 3300048911 | Bacteria | 1645 |
| 608 | Ga0496108_0257570 | 3300048911 | Bacteria | 1518 |
| 609 | Ga0496109_0029766 | 3300048912 | Bacteria | 4892 |
| 610 | Ga0496109_0131042 | 3300048912 | Bacteria | 2340 |
| 611 | Ga0496109_0170283 | 3300048912 | Bacteria | 2043 |
| 612 | Ga0496110_0102205 | 3300048913 | Bacteria | 2570 |
| 613 | Ga0496110_0303618 | 3300048913 | Bacteria | 1454 |
| 614 | Ga0496112_0589124 | 3300048915 | Bacteria | 1044 |
| 615 | Ga0496113_0065359 | 3300048916 | Bacteria | 2753 |
| 616 | Ga0496113_0382817 | 3300048916 | Bacteria | 1129 |
| 617 | Ga0496114_0006581 | 3300048917 | Bacteria | 9162 |
| 618 | Ga0496114_0086137 | 3300048917 | Bacteria | 2662 |
| 619 | Ga0496114_0091595 | 3300048917 | Bacteria | 2582 |
| 620 | Ga0496114_0304126 | 3300048917 | Bacteria | 1408 |
| 621 | Ga0496124_0192102 | 3300048927 | Bacteria | 1561 |
| 622 | Ga0501305_052890 | 3300049161 | Bacteria | 685 |
| 623 | Ga0501290_046462 | 3300049513 | Bacteria | 665 |
| 624 | Ga0501292_020734 | 3300049515 | Bacteria | 1061 |
| 625 | Ga0501033_0236757 | 3300049570 | Bacteria | 1295 |
| 626 | Ga0501034_0372907 | 3300049571 | Bacteria | 1353 |
| 627 | Ga0501036_0213592 | 3300049572 | Bacteria | 1621 |
| 628 | Ga0501036_1256421 | 3300049572 | Bacteria | 603 |
| 629 | Ga0501037_0187688 | 3300049573 | Bacteria | 1465 |
| 630 | Ga0501039_0307911 | 3300049575 | Bacteria | 1245 |
| 631 | Ga0501043_0000277 | 3300049579 | Bacteria | 46284 |
| 632 | Ga0501046_0000345 | 3300049580 | Bacteria | 46730 |
| 633 | Ga0501046_0252836 | 3300049580 | Bacteria | 1297 |
| 634 | Ga0501047_0000395 | 3300049581 | Bacteria | 48969 |
| 635 | Ga0501047_0006218 | 3300049581 | Bacteria | 11224 |
| 636 | Ga0501048_0000111 | 3300049582 | Bacteria | 46009 |
| 637 | Ga0501072_0467810 | 3300049588 | Bacteria | 998 |
| 638 | Ga0501075_0022224 | 3300049591 | Bacteria | 4632 |
| 639 | Ga0501198_000023 | 3300049649 | Bacteria | 69100 |
| 640 | Ga0501207_014093 | 3300049654 | Bacteria | 1217 |
| 641 | Ga0501253_013192 | 3300049683 | Bacteria | 1311 |
| 642 | Ga0501257_016938 | 3300049686 | Bacteria | 1693 |
| 643 | Ga0501262_013596 | 3300049759 | Bacteria | 1051 |
| 644 | Ga0501035_0017204 | 3300049822 | Bacteria | 6664 |
| 645 | Ga0501044_0030603 | 3300049823 | Bacteria | 5671 |
| 646 | Ga0501045_0017605 | 3300049824 | Bacteria | 5074 |
| 647 | Ga0501045_0763089 | 3300049824 | Bacteria | 713 |
| 648 | nmdc:mga00v17_43511_c1 | 3300050491 | Bacteria | 2705 |
| 649 | nmdc:mga0k408_146009_c1 | 3300050493 | Bacteria | 772 |
| 650 | nmdc:mga0k408_249378_c1 | 3300050493 | Bacteria | 1060 |
| 651 | nmdc:mga0k408_28834_c1 | 3300050493 | Bacteria | 3157 |
| 652 | nmdc:mga0k408_9843_c1 | 3300050493 | Bacteria | 5161 |
| 653 | nmdc:mga0n895_70256_c1 | 3300050512 | Bacteria | 3470 |
| 654 | Ga0495601_0120834 | 3300053077 | Bacteria | 1701 |
| 655 | Ga0495601_0430729 | 3300053077 | Bacteria | 854 |
| 656 | Ga0495619_0025876 | 3300053085 | Bacteria | 3772 |
| 657 | Ga0500627_0039830 | 3300053158 | Bacteria | 2014 |
| 658 | Ga0500634_0084755 | 3300053161 | Bacteria | 1623 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049572 | Ga0501036_1256421 | Ga0501036_1256421_56_592 | 178 |
| 2 | 3300049824 | Ga0501045_0017605 | Ga0501045_0017605_4514_5056 | 180 |
| 3 | 3300042001 | Ga0439441_017087 | Ga0439441_017087_725_1270 | 181 |
| 4 | 3300025901 | Ga0207688_10199000 | Ga0207688_101990002 | 200 |
| 5 | 3300005456 | Ga0070678_100090304 | Ga0070678_1000903043 | 203 |
| 6 | 3300026121 | Ga0207683_10055151 | Ga0207683_100551513 | 203 |
| 7 | iso_pu_bacteria | 2643221644 | 2644247265 | 204 |
| 8 | 3300049654 | Ga0501207_014093 | Ga0501207_014093_571_1197 | 206 |
| 9 | 3300005354 | Ga0070675_100190348 | Ga0070675_1001903483 | 207 |
| 10 | 3300005459 | Ga0068867_100236353 | Ga0068867_1002363533 | 207 |
| 11 | 3300005844 | Ga0068862_100491130 | Ga0068862_1004911302 | 207 |
| 12 | 3300009147 | Ga0114129_11688650 | Ga0114129_116886501 | 207 |
| 13 | 3300009176 | Ga0105242_10350864 | Ga0105242_103508642 | 207 |
| 14 | 3300013308 | Ga0157375_10966194 | Ga0157375_109661942 | 207 |
| 15 | 3300025893 | Ga0207682_10019663 | Ga0207682_100196633 | 207 |
| 16 | 3300025926 | Ga0207659_10183021 | Ga0207659_101830213 | 207 |
| 17 | 3300028380 | Ga0268265_10474119 | Ga0268265_104741192 | 207 |
| 18 | 3300044656 | Ga0466969_0000042 | Ga0466969_0000042_57423_58046 | 207 |
| 19 | 3300044684 | Ga0466966_0060949 | Ga0466966_0060949_653_1276 | 207 |
| 20 | 3300044693 | Ga0466961_0016008 | Ga0466961_0016008_2810_3433 | 207 |
| 21 | 3300049824 | Ga0501045_0763089 | Ga0501045_0763089_70_693 | 207 |
| 22 | 3300003322 | rootL2_10176069 | rootL2_101760693 | 208 |
| 23 | 3300003775 | Ga0055524_1000139 | Ga0055524_100013966 | 208 |
| 24 | 3300003791 | Ga0055530_10001259 | Ga0055530_1000125910 | 208 |
| 25 | 3300003792 | Ga0055540_1000090 | Ga0055540_100009080 | 208 |
| 26 | 3300003792 | Ga0055540_1000091 | Ga0055540_100009178 | 208 |
| 27 | 3300003794 | Ga0055531_10014159 | Ga0055531_100141593 | 208 |
| 28 | 3300005327 | Ga0070658_10006609 | Ga0070658_100066093 | 208 |
| 29 | 3300005327 | Ga0070658_10098024 | Ga0070658_100980243 | 208 |
| 30 | 3300005328 | Ga0070676_10007521 | Ga0070676_100075214 | 208 |
| 31 | 3300005328 | Ga0070676_10010297 | Ga0070676_100102973 | 208 |
| 32 | 3300005328 | Ga0070676_10259763 | Ga0070676_102597632 | 208 |
| 33 | 3300005329 | Ga0070683_100018476 | Ga0070683_1000184763 | 208 |
| 34 | 3300005329 | Ga0070683_100582306 | Ga0070683_1005823062 | 208 |
| 35 | 3300005329 | Ga0070683_100808641 | Ga0070683_1008086412 | 208 |
| 36 | 3300005330 | Ga0070690_100193669 | Ga0070690_1001936692 | 208 |
| 37 | 3300005331 | Ga0070670_100038384 | Ga0070670_1000383844 | 208 |
| 38 | 3300005331 | Ga0070670_100107954 | Ga0070670_1001079543 | 208 |
| 39 | 3300005331 | Ga0070670_100138295 | Ga0070670_1001382952 | 208 |
| 40 | 3300005331 | Ga0070670_100157782 | Ga0070670_1001577822 | 208 |
| 41 | 3300005331 | Ga0070670_100213390 | Ga0070670_1002133903 | 208 |
| 42 | 3300005331 | Ga0070670_100296994 | Ga0070670_1002969943 | 208 |
| 43 | 3300005333 | Ga0070677_10064905 | Ga0070677_100649052 | 208 |
| 44 | 3300005334 | Ga0068869_100004440 | Ga0068869_1000044405 | 208 |
| 45 | 3300005334 | Ga0068869_100012807 | Ga0068869_1000128075 | 208 |
| 46 | 3300005334 | Ga0068869_100020181 | Ga0068869_1000201816 | 208 |
| 47 | 3300005335 | Ga0070666_10002033 | Ga0070666_100020336 | 208 |
| 48 | 3300005335 | Ga0070666_10185178 | Ga0070666_101851782 | 208 |
| 49 | 3300005338 | Ga0068868_100001810 | Ga0068868_1000018109 | 208 |
| 50 | 3300005338 | Ga0068868_100007261 | Ga0068868_1000072614 | 208 |
| 51 | 3300005338 | Ga0068868_100072102 | Ga0068868_1000721023 | 208 |
| 52 | 3300005338 | Ga0068868_100126239 | Ga0068868_1001262392 | 208 |
| 53 | 3300005338 | Ga0068868_100161654 | Ga0068868_1001616542 | 208 |
| 54 | 3300005338 | Ga0068868_100183562 | Ga0068868_1001835623 | 208 |
| 55 | 3300005338 | Ga0068868_100955561 | Ga0068868_1009555612 | 208 |
| 56 | 3300005339 | Ga0070660_100022549 | Ga0070660_1000225492 | 208 |
| 57 | 3300005340 | Ga0070689_100093357 | Ga0070689_1000933573 | 208 |
| 58 | 3300005343 | Ga0070687_100007199 | Ga0070687_1000071993 | 208 |
| 59 | 3300005344 | Ga0070661_100005399 | Ga0070661_1000053995 | 208 |
| 60 | 3300005344 | Ga0070661_100055228 | Ga0070661_1000552283 | 208 |
| 61 | 3300005344 | Ga0070661_100093101 | Ga0070661_1000931013 | 208 |
| 62 | 3300005344 | Ga0070661_100659701 | Ga0070661_1006597011 | 208 |
| 63 | 3300005345 | Ga0070692_10139895 | Ga0070692_101398951 | 208 |
| 64 | 3300005347 | Ga0070668_100004185 | Ga0070668_1000041855 | 208 |
| 65 | 3300005347 | Ga0070668_100010936 | Ga0070668_1000109363 | 208 |
| 66 | 3300005347 | Ga0070668_100044298 | Ga0070668_1000442983 | 208 |
| 67 | 3300005353 | Ga0070669_100063158 | Ga0070669_1000631582 | 208 |
| 68 | 3300005353 | Ga0070669_100186002 | Ga0070669_1001860022 | 208 |
| 69 | 3300005353 | Ga0070669_100319221 | Ga0070669_1003192212 | 208 |
| 70 | 3300005354 | Ga0070675_100002331 | Ga0070675_1000023316 | 208 |
| 71 | 3300005354 | Ga0070675_100013401 | Ga0070675_1000134016 | 208 |
| 72 | 3300005354 | Ga0070675_100257834 | Ga0070675_1002578342 | 208 |
| 73 | 3300005354 | Ga0070675_100277368 | Ga0070675_1002773682 | 208 |
| 74 | 3300005355 | Ga0070671_100004867 | Ga0070671_1000048675 | 208 |
| 75 | 3300005355 | Ga0070671_100006569 | Ga0070671_1000065695 | 208 |
| 76 | 3300005355 | Ga0070671_100314287 | Ga0070671_1003142872 | 208 |
| 77 | 3300005356 | Ga0070674_100001965 | Ga0070674_1000019656 | 208 |
| 78 | 3300005356 | Ga0070674_100113475 | Ga0070674_1001134753 | 208 |
| 79 | 3300005356 | Ga0070674_100208739 | Ga0070674_1002087392 | 208 |
| 80 | 3300005364 | Ga0070673_100009152 | Ga0070673_1000091526 | 208 |
| 81 | 3300005364 | Ga0070673_100109832 | Ga0070673_1001098323 | 208 |
| 82 | 3300005364 | Ga0070673_100212439 | Ga0070673_1002124393 | 208 |
| 83 | 3300005364 | Ga0070673_100886691 | Ga0070673_1008866911 | 208 |
| 84 | 3300005365 | Ga0070688_100038594 | Ga0070688_1000385943 | 208 |
| 85 | 3300005365 | Ga0070688_100477381 | Ga0070688_1004773812 | 208 |
| 86 | 3300005366 | Ga0070659_100021242 | Ga0070659_1000212422 | 208 |
| 87 | 3300005366 | Ga0070659_100022737 | Ga0070659_1000227375 | 208 |
| 88 | 3300005366 | Ga0070659_100185871 | Ga0070659_1001858712 | 208 |
| 89 | 3300005367 | Ga0070667_100007789 | Ga0070667_1000077892 | 208 |
| 90 | 3300005367 | Ga0070667_100009094 | Ga0070667_1000090945 | 208 |
| 91 | 3300005367 | Ga0070667_100016258 | Ga0070667_1000162584 | 208 |
| 92 | 3300005441 | Ga0070700_100039713 | Ga0070700_1000397133 | 208 |
| 93 | 3300005441 | Ga0070700_100120998 | Ga0070700_1001209982 | 208 |
| 94 | 3300005455 | Ga0070663_100002951 | Ga0070663_1000029518 | 208 |
| 95 | 3300005455 | Ga0070663_100059788 | Ga0070663_1000597883 | 208 |
| 96 | 3300005455 | Ga0070663_100079636 | Ga0070663_1000796362 | 208 |
| 97 | 3300005456 | Ga0070678_100097700 | Ga0070678_1000977003 | 208 |
| 98 | 3300005456 | Ga0070678_100359330 | Ga0070678_1003593303 | 208 |
| 99 | 3300005456 | Ga0070678_100497193 | Ga0070678_1004971931 | 208 |
| 100 | 3300005456 | Ga0070678_100958460 | Ga0070678_1009584601 | 208 |
| 101 | 3300005457 | Ga0070662_100004754 | Ga0070662_1000047547 | 208 |
| 102 | 3300005457 | Ga0070662_100021079 | Ga0070662_1000210795 | 208 |
| 103 | 3300005457 | Ga0070662_100069085 | Ga0070662_1000690852 | 208 |
| 104 | 3300005457 | Ga0070662_100374633 | Ga0070662_1003746332 | 208 |
| 105 | 3300005459 | Ga0068867_100004555 | Ga0068867_1000045555 | 208 |
| 106 | 3300005459 | Ga0068867_100111341 | Ga0068867_1001113412 | 208 |
| 107 | 3300005535 | Ga0070684_100275307 | Ga0070684_1002753072 | 208 |
| 108 | 3300005535 | Ga0070684_100727427 | Ga0070684_1007274272 | 208 |
| 109 | 3300005539 | Ga0068853_100038341 | Ga0068853_1000383415 | 208 |
| 110 | 3300005539 | Ga0068853_100078421 | Ga0068853_1000784213 | 208 |
| 111 | 3300005539 | Ga0068853_100224810 | Ga0068853_1002248102 | 208 |
| 112 | 3300005539 | Ga0068853_100377449 | Ga0068853_1003774492 | 208 |
| 113 | 3300005543 | Ga0070672_100004824 | Ga0070672_1000048243 | 208 |
| 114 | 3300005543 | Ga0070672_100008163 | Ga0070672_1000081633 | 208 |
| 115 | 3300005543 | Ga0070672_100073815 | Ga0070672_1000738153 | 208 |
| 116 | 3300005543 | Ga0070672_100084070 | Ga0070672_1000840702 | 208 |
| 117 | 3300005543 | Ga0070672_100105115 | Ga0070672_1001051153 | 208 |
| 118 | 3300005543 | Ga0070672_100137927 | Ga0070672_1001379272 | 208 |
| 119 | 3300005543 | Ga0070672_100275152 | Ga0070672_1002751522 | 208 |
| 120 | 3300005543 | Ga0070672_100367085 | Ga0070672_1003670852 | 208 |
| 121 | 3300005547 | Ga0070693_100005436 | Ga0070693_1000054364 | 208 |
| 122 | 3300005547 | Ga0070693_100006153 | Ga0070693_1000061532 | 208 |
| 123 | 3300005563 | Ga0068855_100018722 | Ga0068855_1000187228 | 208 |
| 124 | 3300005563 | Ga0068855_100410942 | Ga0068855_1004109422 | 208 |
| 125 | 3300005564 | Ga0070664_100008904 | Ga0070664_1000089048 | 208 |
| 126 | 3300005564 | Ga0070664_100228096 | Ga0070664_1002280963 | 208 |
| 127 | 3300005564 | Ga0070664_100296020 | Ga0070664_1002960202 | 208 |
| 128 | 3300005577 | Ga0068857_100013495 | Ga0068857_1000134957 | 208 |
| 129 | 3300005578 | Ga0068854_100058976 | Ga0068854_1000589762 | 208 |
| 130 | 3300005578 | Ga0068854_100067551 | Ga0068854_1000675513 | 208 |
| 131 | 3300005614 | Ga0068856_100021431 | Ga0068856_1000214314 | 208 |
| 132 | 3300005614 | Ga0068856_100617867 | Ga0068856_1006178672 | 208 |
| 133 | 3300005615 | Ga0070702_100028970 | Ga0070702_1000289703 | 208 |
| 134 | 3300005615 | Ga0070702_100084844 | Ga0070702_1000848442 | 208 |
| 135 | 3300005615 | Ga0070702_100235883 | Ga0070702_1002358833 | 208 |
| 136 | 3300005615 | Ga0070702_100763831 | Ga0070702_1007638311 | 208 |
| 137 | 3300005616 | Ga0068852_100003024 | Ga0068852_1000030248 | 208 |
| 138 | 3300005616 | Ga0068852_100006821 | Ga0068852_1000068213 | 208 |
| 139 | 3300005616 | Ga0068852_100028674 | Ga0068852_1000286741 | 208 |
| 140 | 3300005616 | Ga0068852_100030751 | Ga0068852_1000307515 | 208 |
| 141 | 3300005617 | Ga0068859_100029554 | Ga0068859_1000295545 | 208 |
| 142 | 3300005617 | Ga0068859_100175376 | Ga0068859_1001753762 | 208 |
| 143 | 3300005618 | Ga0068864_100001527 | Ga0068864_1000015275 | 208 |
| 144 | 3300005618 | Ga0068864_100018338 | Ga0068864_1000183385 | 208 |
| 145 | 3300005618 | Ga0068864_100029588 | Ga0068864_1000295885 | 208 |
| 146 | 3300005618 | Ga0068864_100051719 | Ga0068864_1000517192 | 208 |
| 147 | 3300005618 | Ga0068864_100084251 | Ga0068864_1000842513 | 208 |
| 148 | 3300005718 | Ga0068866_10181765 | Ga0068866_101817653 | 208 |
| 149 | 3300005719 | Ga0068861_100001789 | Ga0068861_1000017896 | 208 |
| 150 | 3300005719 | Ga0068861_100046617 | Ga0068861_1000466174 | 208 |
| 151 | 3300005834 | Ga0068851_10008824 | Ga0068851_100088245 | 208 |
| 152 | 3300005834 | Ga0068851_10008978 | Ga0068851_100089783 | 208 |
| 153 | 3300005834 | Ga0068851_10025597 | Ga0068851_100255974 | 208 |
| 154 | 3300005834 | Ga0068851_10063620 | Ga0068851_100636203 | 208 |
| 155 | 3300005840 | Ga0068870_10092273 | Ga0068870_100922733 | 208 |
| 156 | 3300005841 | Ga0068863_100007547 | Ga0068863_1000075474 | 208 |
| 157 | 3300005841 | Ga0068863_100016334 | Ga0068863_1000163343 | 208 |
| 158 | 3300005841 | Ga0068863_100389591 | Ga0068863_1003895912 | 208 |
| 159 | 3300005841 | Ga0068863_100390450 | Ga0068863_1003904502 | 208 |
| 160 | 3300005842 | Ga0068858_100002470 | Ga0068858_10000247012 | 208 |
| 161 | 3300005842 | Ga0068858_100008215 | Ga0068858_10000821510 | 208 |
| 162 | 3300005842 | Ga0068858_100018020 | Ga0068858_1000180206 | 208 |
| 163 | 3300005842 | Ga0068858_100019820 | Ga0068858_1000198206 | 208 |
| 164 | 3300005842 | Ga0068858_100387342 | Ga0068858_1003873423 | 208 |
| 165 | 3300005843 | Ga0068860_100001365 | Ga0068860_10000136510 | 208 |
| 166 | 3300005843 | Ga0068860_100011663 | Ga0068860_1000116639 | 208 |
| 167 | 3300005843 | Ga0068860_100198116 | Ga0068860_1001981163 | 208 |
| 168 | 3300005844 | Ga0068862_100025242 | Ga0068862_1000252423 | 208 |
| 169 | 3300005844 | Ga0068862_100116699 | Ga0068862_1001166993 | 208 |
| 170 | 3300005844 | Ga0068862_100166779 | Ga0068862_1001667793 | 208 |
| 171 | 3300006237 | Ga0097621_100015141 | Ga0097621_1000151414 | 208 |
| 172 | 3300006237 | Ga0097621_100085384 | Ga0097621_1000853844 | 208 |
| 173 | 3300006237 | Ga0097621_100114484 | Ga0097621_1001144842 | 208 |
| 174 | 3300006237 | Ga0097621_100338545 | Ga0097621_1003385452 | 208 |
| 175 | 3300006237 | Ga0097621_100919178 | Ga0097621_1009191781 | 208 |
| 176 | 3300006358 | Ga0068871_100003520 | Ga0068871_1000035208 | 208 |
| 177 | 3300006358 | Ga0068871_100048486 | Ga0068871_1000484862 | 208 |
| 178 | 3300006358 | Ga0068871_100279766 | Ga0068871_1002797662 | 208 |
| 179 | 3300006871 | Ga0075434_100042080 | Ga0075434_1000420803 | 208 |
| 180 | 3300006881 | Ga0068865_100006734 | Ga0068865_1000067343 | 208 |
| 181 | 3300006881 | Ga0068865_100089552 | Ga0068865_1000895522 | 208 |
| 182 | 3300006881 | Ga0068865_100257112 | Ga0068865_1002571122 | 208 |
| 183 | 3300006881 | Ga0068865_100270221 | Ga0068865_1002702211 | 208 |
| 184 | 3300006931 | Ga0097620_100029554 | Ga0097620_1000295543 | 208 |
| 185 | 3300006931 | Ga0097620_100175378 | Ga0097620_1001753782 | 208 |
| 186 | 3300006946 | Ga0079104_1000916 | Ga0079104_10009167 | 208 |
| 187 | 3300009093 | Ga0105240_10328268 | Ga0105240_103282683 | 208 |
| 188 | 3300009093 | Ga0105240_10908394 | Ga0105240_109083941 | 208 |
| 189 | 3300009098 | Ga0105245_10016431 | Ga0105245_100164316 | 208 |
| 190 | 3300009098 | Ga0105245_10255931 | Ga0105245_102559312 | 208 |
| 191 | 3300009098 | Ga0105245_10746472 | Ga0105245_107464722 | 208 |
| 192 | 3300009148 | Ga0105243_10040884 | Ga0105243_100408843 | 208 |
| 193 | 3300009148 | Ga0105243_10648309 | Ga0105243_106483092 | 208 |
| 194 | 3300009176 | Ga0105242_10058845 | Ga0105242_100588454 | 208 |
| 195 | 3300009177 | Ga0105248_10011287 | Ga0105248_100112878 | 208 |
| 196 | 3300009177 | Ga0105248_10039414 | Ga0105248_100394144 | 208 |
| 197 | 3300009177 | Ga0105248_10047396 | Ga0105248_100473965 | 208 |
| 198 | 3300009177 | Ga0105248_10083807 | Ga0105248_100838073 | 208 |
| 199 | 3300009177 | Ga0105248_10186381 | Ga0105248_101863813 | 208 |
| 200 | 3300009177 | Ga0105248_10473151 | Ga0105248_104731511 | 208 |
| 201 | 3300009177 | Ga0105248_10522602 | Ga0105248_105226023 | 208 |
| 202 | 3300009545 | Ga0105237_10031046 | Ga0105237_100310465 | 208 |
| 203 | 3300009551 | Ga0105238_10093334 | Ga0105238_100933343 | 208 |
| 204 | 3300009553 | Ga0105249_10010587 | Ga0105249_100105879 | 208 |
| 205 | 3300009553 | Ga0105249_10015417 | Ga0105249_100154172 | 208 |
| 206 | 3300010375 | Ga0105239_10196056 | Ga0105239_101960563 | 208 |
| 207 | 3300012512 | Ga0157327_1003471 | Ga0157327_10034712 | 208 |
| 208 | 3300013100 | Ga0157373_10007411 | Ga0157373_100074112 | 208 |
| 209 | 3300013102 | Ga0157371_10130018 | Ga0157371_101300183 | 208 |
| 210 | 3300013104 | Ga0157370_10439805 | Ga0157370_104398052 | 208 |
| 211 | 3300013105 | Ga0157369_10049712 | Ga0157369_100497122 | 208 |
| 212 | 3300013105 | Ga0157369_10213729 | Ga0157369_102137293 | 208 |
| 213 | 3300013296 | Ga0157374_10006173 | Ga0157374_100061739 | 208 |
| 214 | 3300013296 | Ga0157374_10389084 | Ga0157374_103890842 | 208 |
| 215 | 3300013296 | Ga0157374_10709016 | Ga0157374_107090162 | 208 |
| 216 | 3300013297 | Ga0157378_10748716 | Ga0157378_107487162 | 208 |
| 217 | 3300013306 | Ga0163162_10006647 | Ga0163162_100066478 | 208 |
| 218 | 3300013306 | Ga0163162_10012295 | Ga0163162_100122951 | 208 |
| 219 | 3300013306 | Ga0163162_10019368 | Ga0163162_100193687 | 208 |
| 220 | 3300013306 | Ga0163162_10098355 | Ga0163162_100983553 | 208 |
| 221 | 3300013306 | Ga0163162_10193774 | Ga0163162_101937743 | 208 |
| 222 | 3300013306 | Ga0163162_10232968 | Ga0163162_102329683 | 208 |
| 223 | 3300013307 | Ga0157372_10008138 | Ga0157372_100081389 | 208 |
| 224 | 3300013307 | Ga0157372_10024157 | Ga0157372_100241576 | 208 |
| 225 | 3300013308 | Ga0157375_10011278 | Ga0157375_100112787 | 208 |
| 226 | 3300013308 | Ga0157375_10024455 | Ga0157375_100244554 | 208 |
| 227 | 3300013308 | Ga0157375_10040792 | Ga0157375_100407925 | 208 |
| 228 | 3300013308 | Ga0157375_10522370 | Ga0157375_105223702 | 208 |
| 229 | 3300014325 | Ga0163163_10001523 | Ga0163163_1000152311 | 208 |
| 230 | 3300014325 | Ga0163163_10077224 | Ga0163163_100772243 | 208 |
| 231 | 3300014326 | Ga0157380_10011942 | Ga0157380_100119428 | 208 |
| 232 | 3300014326 | Ga0157380_10036620 | Ga0157380_100366204 | 208 |
| 233 | 3300014326 | Ga0157380_10328842 | Ga0157380_103288421 | 208 |
| 234 | 3300014326 | Ga0157380_10487300 | Ga0157380_104873002 | 208 |
| 235 | 3300014745 | Ga0157377_10002400 | Ga0157377_100024004 | 208 |
| 236 | 3300014968 | Ga0157379_10002555 | Ga0157379_100025559 | 208 |
| 237 | 3300014968 | Ga0157379_10003481 | Ga0157379_100034818 | 208 |
| 238 | 3300014968 | Ga0157379_10007487 | Ga0157379_100074875 | 208 |
| 239 | 3300014968 | Ga0157379_10014842 | Ga0157379_100148425 | 208 |
| 240 | 3300014968 | Ga0157379_10141241 | Ga0157379_101412412 | 208 |
| 241 | 3300014968 | Ga0157379_10372931 | Ga0157379_103729312 | 208 |
| 242 | 3300014969 | Ga0157376_10005881 | Ga0157376_100058816 | 208 |
| 243 | 3300014969 | Ga0157376_10068596 | Ga0157376_100685962 | 208 |
| 244 | 3300014969 | Ga0157376_10171775 | Ga0157376_101717753 | 208 |
| 245 | 3300014969 | Ga0157376_10261357 | Ga0157376_102613572 | 208 |
| 246 | 3300014969 | Ga0157376_10385587 | Ga0157376_103855871 | 208 |
| 247 | 3300017792 | Ga0163161_10020312 | Ga0163161_100203123 | 208 |
| 248 | 3300017792 | Ga0163161_10042513 | Ga0163161_100425132 | 208 |
| 249 | 3300017792 | Ga0163161_10044600 | Ga0163161_100446003 | 208 |
| 250 | 3300017792 | Ga0163161_10712424 | Ga0163161_107124242 | 208 |
| 251 | 3300025271 | Ga0207666_1002213 | Ga0207666_10022131 | 208 |
| 252 | 3300025298 | Ga0209050_1000326 | Ga0209050_100032610 | 208 |
| 253 | 3300025298 | Ga0209050_1000967 | Ga0209050_100096721 | 208 |
| 254 | 3300025298 | Ga0209050_1036330 | Ga0209050_10363303 | 208 |
| 255 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019456 | 208 |
| 256 | 3300025303 | Ga0209051_1000133 | Ga0209051_100013381 | 208 |
| 257 | 3300025304 | Ga0209257_1000038 | Ga0209257_100003881 | 208 |
| 258 | 3300025315 | Ga0207697_10013496 | Ga0207697_100134963 | 208 |
| 259 | 3300025315 | Ga0207697_10145965 | Ga0207697_101459652 | 208 |
| 260 | 3300025321 | Ga0207656_10008357 | Ga0207656_100083572 | 208 |
| 261 | 3300025321 | Ga0207656_10009070 | Ga0207656_100090704 | 208 |
| 262 | 3300025893 | Ga0207682_10005021 | Ga0207682_100050213 | 208 |
| 263 | 3300025893 | Ga0207682_10036448 | Ga0207682_100364483 | 208 |
| 264 | 3300025899 | Ga0207642_10002738 | Ga0207642_100027383 | 208 |
| 265 | 3300025901 | Ga0207688_10007645 | Ga0207688_100076456 | 208 |
| 266 | 3300025901 | Ga0207688_10018395 | Ga0207688_100183953 | 208 |
| 267 | 3300025903 | Ga0207680_10003179 | Ga0207680_100031793 | 208 |
| 268 | 3300025903 | Ga0207680_10169734 | Ga0207680_101697343 | 208 |
| 269 | 3300025907 | Ga0207645_10007079 | Ga0207645_100070798 | 208 |
| 270 | 3300025907 | Ga0207645_10017927 | Ga0207645_100179272 | 208 |
| 271 | 3300025907 | Ga0207645_10184291 | Ga0207645_101842912 | 208 |
| 272 | 3300025909 | Ga0207705_10132723 | Ga0207705_101327233 | 208 |
| 273 | 3300025911 | Ga0207654_10037247 | Ga0207654_100372473 | 208 |
| 274 | 3300025913 | Ga0207695_10184325 | Ga0207695_101843253 | 208 |
| 275 | 3300025914 | Ga0207671_10080690 | Ga0207671_100806903 | 208 |
| 276 | 3300025919 | Ga0207657_10061349 | Ga0207657_100613491 | 208 |
| 277 | 3300025919 | Ga0207657_10112825 | Ga0207657_101128253 | 208 |
| 278 | 3300025920 | Ga0207649_10023850 | Ga0207649_100238503 | 208 |
| 279 | 3300025920 | Ga0207649_10038984 | Ga0207649_100389843 | 208 |
| 280 | 3300025920 | Ga0207649_10172645 | Ga0207649_101726452 | 208 |
| 281 | 3300025923 | Ga0207681_10003817 | Ga0207681_100038175 | 208 |
| 282 | 3300025923 | Ga0207681_10364662 | Ga0207681_103646622 | 208 |
| 283 | 3300025924 | Ga0207694_10015426 | Ga0207694_100154265 | 208 |
| 284 | 3300025924 | Ga0207694_10019601 | Ga0207694_100196013 | 208 |
| 285 | 3300025925 | Ga0207650_10000382 | Ga0207650_100003828 | 208 |
| 286 | 3300025925 | Ga0207650_10055425 | Ga0207650_100554252 | 208 |
| 287 | 3300025925 | Ga0207650_10072514 | Ga0207650_100725143 | 208 |
| 288 | 3300025925 | Ga0207650_10286547 | Ga0207650_102865473 | 208 |
| 289 | 3300025925 | Ga0207650_10379448 | Ga0207650_103794482 | 208 |
| 290 | 3300025925 | Ga0207650_10522543 | Ga0207650_105225432 | 208 |
| 291 | 3300025926 | Ga0207659_10002417 | Ga0207659_100024174 | 208 |
| 292 | 3300025926 | Ga0207659_10006243 | Ga0207659_100062436 | 208 |
| 293 | 3300025926 | Ga0207659_10007553 | Ga0207659_100075533 | 208 |
| 294 | 3300025926 | Ga0207659_10017327 | Ga0207659_100173275 | 208 |
| 295 | 3300025926 | Ga0207659_10027687 | Ga0207659_100276875 | 208 |
| 296 | 3300025927 | Ga0207687_10017347 | Ga0207687_100173473 | 208 |
| 297 | 3300025927 | Ga0207687_10032593 | Ga0207687_100325933 | 208 |
| 298 | 3300025927 | Ga0207687_10210725 | Ga0207687_102107252 | 208 |
| 299 | 3300025931 | Ga0207644_10009179 | Ga0207644_100091793 | 208 |
| 300 | 3300025931 | Ga0207644_10010498 | Ga0207644_100104983 | 208 |
| 301 | 3300025931 | Ga0207644_10367443 | Ga0207644_103674432 | 208 |
| 302 | 3300025931 | Ga0207644_10403898 | Ga0207644_104038981 | 208 |
| 303 | 3300025932 | Ga0207690_10005702 | Ga0207690_100057022 | 208 |
| 304 | 3300025932 | Ga0207690_10178692 | Ga0207690_101786922 | 208 |
| 305 | 3300025933 | Ga0207706_10001995 | Ga0207706_1000199516 | 208 |
| 306 | 3300025933 | Ga0207706_10009005 | Ga0207706_100090056 | 208 |
| 307 | 3300025933 | Ga0207706_10245012 | Ga0207706_102450123 | 208 |
| 308 | 3300025933 | Ga0207706_10340536 | Ga0207706_103405363 | 208 |
| 309 | 3300025933 | Ga0207706_10544722 | Ga0207706_105447222 | 208 |
| 310 | 3300025934 | Ga0207686_10024985 | Ga0207686_100249853 | 208 |
| 311 | 3300025934 | Ga0207686_11031600 | Ga0207686_110316001 | 208 |
| 312 | 3300025935 | Ga0207709_10010409 | Ga0207709_100104094 | 208 |
| 313 | 3300025937 | Ga0207669_10011790 | Ga0207669_100117904 | 208 |
| 314 | 3300025937 | Ga0207669_10090965 | Ga0207669_100909653 | 208 |
| 315 | 3300025937 | Ga0207669_10217933 | Ga0207669_102179332 | 208 |
| 316 | 3300025938 | Ga0207704_10002822 | Ga0207704_100028225 | 208 |
| 317 | 3300025938 | Ga0207704_10061980 | Ga0207704_100619803 | 208 |
| 318 | 3300025938 | Ga0207704_10111635 | Ga0207704_101116353 | 208 |
| 319 | 3300025940 | Ga0207691_10004985 | Ga0207691_1000498511 | 208 |
| 320 | 3300025940 | Ga0207691_10035897 | Ga0207691_100358975 | 208 |
| 321 | 3300025940 | Ga0207691_10098585 | Ga0207691_100985853 | 208 |
| 322 | 3300025940 | Ga0207691_10134093 | Ga0207691_101340932 | 208 |
| 323 | 3300025940 | Ga0207691_10138439 | Ga0207691_101384393 | 208 |
| 324 | 3300025940 | Ga0207691_10273601 | Ga0207691_102736013 | 208 |
| 325 | 3300025940 | Ga0207691_10295161 | Ga0207691_102951612 | 208 |
| 326 | 3300025941 | Ga0207711_10015498 | Ga0207711_100154986 | 208 |
| 327 | 3300025941 | Ga0207711_10043131 | Ga0207711_100431315 | 208 |
| 328 | 3300025941 | Ga0207711_10058166 | Ga0207711_100581663 | 208 |
| 329 | 3300025941 | Ga0207711_10084520 | Ga0207711_100845203 | 208 |
| 330 | 3300025941 | Ga0207711_10106031 | Ga0207711_101060313 | 208 |
| 331 | 3300025941 | Ga0207711_10127103 | Ga0207711_101271032 | 208 |
| 332 | 3300025941 | Ga0207711_10536062 | Ga0207711_105360621 | 208 |
| 333 | 3300025942 | Ga0207689_10000996 | Ga0207689_1000099616 | 208 |
| 334 | 3300025942 | Ga0207689_10005866 | Ga0207689_100058665 | 208 |
| 335 | 3300025942 | Ga0207689_10019786 | Ga0207689_100197863 | 208 |
| 336 | 3300025944 | Ga0207661_10119681 | Ga0207661_101196812 | 208 |
| 337 | 3300025944 | Ga0207661_10617496 | Ga0207661_106174962 | 208 |
| 338 | 3300025945 | Ga0207679_10023086 | Ga0207679_100230864 | 208 |
| 339 | 3300025945 | Ga0207679_10281902 | Ga0207679_102819023 | 208 |
| 340 | 3300025945 | Ga0207679_10352500 | Ga0207679_103525002 | 208 |
| 341 | 3300025945 | Ga0207679_10366783 | Ga0207679_103667832 | 208 |
| 342 | 3300025945 | Ga0207679_10571510 | Ga0207679_105715102 | 208 |
| 343 | 3300025960 | Ga0207651_10005465 | Ga0207651_100054652 | 208 |
| 344 | 3300025960 | Ga0207651_10033408 | Ga0207651_100334085 | 208 |
| 345 | 3300025960 | Ga0207651_10122313 | Ga0207651_101223132 | 208 |
| 346 | 3300025961 | Ga0207712_10002952 | Ga0207712_100029523 | 208 |
| 347 | 3300025961 | Ga0207712_10087613 | Ga0207712_100876132 | 208 |
| 348 | 3300025972 | Ga0207668_10018678 | Ga0207668_100186785 | 208 |
| 349 | 3300025972 | Ga0207668_10028532 | Ga0207668_100285324 | 208 |
| 350 | 3300025972 | Ga0207668_10172783 | Ga0207668_101727832 | 208 |
| 351 | 3300025972 | Ga0207668_10390918 | Ga0207668_103909182 | 208 |
| 352 | 3300025981 | Ga0207640_10005754 | Ga0207640_100057546 | 208 |
| 353 | 3300025981 | Ga0207640_10057330 | Ga0207640_100573303 | 208 |
| 354 | 3300025986 | Ga0207658_10000181 | Ga0207658_1000018158 | 208 |
| 355 | 3300025986 | Ga0207658_10007082 | Ga0207658_1000708210 | 208 |
| 356 | 3300025986 | Ga0207658_10030504 | Ga0207658_100305043 | 208 |
| 357 | 3300026023 | Ga0207677_10000853 | Ga0207677_1000085318 | 208 |
| 358 | 3300026023 | Ga0207677_10016079 | Ga0207677_100160795 | 208 |
| 359 | 3300026023 | Ga0207677_10035612 | Ga0207677_100356123 | 208 |
| 360 | 3300026023 | Ga0207677_10057068 | Ga0207677_100570683 | 208 |
| 361 | 3300026023 | Ga0207677_10591141 | Ga0207677_105911412 | 208 |
| 362 | 3300026035 | Ga0207703_10000907 | Ga0207703_1000090722 | 208 |
| 363 | 3300026035 | Ga0207703_10002895 | Ga0207703_100028959 | 208 |
| 364 | 3300026035 | Ga0207703_10003620 | Ga0207703_1000362010 | 208 |
| 365 | 3300026035 | Ga0207703_10026824 | Ga0207703_100268244 | 208 |
| 366 | 3300026041 | Ga0207639_10051155 | Ga0207639_100511553 | 208 |
| 367 | 3300026041 | Ga0207639_10553653 | Ga0207639_105536532 | 208 |
| 368 | 3300026041 | Ga0207639_10825815 | Ga0207639_108258152 | 208 |
| 369 | 3300026067 | Ga0207678_10003624 | Ga0207678_100036249 | 208 |
| 370 | 3300026067 | Ga0207678_10072781 | Ga0207678_100727813 | 208 |
| 371 | 3300026067 | Ga0207678_10126976 | Ga0207678_101269763 | 208 |
| 372 | 3300026067 | Ga0207678_10150777 | Ga0207678_101507773 | 208 |
| 373 | 3300026075 | Ga0207708_10030177 | Ga0207708_100301773 | 208 |
| 374 | 3300026075 | Ga0207708_10096148 | Ga0207708_100961483 | 208 |
| 375 | 3300026078 | Ga0207702_10011735 | Ga0207702_100117353 | 208 |
| 376 | 3300026078 | Ga0207702_10268091 | Ga0207702_102680912 | 208 |
| 377 | 3300026078 | Ga0207702_10551717 | Ga0207702_105517172 | 208 |
| 378 | 3300026088 | Ga0207641_10005494 | Ga0207641_100054949 | 208 |
| 379 | 3300026088 | Ga0207641_10006799 | Ga0207641_100067995 | 208 |
| 380 | 3300026088 | Ga0207641_10076167 | Ga0207641_100761674 | 208 |
| 381 | 3300026088 | Ga0207641_10563026 | Ga0207641_105630262 | 208 |
| 382 | 3300026088 | Ga0207641_10777422 | Ga0207641_107774222 | 208 |
| 383 | 3300026089 | Ga0207648_10018549 | Ga0207648_100185494 | 208 |
| 384 | 3300026089 | Ga0207648_10051037 | Ga0207648_100510375 | 208 |
| 385 | 3300026089 | Ga0207648_10306586 | Ga0207648_103065862 | 208 |
| 386 | 3300026095 | Ga0207676_10002438 | Ga0207676_100024385 | 208 |
| 387 | 3300026095 | Ga0207676_10012441 | Ga0207676_100124414 | 208 |
| 388 | 3300026095 | Ga0207676_10016864 | Ga0207676_100168643 | 208 |
| 389 | 3300026095 | Ga0207676_10064169 | Ga0207676_100641692 | 208 |
| 390 | 3300026095 | Ga0207676_10081670 | Ga0207676_100816703 | 208 |
| 391 | 3300026095 | Ga0207676_10294065 | Ga0207676_102940653 | 208 |
| 392 | 3300026116 | Ga0207674_10066252 | Ga0207674_100662523 | 208 |
| 393 | 3300026118 | Ga0207675_100002360 | Ga0207675_10000236011 | 208 |
| 394 | 3300026118 | Ga0207675_100002486 | Ga0207675_1000024869 | 208 |
| 395 | 3300026118 | Ga0207675_100358152 | Ga0207675_1003581522 | 208 |
| 396 | 3300026121 | Ga0207683_10002157 | Ga0207683_1000215716 | 208 |
| 397 | 3300026121 | Ga0207683_10084574 | Ga0207683_100845744 | 208 |
| 398 | 3300026121 | Ga0207683_10093009 | Ga0207683_100930093 | 208 |
| 399 | 3300026121 | Ga0207683_10196292 | Ga0207683_101962923 | 208 |
| 400 | 3300026121 | Ga0207683_10200619 | Ga0207683_102006192 | 208 |
| 401 | 3300026121 | Ga0207683_10440416 | Ga0207683_104404161 | 208 |
| 402 | 3300026142 | Ga0207698_10007978 | Ga0207698_100079787 | 208 |
| 403 | 3300026142 | Ga0207698_10104525 | Ga0207698_101045252 | 208 |
| 404 | 3300026142 | Ga0207698_10180043 | Ga0207698_101800433 | 208 |
| 405 | 3300026142 | Ga0207698_10291483 | Ga0207698_102914832 | 208 |
| 406 | 3300026142 | Ga0207698_10535431 | Ga0207698_105354312 | 208 |
| 407 | 3300027111 | Ga0209281_1000935 | Ga0209281_100093519 | 208 |
| 408 | 3300027876 | Ga0209974_10002440 | Ga0209974_100024405 | 208 |
| 409 | 3300028380 | Ga0268265_10012152 | Ga0268265_100121523 | 208 |
| 410 | 3300028380 | Ga0268265_10058457 | Ga0268265_100584571 | 208 |
| 411 | 3300028381 | Ga0268264_10001738 | Ga0268264_1000173816 | 208 |
| 412 | 3300028381 | Ga0268264_10007941 | Ga0268264_100079416 | 208 |
| 413 | 3300028381 | Ga0268264_10134746 | Ga0268264_101347463 | 208 |
| 414 | 3300028381 | Ga0268264_10291303 | Ga0268264_102913033 | 208 |
| 415 | 3300031548 | Ga0307408_100075271 | Ga0307408_1000752712 | 208 |
| 416 | 3300031901 | Ga0307406_10019969 | Ga0307406_100199693 | 208 |
| 417 | 3300031911 | Ga0307412_10026713 | Ga0307412_100267134 | 208 |
| 418 | 3300031995 | Ga0307409_100003223 | Ga0307409_1000032231 | 208 |
| 419 | 3300032002 | Ga0307416_100001157 | Ga0307416_1000011576 | 208 |
| 420 | 3300032005 | Ga0307411_10022265 | Ga0307411_100222655 | 208 |
| 421 | 3300032126 | Ga0307415_100135773 | Ga0307415_1001357732 | 208 |
| 422 | 3300032126 | Ga0307415_100323282 | Ga0307415_1003232822 | 208 |
| 423 | 3300034817 | Ga0373948_0019368 | Ga0373948_0019368_278_916 | 208 |
| 424 | 3300034957 | Ga0373938_0004404 | Ga0373938_0004404_1003_1641 | 208 |
| 425 | 3300035092 | Ga0373952_0062208 | Ga0373952_0062208_128_766 | 208 |
| 426 | 3300035111 | Ga0373923_0108112 | Ga0373923_0108112_390_1028 | 208 |
| 427 | 3300035116 | Ga0373945_0026236 | Ga0373945_0026236_1257_1895 | 208 |
| 428 | 3300035121 | Ga0373960_0023822 | Ga0373960_0023822_490_1128 | 208 |
| 429 | 3300035170 | Ga0373943_0033638 | Ga0373943_0033638_931_1569 | 208 |
| 430 | 3300035691 | Ga0373931_0018622 | Ga0373931_0018622_1209_1847 | 208 |
| 431 | 3300035695 | Ga0373927_0183986 | Ga0373927_0183986_191_829 | 208 |
| 432 | 3300035725 | Ga0373947_0063240 | Ga0373947_0063240_1090_1728 | 208 |
| 433 | 3300036401 | Ga0373937_0778759 | Ga0373937_0778759_201_839 | 208 |
| 434 | 3300039437 | Ga0436365_1317424 | Ga0436365_1317424_213_851 | 208 |
| 435 | 3300039450 | Ga0436363_0116538 | Ga0436363_0116538_102_740 | 208 |
| 436 | 3300042121 | Ga0450919_000090 | Ga0450919_000090_3959_4585 | 208 |
| 437 | 3300042876 | Ga0451577_0019505 | Ga0451577_0019505_4831_5457 | 208 |
| 438 | 3300042876 | Ga0451577_0138750 | Ga0451577_0138750_1329_1955 | 208 |
| 439 | 3300044712 | Ga0453684_0126138 | Ga0453684_0126138_522_1148 | 208 |
| 440 | 3300045051 | Ga0451576_0063338 | Ga0451576_0063338_374_1012 | 208 |
| 441 | 3300045051 | Ga0451576_0317817 | Ga0451576_0317817_269_907 | 208 |
| 442 | 3300046472 | Ga0495580_0422237 | Ga0495580_0422237_143_781 | 208 |
| 443 | 3300046516 | Ga0495628_0422893 | Ga0495628_0422893_122_760 | 208 |
| 444 | 3300046537 | Ga0495598_0039809 | Ga0495598_0039809_62_700 | 208 |
| 445 | 3300046537 | Ga0495598_0056259 | Ga0495598_0056259_403_1041 | 208 |
| 446 | 3300046543 | Ga0495645_0131443 | Ga0495645_0131443_468_1106 | 208 |
| 447 | 3300046683 | Ga0495658_0028575 | Ga0495658_0028575_1234_1872 | 208 |
| 448 | 3300046683 | Ga0495658_0106316 | Ga0495658_0106316_389_1027 | 208 |
| 449 | 3300046689 | Ga0495613_0209940 | Ga0495613_0209940_19_657 | 208 |
| 450 | 3300047470 | Ga0495681_0050673 | Ga0495681_0050673_142_780 | 208 |
| 451 | 3300047471 | Ga0495684_0011588 | Ga0495684_0011588_990_1628 | 208 |
| 452 | 3300048090 | Ga0495615_0018856 | Ga0495615_0018856_126_764 | 208 |
| 453 | 3300048903 | Ga0496100_0056827 | Ga0496100_0056827_1550_2188 | 208 |
| 454 | 3300048903 | Ga0496100_0238573 | Ga0496100_0238573_566_1204 | 208 |
| 455 | 3300048904 | Ga0496101_0009418 | Ga0496101_0009418_3655_4293 | 208 |
| 456 | 3300048905 | Ga0496102_0027006 | Ga0496102_0027006_804_1430 | 208 |
| 457 | 3300048907 | Ga0496104_0170815 | Ga0496104_0170815_985_1623 | 208 |
| 458 | 3300048908 | Ga0496105_0115513 | Ga0496105_0115513_1219_1857 | 208 |
| 459 | 3300048909 | Ga0496106_0005857 | Ga0496106_0005857_7565_8203 | 208 |
| 460 | 3300048910 | Ga0496107_0027177 | Ga0496107_0027177_2098_2736 | 208 |
| 461 | 3300048910 | Ga0496107_0690777 | Ga0496107_0690777_65_703 | 208 |
| 462 | 3300048911 | Ga0496108_0021455 | Ga0496108_0021455_2032_2670 | 208 |
| 463 | 3300048911 | Ga0496108_0064837 | Ga0496108_0064837_2019_2657 | 208 |
| 464 | 3300048911 | Ga0496108_0221191 | Ga0496108_0221191_459_1142 | 208 |
| 465 | 3300048912 | Ga0496109_0029766 | Ga0496109_0029766_2986_3624 | 208 |
| 466 | 3300048912 | Ga0496109_0170283 | Ga0496109_0170283_662_1300 | 208 |
| 467 | 3300048913 | Ga0496110_0102205 | Ga0496110_0102205_437_1075 | 208 |
| 468 | 3300048915 | Ga0496112_0589124 | Ga0496112_0589124_362_1000 | 208 |
| 469 | 3300048916 | Ga0496113_0065359 | Ga0496113_0065359_45_683 | 208 |
| 470 | 3300048916 | Ga0496113_0382817 | Ga0496113_0382817_327_965 | 208 |
| 471 | 3300048917 | Ga0496114_0006581 | Ga0496114_0006581_1378_2004 | 208 |
| 472 | 3300048917 | Ga0496114_0086137 | Ga0496114_0086137_896_1534 | 208 |
| 473 | 3300048917 | Ga0496114_0091595 | Ga0496114_0091595_391_1029 | 208 |
| 474 | 3300048917 | Ga0496114_0304126 | Ga0496114_0304126_78_716 | 208 |
| 475 | 3300049575 | Ga0501039_0307911 | Ga0501039_0307911_127_768 | 208 |
| 476 | 3300049580 | Ga0501046_0252836 | Ga0501046_0252836_377_1018 | 208 |
| 477 | 3300049588 | Ga0501072_0467810 | Ga0501072_0467810_28_654 | 208 |
| 478 | 3300049591 | Ga0501075_0022224 | Ga0501075_0022224_2164_2790 | 208 |
| 479 | 3300050512 | nmdc:mga0n895_70256_c1 | nmdc:mga0n895_70256_c1_1654_2292 | 208 |
| 480 | 3300053077 | Ga0495601_0120834 | Ga0495601_0120834_929_1567 | 208 |
| 481 | 3300053085 | Ga0495619_0025876 | Ga0495619_0025876_2575_3213 | 208 |
| 482 | 3300053158 | Ga0500627_0039830 | Ga0500627_0039830_242_868 | 208 |
| 483 | 3300005334 | Ga0068869_100375644 | Ga0068869_1003756442 | 209 |
| 484 | 3300005336 | Ga0070680_100006667 | Ga0070680_1000066678 | 209 |
| 485 | 3300005530 | Ga0070679_100017999 | Ga0070679_1000179997 | 209 |
| 486 | 3300005547 | Ga0070693_100070902 | Ga0070693_1000709021 | 209 |
| 487 | 3300005563 | Ga0068855_100851532 | Ga0068855_1008515322 | 209 |
| 488 | 3300005564 | Ga0070664_100282262 | Ga0070664_1002822622 | 209 |
| 489 | 3300005842 | Ga0068858_100005840 | Ga0068858_10000584014 | 209 |
| 490 | 3300005843 | Ga0068860_101230384 | Ga0068860_1012303842 | 209 |
| 491 | 3300006195 | Ga0075366_10010694 | Ga0075366_100106945 | 209 |
| 492 | 3300006237 | Ga0097621_101015610 | Ga0097621_1010156101 | 209 |
| 493 | 3300009101 | Ga0105247_10130196 | Ga0105247_101301962 | 209 |
| 494 | 3300009147 | Ga0114129_10084121 | Ga0114129_100841213 | 209 |
| 495 | 3300009177 | Ga0105248_10339087 | Ga0105248_103390872 | 209 |
| 496 | 3300014326 | Ga0157380_10063579 | Ga0157380_100635793 | 209 |
| 497 | 3300014968 | Ga0157379_10004289 | Ga0157379_1000428914 | 209 |
| 498 | 3300025912 | Ga0207707_10069401 | Ga0207707_100694014 | 209 |
| 499 | 3300025917 | Ga0207660_10013406 | Ga0207660_100134066 | 209 |
| 500 | 3300025918 | Ga0207662_10802386 | Ga0207662_108023861 | 209 |
| 501 | 3300025921 | Ga0207652_10030599 | Ga0207652_100305993 | 209 |
| 502 | 3300025941 | Ga0207711_10261101 | Ga0207711_102611013 | 209 |
| 503 | 3300025986 | Ga0207658_10137721 | Ga0207658_101377212 | 209 |
| 504 | 3300031251 | Ga0265327_10164121 | Ga0265327_101641211 | 209 |
| 505 | 3300031548 | Ga0307408_100353273 | Ga0307408_1003532732 | 209 |
| 506 | 3300031852 | Ga0307410_10204103 | Ga0307410_102041032 | 209 |
| 507 | 3300031901 | Ga0307406_10178724 | Ga0307406_101787242 | 209 |
| 508 | 3300032002 | Ga0307416_100090220 | Ga0307416_1000902203 | 209 |
| 509 | 3300032005 | Ga0307411_10212681 | Ga0307411_102126812 | 209 |
| 510 | 3300035114 | Ga0373939_0074949 | Ga0373939_0074949_398_1027 | 209 |
| 511 | 3300037471 | Ga0395905_0083762 | Ga0395905_0083762_2119_2748 | 209 |
| 512 | 3300041413 | Ga0439465_0022571 | Ga0439465_0022571_216_845 | 209 |
| 513 | 3300044658 | Ga0466972_0126098 | Ga0466972_0126098_378_1007 | 209 |
| 514 | 3300049161 | Ga0501305_052890 | Ga0501305_052890_37_666 | 209 |
| 515 | 3300049513 | Ga0501290_046462 | Ga0501290_046462_22_651 | 209 |
| 516 | 3300049515 | Ga0501292_020734 | Ga0501292_020734_158_787 | 209 |
| 517 | 3300049649 | Ga0501198_000023 | Ga0501198_000023_42167_42811 | 209 |
| 518 | 3300049683 | Ga0501253_013192 | Ga0501253_013192_183_812 | 209 |
| 519 | 3300049686 | Ga0501257_016938 | Ga0501257_016938_570_1199 | 209 |
| 520 | 3300049759 | Ga0501262_013596 | Ga0501262_013596_26_655 | 209 |
| 521 | 3300050493 | nmdc:mga0k408_9843_c1 | nmdc:mga0k408_9843_c1_555_1184 | 209 |
| 522 | 3300005328 | Ga0070676_10257501 | Ga0070676_102575013 | 210 |
| 523 | 3300005331 | Ga0070670_100000527 | Ga0070670_1000005277 | 210 |
| 524 | 3300005333 | Ga0070677_10039324 | Ga0070677_100393243 | 210 |
| 525 | 3300005333 | Ga0070677_10048834 | Ga0070677_100488342 | 210 |
| 526 | 3300005334 | Ga0068869_100217947 | Ga0068869_1002179472 | 210 |
| 527 | 3300005338 | Ga0068868_100129245 | Ga0068868_1001292453 | 210 |
| 528 | 3300005354 | Ga0070675_100011552 | Ga0070675_1000115525 | 210 |
| 529 | 3300005355 | Ga0070671_100038919 | Ga0070671_1000389195 | 210 |
| 530 | 3300005355 | Ga0070671_100176529 | Ga0070671_1001765292 | 210 |
| 531 | 3300005364 | Ga0070673_100225610 | Ga0070673_1002256102 | 210 |
| 532 | 3300005441 | Ga0070700_100014555 | Ga0070700_1000145553 | 210 |
| 533 | 3300005456 | Ga0070678_100007587 | Ga0070678_1000075876 | 210 |
| 534 | 3300005456 | Ga0070678_100102186 | Ga0070678_1001021863 | 210 |
| 535 | 3300005456 | Ga0070678_100139566 | Ga0070678_1001395662 | 210 |
| 536 | 3300005457 | Ga0070662_100048266 | Ga0070662_1000482663 | 210 |
| 537 | 3300005459 | Ga0068867_100020712 | Ga0068867_1000207121 | 210 |
| 538 | 3300005543 | Ga0070672_100001982 | Ga0070672_10000198212 | 210 |
| 539 | 3300005543 | Ga0070672_100028822 | Ga0070672_1000288222 | 210 |
| 540 | 3300005543 | Ga0070672_100688434 | Ga0070672_1006884342 | 210 |
| 541 | 3300005616 | Ga0068852_100129301 | Ga0068852_1001293013 | 210 |
| 542 | 3300005616 | Ga0068852_100423490 | Ga0068852_1004234902 | 210 |
| 543 | 3300005617 | Ga0068859_100042793 | Ga0068859_1000427932 | 210 |
| 544 | 3300005617 | Ga0068859_100115004 | Ga0068859_1001150041 | 210 |
| 545 | 3300005618 | Ga0068864_100018933 | Ga0068864_1000189336 | 210 |
| 546 | 3300005718 | Ga0068866_10002740 | Ga0068866_100027408 | 210 |
| 547 | 3300005719 | Ga0068861_100005508 | Ga0068861_1000055086 | 210 |
| 548 | 3300005834 | Ga0068851_10037992 | Ga0068851_100379922 | 210 |
| 549 | 3300005834 | Ga0068851_10113053 | Ga0068851_101130532 | 210 |
| 550 | 3300005841 | Ga0068863_100387218 | Ga0068863_1003872182 | 210 |
| 551 | 3300005843 | Ga0068860_100017835 | Ga0068860_1000178354 | 210 |
| 552 | 3300005844 | Ga0068862_100002626 | Ga0068862_1000026263 | 210 |
| 553 | 3300005844 | Ga0068862_100032603 | Ga0068862_1000326033 | 210 |
| 554 | 3300005844 | Ga0068862_100035259 | Ga0068862_1000352594 | 210 |
| 555 | 3300006195 | Ga0075366_10025447 | Ga0075366_100254472 | 210 |
| 556 | 3300006237 | Ga0097621_100026287 | Ga0097621_1000262874 | 210 |
| 557 | 3300006931 | Ga0097620_100042793 | Ga0097620_1000427932 | 210 |
| 558 | 3300006931 | Ga0097620_100114998 | Ga0097620_1001149981 | 210 |
| 559 | 3300009094 | Ga0111539_10581631 | Ga0111539_105816311 | 210 |
| 560 | 3300009148 | Ga0105243_10020108 | Ga0105243_100201085 | 210 |
| 561 | 3300009148 | Ga0105243_10353300 | Ga0105243_103533002 | 210 |
| 562 | 3300009176 | Ga0105242_10337409 | Ga0105242_103374092 | 210 |
| 563 | 3300009553 | Ga0105249_10017892 | Ga0105249_100178924 | 210 |
| 564 | 3300009553 | Ga0105249_10293441 | Ga0105249_102934413 | 210 |
| 565 | 3300013297 | Ga0157378_10003330 | Ga0157378_100033303 | 210 |
| 566 | 3300013306 | Ga0163162_10005003 | Ga0163162_100050038 | 210 |
| 567 | 3300013308 | Ga0157375_10062210 | Ga0157375_100622103 | 210 |
| 568 | 3300013308 | Ga0157375_10239374 | Ga0157375_102393743 | 210 |
| 569 | 3300014326 | Ga0157380_10061404 | Ga0157380_100614043 | 210 |
| 570 | 3300014968 | Ga0157379_10029042 | Ga0157379_100290424 | 210 |
| 571 | 3300014968 | Ga0157379_10052764 | Ga0157379_100527645 | 210 |
| 572 | 3300014969 | Ga0157376_10003563 | Ga0157376_100035638 | 210 |
| 573 | 3300017792 | Ga0163161_10080670 | Ga0163161_100806702 | 210 |
| 574 | 3300025321 | Ga0207656_10192548 | Ga0207656_101925482 | 210 |
| 575 | 3300025893 | Ga0207682_10032538 | Ga0207682_100325383 | 210 |
| 576 | 3300025893 | Ga0207682_10194352 | Ga0207682_101943522 | 210 |
| 577 | 3300025899 | Ga0207642_10016280 | Ga0207642_100162802 | 210 |
| 578 | 3300025907 | Ga0207645_10270625 | Ga0207645_102706253 | 210 |
| 579 | 3300025925 | Ga0207650_10017187 | Ga0207650_100171876 | 210 |
| 580 | 3300025926 | Ga0207659_10023241 | Ga0207659_100232413 | 210 |
| 581 | 3300025931 | Ga0207644_10042039 | Ga0207644_100420392 | 210 |
| 582 | 3300025931 | Ga0207644_10186631 | Ga0207644_101866312 | 210 |
| 583 | 3300025933 | Ga0207706_10075908 | Ga0207706_100759083 | 210 |
| 584 | 3300025934 | Ga0207686_10211559 | Ga0207686_102115593 | 210 |
| 585 | 3300025935 | Ga0207709_10229289 | Ga0207709_102292893 | 210 |
| 586 | 3300025938 | Ga0207704_10003481 | Ga0207704_100034817 | 210 |
| 587 | 3300025940 | Ga0207691_10010603 | Ga0207691_1001060310 | 210 |
| 588 | 3300025940 | Ga0207691_10044864 | Ga0207691_100448642 | 210 |
| 589 | 3300025940 | Ga0207691_10599137 | Ga0207691_105991371 | 210 |
| 590 | 3300025945 | Ga0207679_10274027 | Ga0207679_102740272 | 210 |
| 591 | 3300025960 | Ga0207651_10032421 | Ga0207651_100324214 | 210 |
| 592 | 3300025961 | Ga0207712_10165533 | Ga0207712_101655332 | 210 |
| 593 | 3300025981 | Ga0207640_10055919 | Ga0207640_100559193 | 210 |
| 594 | 3300026075 | Ga0207708_10013014 | Ga0207708_100130144 | 210 |
| 595 | 3300026078 | Ga0207702_10561089 | Ga0207702_105610892 | 210 |
| 596 | 3300026089 | Ga0207648_10000419 | Ga0207648_1000041934 | 210 |
| 597 | 3300026095 | Ga0207676_10013882 | Ga0207676_100138822 | 210 |
| 598 | 3300026118 | Ga0207675_100000693 | Ga0207675_10000069312 | 210 |
| 599 | 3300026121 | Ga0207683_10124817 | Ga0207683_101248173 | 210 |
| 600 | 3300026142 | Ga0207698_10046432 | Ga0207698_100464323 | 210 |
| 601 | 3300026142 | Ga0207698_10253516 | Ga0207698_102535162 | 210 |
| 602 | 3300028380 | Ga0268265_10013134 | Ga0268265_100131344 | 210 |
| 603 | 3300028380 | Ga0268265_10014510 | Ga0268265_100145107 | 210 |
| 604 | 3300028380 | Ga0268265_10163438 | Ga0268265_101634383 | 210 |
| 605 | 3300028381 | Ga0268264_10039249 | Ga0268264_100392493 | 210 |
| 606 | 3300028381 | Ga0268264_10102470 | Ga0268264_101024703 | 210 |
| 607 | 3300031548 | Ga0307408_100336262 | Ga0307408_1003362622 | 210 |
| 608 | 3300032002 | Ga0307416_101177055 | Ga0307416_1011770552 | 210 |
| 609 | 3300035116 | Ga0373945_0193126 | Ga0373945_0193126_150_782 | 210 |
| 610 | 3300035170 | Ga0373943_0225334 | Ga0373943_0225334_130_762 | 210 |
| 611 | 3300036401 | Ga0373937_0067765 | Ga0373937_0067765_1301_1945 | 210 |
| 612 | 3300037068 | Ga0373925_0046026 | Ga0373925_0046026_181_813 | 210 |
| 613 | 3300037471 | Ga0395905_0043213 | Ga0395905_0043213_2237_2869 | 210 |
| 614 | 3300042015 | Ga0439462_0056101 | Ga0439462_0056101_179_811 | 210 |
| 615 | 3300042131 | Ga0450894_005548 | Ga0450894_005548_642_1274 | 210 |
| 616 | 3300042134 | Ga0450898_021514 | Ga0450898_021514_78_710 | 210 |
| 617 | 3300046459 | Ga0495629_0028744 | Ga0495629_0028744_1649_2293 | 210 |
| 618 | 3300046535 | Ga0495586_0170313 | Ga0495586_0170313_94_726 | 210 |
| 619 | 3300046543 | Ga0495645_0013570 | Ga0495645_0013570_1098_1742 | 210 |
| 620 | 3300046681 | Ga0495647_0145359 | Ga0495647_0145359_124_768 | 210 |
| 621 | 3300046683 | Ga0495658_0014662 | Ga0495658_0014662_325_957 | 210 |
| 622 | 3300046683 | Ga0495658_0358347 | Ga0495658_0358347_52_696 | 210 |
| 623 | 3300047471 | Ga0495684_0530748 | Ga0495684_0530748_78_722 | 210 |
| 624 | 3300048911 | Ga0496108_0257570 | Ga0496108_0257570_93_737 | 210 |
| 625 | 3300048912 | Ga0496109_0131042 | Ga0496109_0131042_176_820 | 210 |
| 626 | 3300048913 | Ga0496110_0303618 | Ga0496110_0303618_20_664 | 210 |
| 627 | 3300050493 | nmdc:mga0k408_146009_c1 | nmdc:mga0k408_146009_c1_105_737 | 210 |
| 628 | 3300050493 | nmdc:mga0k408_249378_c1 | nmdc:mga0k408_249378_c1_71_703 | 210 |
| 629 | 3300050493 | nmdc:mga0k408_28834_c1 | nmdc:mga0k408_28834_c1_1822_2454 | 210 |
| 630 | 3300053077 | Ga0495601_0430729 | Ga0495601_0430729_69_713 | 210 |
| 631 | 3300032005 | Ga0307411_10878749 | Ga0307411_108787491 | 211 |
| 632 | 3300037471 | Ga0395905_0294763 | Ga0395905_0294763_76_741 | 211 |
| 633 | 3300049572 | Ga0501036_0213592 | Ga0501036_0213592_511_1146 | 211 |
| 634 | 3300017792 | Ga0163161_10144445 | Ga0163161_101444453 | 212 |
| 635 | 3300028794 | Ga0307515_10018987 | Ga0307515_100189873 | 212 |
| 636 | 3300046557 | Ga0495622_0000548 | Ga0495622_0000548_1073_1732 | 212 |
| 637 | iso_pu_bacteria | 2855730933 | 2855735054 | 213 |
| 638 | iso_pu_bacteria | 2855767633 | 2855770838 | 213 |
| 639 | iso_pu_bacteria | 2881412998 | 2881418232 | 213 |
| 640 | 3300005295 | Ga0065707_10083353 | Ga0065707_100833538 | 214 |
| 641 | 3300031548 | Ga0307408_100221485 | Ga0307408_1002214852 | 214 |
| 642 | 3300031911 | Ga0307412_10236052 | Ga0307412_102360521 | 214 |
| 643 | 3300041997 | Ga0439431_0014206 | Ga0439431_0014206_1187_1831 | 214 |
| 644 | 3300046507 | Ga0495606_0001756 | Ga0495606_0001756_26301_26960 | 215 |
| 645 | 3300047469 | Ga0495673_0000074 | Ga0495673_0000074_99484_100143 | 215 |
| 646 | 3300053161 | Ga0500634_0084755 | Ga0500634_0084755_903_1550 | 215 |
| 647 | 3300003187 | JGI25151J46595_10000137 | JGI25151J46595_1000013776 | 217 |
| 648 | 3300006051 | Ga0075364_10001290 | Ga0075364_100012909 | 217 |
| 649 | 3300025294 | Ga0209025_1000071 | Ga0209025_1000071184 | 217 |
| 650 | 3300025298 | Ga0209050_1001375 | Ga0209050_100137521 | 217 |
| 651 | 3300048927 | Ga0496124_0192102 | Ga0496124_0192102_470_1123 | 217 |
| 652 | 3300049570 | Ga0501033_0236757 | Ga0501033_0236757_321_974 | 217 |
| 653 | 3300049571 | Ga0501034_0372907 | Ga0501034_0372907_140_793 | 217 |
| 654 | 3300049573 | Ga0501037_0187688 | Ga0501037_0187688_264_917 | 217 |
| 655 | 3300049579 | Ga0501043_0000277 | Ga0501043_0000277_12636_13289 | 217 |
| 656 | 3300049580 | Ga0501046_0000345 | Ga0501046_0000345_33442_34095 | 217 |
| 657 | 3300049581 | Ga0501047_0000395 | Ga0501047_0000395_12636_13289 | 217 |
| 658 | 3300049581 | Ga0501047_0006218 | Ga0501047_0006218_3725_4378 | 217 |
| 659 | 3300049582 | Ga0501048_0000111 | Ga0501048_0000111_12586_13239 | 217 |
| 660 | 3300049822 | Ga0501035_0017204 | Ga0501035_0017204_996_1649 | 217 |
| 661 | 3300049823 | Ga0501044_0030603 | Ga0501044_0030603_4281_4934 | 217 |
| 662 | 3300050491 | nmdc:mga00v17_43511_c1 | nmdc:mga00v17_43511_c1_59_712 | 217 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vi3-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.9126 | 2 | 202 |
| 1fjj-assembly1.cif.gz_A-2 | crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family | 0.9121 | 2 | 202 |
| 1fjj-assembly1.cif.gz_A-2 | crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family | 0.8957 | 2 | 202 |
| 3n08-assembly1.cif.gz_B | crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx | 0.8949 | 2 | 201 |
| 1vi3-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.8907 | 2 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fjjA00 | Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like | 0.9107 | 1 | 201 | 3.90.280.10 |
| 1fjjA00 | Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like | 0.9051 | 1 | 201 | 3.90.280.10 |
| af_P77368_20_183_3.90.280.10 | Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like | 0.8978 | 2 | 202 | 3.90.280.10 |
| 3n08A00 | Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like | 0.8928 | 2 | 201 | 3.90.280.10 |
| 4begB00 | Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like | 0.8883 | 3 | 202 | 3.90.280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C3X4Y9-F1-model_v4 | YbhB/YbcL family Raf kinase inhibitor-like protein | 0.998 | 1 | 206 |
|
| AF-A0A257QJA4-F1-model_v4 | Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) | 0.9961 | 28 | 207 |
GO:0006090
GO:0050242 |
| AF-A0A7I8ECA7-F1-model_v4 | Phospholipid-binding protein | 0.9956 | 1 | 207 |
|
| AF-A0A4Y6PTT7-F1-model_v4 | YbhB/YbcL family Raf kinase inhibitor-like protein | 0.9948 | 1 | 206 |
|
| AF-I3U9P2-F1-model_v4 | YbhB/YbcL family Raf kinase inhibitor-like protein | 0.9928 | 2 | 208 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar