F473455

General Info

Members Datasets Scaffolds Average Seq Length
662 258 658 212

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100126239|Ga0068868_1001262392
Length 227
Sequence VIRRVGPAFRSSEDTMKLWSDSWPNGERIPARYACGRLDGADGTAFSDNVNPHLAWSELPPATQSLVLVCHDFDVPSRGDDVNQAGREIPADLPRVDFFHWLLADVPVSARSIEEGALSKGFSPRGKPGPAVTVPGLERARQGINDFTGWFAGNPALAGDYYGYDGPYPPWNDSLVHHYVFTLYALSVARAPVEGRFGGAELRKAIDGHVLAEAMHSGTYTLNRRLG

Samples

Sample ID Description Type Environment
1 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
2 2855730933 Achromobacter sp. HZ28 Isolate Nodule
3 2855767633 Achromobacter sp. HZ34 Isolate Nodule
4 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
191 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
192 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
193 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
232 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
245 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
246 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
247 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
248 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
258 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.15
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.63
Nodule 0.6
Rhizoplane 3.78
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000137 3300003187 Bacteria 96370
2 rootL2_10176069 3300003322 Bacteria 2021
3 Ga0055524_1000139 3300003775 Bacteria 86430
4 Ga0055530_10001259 3300003791 Bacteria 19200
5 Ga0055540_1000090 3300003792 Bacteria 99454
6 Ga0055540_1000091 3300003792 Bacteria 99089
7 Ga0055531_10014159 3300003794 Bacteria 3615
8 Ga0065707_10083353 3300005295 Bacteria 9453
9 Ga0070658_10006609 3300005327 Bacteria 9401
10 Ga0070658_10098024 3300005327 Bacteria 2421
11 Ga0070676_10007521 3300005328 Bacteria 5850
12 Ga0070676_10010297 3300005328 Bacteria 5070
13 Ga0070676_10257501 3300005328 Bacteria 1167
14 Ga0070676_10259763 3300005328 Bacteria 1162
15 Ga0070683_100018476 3300005329 Bacteria 6176
16 Ga0070683_100582306 3300005329 Bacteria 1070
17 Ga0070683_100808641 3300005329 Bacteria 899
18 Ga0070690_100193669 3300005330 Bacteria 1411
19 Ga0070670_100000527 3300005331 Bacteria 30691
20 Ga0070670_100038384 3300005331 Bacteria 4118
21 Ga0070670_100107954 3300005331 Bacteria 2398
22 Ga0070670_100138295 3300005331 Bacteria 2105
23 Ga0070670_100157782 3300005331 Bacteria 1966
24 Ga0070670_100213390 3300005331 Bacteria 1678
25 Ga0070670_100296994 3300005331 Bacteria 1412
26 Ga0070677_10039324 3300005333 Bacteria 1856
27 Ga0070677_10048834 3300005333 Bacteria 1702
28 Ga0070677_10064905 3300005333 Bacteria 1518
29 Ga0068869_100004440 3300005334 Bacteria 8721
30 Ga0068869_100012807 3300005334 Bacteria 5549
31 Ga0068869_100020181 3300005334 Bacteria 4566
32 Ga0068869_100217947 3300005334 Bacteria 1511
33 Ga0068869_100375644 3300005334 Bacteria 1164
34 Ga0070666_10002033 3300005335 Bacteria 12294
35 Ga0070666_10185178 3300005335 Bacteria 1462
36 Ga0070680_100006667 3300005336 Bacteria 8787
37 Ga0068868_100001810 3300005338 Bacteria 14685
38 Ga0068868_100007261 3300005338 Bacteria 7882
39 Ga0068868_100072102 3300005338 Bacteria 2755
40 Ga0068868_100126239 3300005338 Bacteria 2090
41 Ga0068868_100129245 3300005338 Bacteria 2066
42 Ga0068868_100161654 3300005338 Bacteria 1850
43 Ga0068868_100183562 3300005338 Bacteria 1737
44 Ga0068868_100955561 3300005338 Bacteria 782
45 Ga0070660_100022549 3300005339 Bacteria 4657
46 Ga0070689_100093357 3300005340 Bacteria 2375
47 Ga0070687_100007199 3300005343 Bacteria 4617
48 Ga0070661_100005399 3300005344 Bacteria 8811
49 Ga0070661_100055228 3300005344 Bacteria 2908
50 Ga0070661_100093101 3300005344 Bacteria 2233
51 Ga0070661_100659701 3300005344 Bacteria 850
52 Ga0070692_10139895 3300005345 Bacteria 1369
53 Ga0070668_100004185 3300005347 Bacteria 10693
54 Ga0070668_100010936 3300005347 Bacteria 6752
55 Ga0070668_100044298 3300005347 Bacteria 3414
56 Ga0070669_100063158 3300005353 Bacteria 2725
57 Ga0070669_100186002 3300005353 Bacteria 1627
58 Ga0070669_100319221 3300005353 Bacteria 1254
59 Ga0070675_100002331 3300005354 Bacteria 14118
60 Ga0070675_100011552 3300005354 Bacteria 6917
61 Ga0070675_100013401 3300005354 Bacteria 6443
62 Ga0070675_100190348 3300005354 Bacteria 1777
63 Ga0070675_100257834 3300005354 Bacteria 1527
64 Ga0070675_100277368 3300005354 Bacteria 1472
65 Ga0070671_100004867 3300005355 Bacteria 10682
66 Ga0070671_100006569 3300005355 Bacteria 9298
67 Ga0070671_100038919 3300005355 Bacteria 3947
68 Ga0070671_100176529 3300005355 Bacteria 1808
69 Ga0070671_100314287 3300005355 Bacteria 1335
70 Ga0070674_100001965 3300005356 Bacteria 11241
71 Ga0070674_100113475 3300005356 Bacteria 1994
72 Ga0070674_100208739 3300005356 Bacteria 1512
73 Ga0070673_100009152 3300005364 Bacteria 6635
74 Ga0070673_100109832 3300005364 Bacteria 2285
75 Ga0070673_100212439 3300005364 Bacteria 1672
76 Ga0070673_100225610 3300005364 Bacteria 1623
77 Ga0070673_100886691 3300005364 Bacteria 827
78 Ga0070688_100038594 3300005365 Bacteria 2918
79 Ga0070688_100477381 3300005365 Bacteria 937
80 Ga0070659_100021242 3300005366 Bacteria 4939
81 Ga0070659_100022737 3300005366 Bacteria 4789
82 Ga0070659_100185871 3300005366 Bacteria 1707
83 Ga0070667_100007789 3300005367 Bacteria 8881
84 Ga0070667_100009094 3300005367 Bacteria 8219
85 Ga0070667_100016258 3300005367 Bacteria 6154
86 Ga0070700_100014555 3300005441 Bacteria 4443
87 Ga0070700_100039713 3300005441 Bacteria 2877
88 Ga0070700_100120998 3300005441 Bacteria 1754
89 Ga0070663_100002951 3300005455 Bacteria 9688
90 Ga0070663_100059788 3300005455 Bacteria 2739
91 Ga0070663_100079636 3300005455 Bacteria 2404
92 Ga0070678_100007587 3300005456 Bacteria 6443
93 Ga0070678_100090304 3300005456 Bacteria 2347
94 Ga0070678_100097700 3300005456 Bacteria 2269
95 Ga0070678_100102186 3300005456 Bacteria 2224
96 Ga0070678_100139566 3300005456 Bacteria 1937
97 Ga0070678_100359330 3300005456 Bacteria 1254
98 Ga0070678_100497193 3300005456 Bacteria 1075
99 Ga0070678_100958460 3300005456 Bacteria 785
100 Ga0070662_100004754 3300005457 Bacteria 8600
101 Ga0070662_100021079 3300005457 Bacteria 4446
102 Ga0070662_100048266 3300005457 Bacteria 3066
103 Ga0070662_100069085 3300005457 Bacteria 2599
104 Ga0070662_100374633 3300005457 Bacteria 1171
105 Ga0068867_100004555 3300005459 Bacteria 9747
106 Ga0068867_100020712 3300005459 Bacteria 4687
107 Ga0068867_100111341 3300005459 Bacteria 2103
108 Ga0068867_100236353 3300005459 Bacteria 1480
109 Ga0070679_100017999 3300005530 Bacteria 6848
110 Ga0070684_100275307 3300005535 Bacteria 1541
111 Ga0070684_100727427 3300005535 Bacteria 926
112 Ga0068853_100038341 3300005539 Bacteria 4081
113 Ga0068853_100078421 3300005539 Bacteria 2887
114 Ga0068853_100224810 3300005539 Bacteria 1715
115 Ga0068853_100377449 3300005539 Bacteria 1323
116 Ga0070672_100001982 3300005543 Bacteria 12830
117 Ga0070672_100004824 3300005543 Bacteria 8860
118 Ga0070672_100008163 3300005543 Bacteria 7156
119 Ga0070672_100028822 3300005543 Bacteria 4157
120 Ga0070672_100073815 3300005543 Bacteria 2719
121 Ga0070672_100084070 3300005543 Bacteria 2555
122 Ga0070672_100105115 3300005543 Bacteria 2295
123 Ga0070672_100137927 3300005543 Bacteria 2010
124 Ga0070672_100275152 3300005543 Bacteria 1422
125 Ga0070672_100367085 3300005543 Bacteria 1229
126 Ga0070672_100688434 3300005543 Bacteria 895
127 Ga0070693_100005436 3300005547 Bacteria 6120
128 Ga0070693_100006153 3300005547 Bacteria 5815
129 Ga0070693_100070902 3300005547 Bacteria 2052
130 Ga0068855_100018722 3300005563 Bacteria 8325
131 Ga0068855_100410942 3300005563 Bacteria 1482
132 Ga0068855_100851532 3300005563 Bacteria 966
133 Ga0070664_100008904 3300005564 Bacteria 8133
134 Ga0070664_100228096 3300005564 Bacteria 1669
135 Ga0070664_100282262 3300005564 Bacteria 1498
136 Ga0070664_100296020 3300005564 Bacteria 1461
137 Ga0068857_100013495 3300005577 Bacteria 7117
138 Ga0068854_100058976 3300005578 Bacteria 2772
139 Ga0068854_100067551 3300005578 Bacteria 2604
140 Ga0068856_100021431 3300005614 Bacteria 6283
141 Ga0068856_100617867 3300005614 Bacteria 1105
142 Ga0070702_100028970 3300005615 Bacteria 3006
143 Ga0070702_100084844 3300005615 Bacteria 1906
144 Ga0070702_100235883 3300005615 Bacteria 1232
145 Ga0070702_100763831 3300005615 Bacteria 744
146 Ga0068852_100003024 3300005616 Bacteria 11700
147 Ga0068852_100006821 3300005616 Bacteria 8293
148 Ga0068852_100028674 3300005616 Bacteria 4561
149 Ga0068852_100030751 3300005616 Bacteria 4424
150 Ga0068852_100129301 3300005616 Bacteria 2324
151 Ga0068852_100423490 3300005616 Bacteria 1313
152 Ga0068859_100029554 3300005617 Bacteria 5500
153 Ga0068859_100042793 3300005617 Bacteria 4550
154 Ga0068859_100115004 3300005617 Bacteria 2755
155 Ga0068859_100175376 3300005617 Bacteria 2225
156 Ga0068864_100001527 3300005618 Bacteria 19051
157 Ga0068864_100018338 3300005618 Bacteria 5846
158 Ga0068864_100018933 3300005618 Bacteria 5756
159 Ga0068864_100029588 3300005618 Bacteria 4640
160 Ga0068864_100051719 3300005618 Bacteria 3539
161 Ga0068864_100084251 3300005618 Bacteria 2793
162 Ga0068866_10002740 3300005718 Bacteria 7264
163 Ga0068866_10181765 3300005718 Bacteria 1243
164 Ga0068861_100001789 3300005719 Bacteria 13833
165 Ga0068861_100005508 3300005719 Bacteria 8577
166 Ga0068861_100046617 3300005719 Bacteria 3268
167 Ga0068851_10008824 3300005834 Bacteria 4672
168 Ga0068851_10008978 3300005834 Bacteria 4637
169 Ga0068851_10025597 3300005834 Bacteria 2895
170 Ga0068851_10037992 3300005834 Bacteria 2414
171 Ga0068851_10063620 3300005834 Bacteria 1895
172 Ga0068851_10113053 3300005834 Bacteria 1451
173 Ga0068870_10092273 3300005840 Bacteria 1696
174 Ga0068863_100007547 3300005841 Bacteria 10637
175 Ga0068863_100016334 3300005841 Bacteria 7123
176 Ga0068863_100387218 3300005841 Bacteria 1366
177 Ga0068863_100389591 3300005841 Bacteria 1361
178 Ga0068863_100390450 3300005841 Bacteria 1360
179 Ga0068858_100002470 3300005842 Bacteria 18659
180 Ga0068858_100005840 3300005842 Bacteria 12023
181 Ga0068858_100008215 3300005842 Bacteria 10036
182 Ga0068858_100018020 3300005842 Bacteria 6613
183 Ga0068858_100019820 3300005842 Bacteria 6288
184 Ga0068858_100387342 3300005842 Bacteria 1342
185 Ga0068860_100001365 3300005843 Bacteria 26507
186 Ga0068860_100011663 3300005843 Bacteria 8664
187 Ga0068860_100017835 3300005843 Bacteria 6913
188 Ga0068860_100198116 3300005843 Bacteria 1945
189 Ga0068860_101230384 3300005843 Bacteria 769
190 Ga0068862_100002626 3300005844 Bacteria 15828
191 Ga0068862_100025242 3300005844 Bacteria 4989
192 Ga0068862_100032603 3300005844 Bacteria 4402
193 Ga0068862_100035259 3300005844 Bacteria 4235
194 Ga0068862_100116699 3300005844 Bacteria 2348
195 Ga0068862_100166779 3300005844 Bacteria 1969
196 Ga0068862_100491130 3300005844 Bacteria 1164
197 Ga0075364_10001290 3300006051 Bacteria 13499
198 Ga0075366_10010694 3300006195 Bacteria 5158
199 Ga0075366_10025447 3300006195 Bacteria 3457
200 Ga0097621_100015141 3300006237 Bacteria 5795
201 Ga0097621_100026287 3300006237 Bacteria 4564
202 Ga0097621_100085384 3300006237 Bacteria 2633
203 Ga0097621_100114484 3300006237 Bacteria 2282
204 Ga0097621_100338545 3300006237 Bacteria 1336
205 Ga0097621_100919178 3300006237 Bacteria 816
206 Ga0097621_101015610 3300006237 Bacteria 776
207 Ga0068871_100003520 3300006358 Bacteria 10774
208 Ga0068871_100048486 3300006358 Bacteria 3429
209 Ga0068871_100279766 3300006358 Bacteria 1459
210 Ga0075434_100042080 3300006871 Bacteria 4529
211 Ga0068865_100006734 3300006881 Bacteria 7030
212 Ga0068865_100089552 3300006881 Bacteria 2229
213 Ga0068865_100257112 3300006881 Bacteria 1381
214 Ga0068865_100270221 3300006881 Bacteria 1350
215 Ga0097620_100029554 3300006931 Bacteria 5500
216 Ga0097620_100042793 3300006931 Bacteria 4550
217 Ga0097620_100114998 3300006931 Bacteria 2755
218 Ga0097620_100175378 3300006931 Bacteria 2225
219 Ga0079104_1000916 3300006946 Bacteria 23741
220 Ga0105240_10328268 3300009093 Bacteria 1742
221 Ga0105240_10908394 3300009093 Bacteria 947
222 Ga0111539_10581631 3300009094 Bacteria 1304
223 Ga0105245_10016431 3300009098 Bacteria 6456
224 Ga0105245_10255931 3300009098 Bacteria 1702
225 Ga0105245_10746472 3300009098 Bacteria 1014
226 Ga0105247_10130196 3300009101 Bacteria 1639
227 Ga0114129_10084121 3300009147 Bacteria 4418
228 Ga0114129_11688650 3300009147 Bacteria 773
229 Ga0105243_10020108 3300009148 Bacteria 5061
230 Ga0105243_10040884 3300009148 Bacteria 3624
231 Ga0105243_10353300 3300009148 Bacteria 1350
232 Ga0105243_10648309 3300009148 Bacteria 1023
233 Ga0105242_10058845 3300009176 Bacteria 3152
234 Ga0105242_10337409 3300009176 Bacteria 1388
235 Ga0105242_10350864 3300009176 Bacteria 1363
236 Ga0105248_10011287 3300009177 Bacteria 9853
237 Ga0105248_10039414 3300009177 Bacteria 5291
238 Ga0105248_10047396 3300009177 Bacteria 4819
239 Ga0105248_10083807 3300009177 Bacteria 3586
240 Ga0105248_10186381 3300009177 Bacteria 2338
241 Ga0105248_10339087 3300009177 Bacteria 1692
242 Ga0105248_10473151 3300009177 Bacteria 1412
243 Ga0105248_10522602 3300009177 Bacteria 1338
244 Ga0105237_10031046 3300009545 Bacteria 5420
245 Ga0105238_10093334 3300009551 Bacteria 2998
246 Ga0105249_10010587 3300009553 Bacteria 8103
247 Ga0105249_10015417 3300009553 Bacteria 6764
248 Ga0105249_10017892 3300009553 Bacteria 6297
249 Ga0105249_10293441 3300009553 Bacteria 1628
250 Ga0105239_10196056 3300010375 Bacteria 2262
251 Ga0157327_1003471 3300012512 Bacteria 1165
252 Ga0157373_10007411 3300013100 Bacteria 8160
253 Ga0157371_10130018 3300013102 Bacteria 1791
254 Ga0157370_10439805 3300013104 Bacteria 1199
255 Ga0157369_10049712 3300013105 Bacteria 4544
256 Ga0157369_10213729 3300013105 Bacteria 2021
257 Ga0157374_10006173 3300013296 Bacteria 10156
258 Ga0157374_10389084 3300013296 Bacteria 1390
259 Ga0157374_10709016 3300013296 Bacteria 1020
260 Ga0157378_10003330 3300013297 Bacteria 14290
261 Ga0157378_10748716 3300013297 Bacteria 1000
262 Ga0163162_10005003 3300013306 Bacteria 12767
263 Ga0163162_10006647 3300013306 Bacteria 11210
264 Ga0163162_10012295 3300013306 Bacteria 8356
265 Ga0163162_10019368 3300013306 Bacteria 6674
266 Ga0163162_10098355 3300013306 Bacteria 3015
267 Ga0163162_10193774 3300013306 Bacteria 2160
268 Ga0163162_10232968 3300013306 Bacteria 1972
269 Ga0157372_10008138 3300013307 Bacteria 11151
270 Ga0157372_10024157 3300013307 Bacteria 6597
271 Ga0157375_10011278 3300013308 Bacteria 7889
272 Ga0157375_10024455 3300013308 Bacteria 5590
273 Ga0157375_10040792 3300013308 Bacteria 4478
274 Ga0157375_10062210 3300013308 Bacteria 3708
275 Ga0157375_10239374 3300013308 Bacteria 1974
276 Ga0157375_10522370 3300013308 Bacteria 1350
277 Ga0157375_10966194 3300013308 Bacteria 993
278 Ga0163163_10001523 3300014325 Bacteria 19551
279 Ga0163163_10077224 3300014325 Bacteria 3326
280 Ga0157380_10011942 3300014326 Bacteria 6283
281 Ga0157380_10036620 3300014326 Bacteria 3797
282 Ga0157380_10061404 3300014326 Bacteria 3007
283 Ga0157380_10063579 3300014326 Bacteria 2960
284 Ga0157380_10328842 3300014326 Bacteria 1420
285 Ga0157380_10487300 3300014326 Bacteria 1194
286 Ga0157377_10002400 3300014745 Bacteria 8267
287 Ga0157379_10002555 3300014968 Bacteria 15267
288 Ga0157379_10003481 3300014968 Bacteria 13328
289 Ga0157379_10004289 3300014968 Bacteria 12180
290 Ga0157379_10007487 3300014968 Bacteria 9453
291 Ga0157379_10014842 3300014968 Bacteria 6832
292 Ga0157379_10029042 3300014968 Bacteria 4917
293 Ga0157379_10052764 3300014968 Bacteria 3631
294 Ga0157379_10141241 3300014968 Bacteria 2171
295 Ga0157379_10372931 3300014968 Bacteria 1309
296 Ga0157376_10003563 3300014969 Bacteria 10736
297 Ga0157376_10005881 3300014969 Bacteria 8606
298 Ga0157376_10068596 3300014969 Bacteria 3003
299 Ga0157376_10171775 3300014969 Bacteria 1975
300 Ga0157376_10261357 3300014969 Bacteria 1622
301 Ga0157376_10385587 3300014969 Bacteria 1351
302 Ga0163161_10020312 3300017792 Bacteria 4660
303 Ga0163161_10042513 3300017792 Bacteria 3269
304 Ga0163161_10044600 3300017792 Bacteria 3194
305 Ga0163161_10080670 3300017792 Bacteria 2395
306 Ga0163161_10144445 3300017792 Bacteria 1804
307 Ga0163161_10712424 3300017792 Bacteria 837
308 Ga0207666_1002213 3300025271 Bacteria 2332
309 Ga0209025_1000071 3300025294 Bacteria 287297
310 Ga0209050_1000326 3300025298 Bacteria 95495
311 Ga0209050_1000967 3300025298 Bacteria 36985
312 Ga0209050_1001375 3300025298 Bacteria 26556
313 Ga0209050_1036330 3300025298 Bacteria 1440
314 Ga0209256_1000019 3300025299 Bacteria 558627
315 Ga0209051_1000133 3300025303 Bacteria 139014
316 Ga0209257_1000038 3300025304 Bacteria 609032
317 Ga0207697_10013496 3300025315 Bacteria 3408
318 Ga0207697_10145965 3300025315 Bacteria 1028
319 Ga0207656_10008357 3300025321 Bacteria 3806
320 Ga0207656_10009070 3300025321 Bacteria 3687
321 Ga0207656_10192548 3300025321 Bacteria 982
322 Ga0207682_10005021 3300025893 Bacteria 5426
323 Ga0207682_10019663 3300025893 Bacteria 2645
324 Ga0207682_10032538 3300025893 Bacteria 2096
325 Ga0207682_10036448 3300025893 Bacteria 1990
326 Ga0207682_10194352 3300025893 Bacteria 931
327 Ga0207642_10002738 3300025899 Bacteria 5505
328 Ga0207642_10016280 3300025899 Bacteria 2796
329 Ga0207688_10007645 3300025901 Bacteria 5886
330 Ga0207688_10018395 3300025901 Bacteria 3802
331 Ga0207688_10199000 3300025901 Bacteria 1200
332 Ga0207680_10003179 3300025903 Bacteria 7715
333 Ga0207680_10169734 3300025903 Bacteria 1468
334 Ga0207645_10007079 3300025907 Bacteria 7978
335 Ga0207645_10017927 3300025907 Bacteria 4668
336 Ga0207645_10184291 3300025907 Bacteria 1370
337 Ga0207645_10270625 3300025907 Bacteria 1126
338 Ga0207705_10132723 3300025909 Bacteria 1854
339 Ga0207654_10037247 3300025911 Bacteria 2721
340 Ga0207707_10069401 3300025912 Bacteria 3071
341 Ga0207695_10184325 3300025913 Bacteria 2007
342 Ga0207671_10080690 3300025914 Bacteria 2439
343 Ga0207660_10013406 3300025917 Bacteria 5372
344 Ga0207662_10802386 3300025918 Bacteria 663
345 Ga0207657_10061349 3300025919 Bacteria 3224
346 Ga0207657_10112825 3300025919 Bacteria 2243
347 Ga0207649_10023850 3300025920 Bacteria 3548
348 Ga0207649_10038984 3300025920 Bacteria 2879
349 Ga0207649_10172645 3300025920 Bacteria 1507
350 Ga0207652_10030599 3300025921 Bacteria 4509
351 Ga0207681_10003817 3300025923 Bacteria 9343
352 Ga0207681_10364662 3300025923 Bacteria 1159
353 Ga0207694_10015426 3300025924 Bacteria 5762
354 Ga0207694_10019601 3300025924 Bacteria 5115
355 Ga0207650_10000382 3300025925 Bacteria 41562
356 Ga0207650_10017187 3300025925 Bacteria 5063
357 Ga0207650_10055425 3300025925 Bacteria 2943
358 Ga0207650_10072514 3300025925 Bacteria 2592
359 Ga0207650_10286547 3300025925 Bacteria 1342
360 Ga0207650_10379448 3300025925 Bacteria 1167
361 Ga0207650_10522543 3300025925 Bacteria 993
362 Ga0207659_10002417 3300025926 Bacteria 11122
363 Ga0207659_10006243 3300025926 Bacteria 7290
364 Ga0207659_10007553 3300025926 Bacteria 6696
365 Ga0207659_10017327 3300025926 Bacteria 4705
366 Ga0207659_10023241 3300025926 Bacteria 4134
367 Ga0207659_10027687 3300025926 Bacteria 3841
368 Ga0207659_10183021 3300025926 Bacteria 1662
369 Ga0207687_10017347 3300025927 Bacteria 4739
370 Ga0207687_10032593 3300025927 Bacteria 3529
371 Ga0207687_10210725 3300025927 Bacteria 1524
372 Ga0207644_10009179 3300025931 Bacteria 6485
373 Ga0207644_10010498 3300025931 Bacteria 6105
374 Ga0207644_10042039 3300025931 Bacteria 3237
375 Ga0207644_10186631 3300025931 Bacteria 1628
376 Ga0207644_10367443 3300025931 Bacteria 1171
377 Ga0207644_10403898 3300025931 Bacteria 1117
378 Ga0207690_10005702 3300025932 Bacteria 7355
379 Ga0207690_10178692 3300025932 Bacteria 1596
380 Ga0207706_10001995 3300025933 Bacteria 19971
381 Ga0207706_10009005 3300025933 Bacteria 9185
382 Ga0207706_10075908 3300025933 Bacteria 2956
383 Ga0207706_10245012 3300025933 Bacteria 1566
384 Ga0207706_10340536 3300025933 Bacteria 1305
385 Ga0207706_10544722 3300025933 Bacteria 999
386 Ga0207686_10024985 3300025934 Bacteria 3469
387 Ga0207686_10211559 3300025934 Bacteria 1394
388 Ga0207686_11031600 3300025934 Bacteria 668
389 Ga0207709_10010409 3300025935 Bacteria 5120
390 Ga0207709_10229289 3300025935 Bacteria 1344
391 Ga0207669_10011790 3300025937 Bacteria 4270
392 Ga0207669_10090965 3300025937 Bacteria 1986
393 Ga0207669_10217933 3300025937 Bacteria 1398
394 Ga0207704_10002822 3300025938 Bacteria 7837
395 Ga0207704_10003481 3300025938 Bacteria 7159
396 Ga0207704_10061980 3300025938 Bacteria 2323
397 Ga0207704_10111635 3300025938 Bacteria 1849
398 Ga0207691_10004985 3300025940 Bacteria 12806
399 Ga0207691_10010603 3300025940 Bacteria 8839
400 Ga0207691_10035897 3300025940 Bacteria 4596
401 Ga0207691_10044864 3300025940 Bacteria 4067
402 Ga0207691_10098585 3300025940 Bacteria 2610
403 Ga0207691_10134093 3300025940 Bacteria 2186
404 Ga0207691_10138439 3300025940 Bacteria 2146
405 Ga0207691_10273601 3300025940 Bacteria 1454
406 Ga0207691_10295161 3300025940 Bacteria 1393
407 Ga0207691_10599137 3300025940 Bacteria 933
408 Ga0207711_10015498 3300025941 Bacteria 6326
409 Ga0207711_10043131 3300025941 Bacteria 3846
410 Ga0207711_10058166 3300025941 Bacteria 3326
411 Ga0207711_10084520 3300025941 Bacteria 2778
412 Ga0207711_10106031 3300025941 Bacteria 2493
413 Ga0207711_10127103 3300025941 Bacteria 2282
414 Ga0207711_10261101 3300025941 Bacteria 1592
415 Ga0207711_10536062 3300025941 Bacteria 1092
416 Ga0207689_10000996 3300025942 Bacteria 27158
417 Ga0207689_10005866 3300025942 Bacteria 10886
418 Ga0207689_10019786 3300025942 Bacteria 5670
419 Ga0207661_10119681 3300025944 Bacteria 2240
420 Ga0207661_10617496 3300025944 Bacteria 995
421 Ga0207679_10023086 3300025945 Bacteria 4247
422 Ga0207679_10274027 3300025945 Bacteria 1444
423 Ga0207679_10281902 3300025945 Bacteria 1425
424 Ga0207679_10352500 3300025945 Bacteria 1283
425 Ga0207679_10366783 3300025945 Bacteria 1259
426 Ga0207679_10571510 3300025945 Bacteria 1016
427 Ga0207651_10005465 3300025960 Bacteria 6527
428 Ga0207651_10032421 3300025960 Bacteria 3355
429 Ga0207651_10033408 3300025960 Bacteria 3318
430 Ga0207651_10122313 3300025960 Bacteria 1976
431 Ga0207712_10002952 3300025961 Bacteria 10857
432 Ga0207712_10087613 3300025961 Bacteria 2284
433 Ga0207712_10165533 3300025961 Bacteria 1723
434 Ga0207668_10018678 3300025972 Bacteria 4369
435 Ga0207668_10028532 3300025972 Bacteria 3650
436 Ga0207668_10172783 3300025972 Bacteria 1696
437 Ga0207668_10390918 3300025972 Bacteria 1173
438 Ga0207640_10005754 3300025981 Bacteria 6757
439 Ga0207640_10055919 3300025981 Bacteria 2587
440 Ga0207640_10057330 3300025981 Bacteria 2561
441 Ga0207658_10000181 3300025986 Bacteria 67700
442 Ga0207658_10007082 3300025986 Bacteria 7640
443 Ga0207658_10030504 3300025986 Bacteria 3818
444 Ga0207658_10137721 3300025986 Bacteria 1971
445 Ga0207677_10000853 3300026023 Bacteria 17454
446 Ga0207677_10016079 3300026023 Bacteria 4421
447 Ga0207677_10035612 3300026023 Bacteria 3235
448 Ga0207677_10057068 3300026023 Bacteria 2679
449 Ga0207677_10591141 3300026023 Bacteria 973
450 Ga0207703_10000907 3300026035 Bacteria 28985
451 Ga0207703_10002895 3300026035 Bacteria 14618
452 Ga0207703_10003620 3300026035 Bacteria 12891
453 Ga0207703_10026824 3300026035 Bacteria 4537
454 Ga0207639_10051155 3300026041 Bacteria 3141
455 Ga0207639_10553653 3300026041 Bacteria 1056
456 Ga0207639_10825815 3300026041 Bacteria 864
457 Ga0207678_10003624 3300026067 Bacteria 13877
458 Ga0207678_10072781 3300026067 Bacteria 2945
459 Ga0207678_10126976 3300026067 Bacteria 2175
460 Ga0207678_10150777 3300026067 Bacteria 1985
461 Ga0207708_10013014 3300026075 Bacteria 6207
462 Ga0207708_10030177 3300026075 Bacteria 4112
463 Ga0207708_10096148 3300026075 Bacteria 2288
464 Ga0207702_10011735 3300026078 Bacteria 7298
465 Ga0207702_10268091 3300026078 Bacteria 1610
466 Ga0207702_10551717 3300026078 Bacteria 1127
467 Ga0207702_10561089 3300026078 Bacteria 1118
468 Ga0207641_10005494 3300026088 Bacteria 10811
469 Ga0207641_10006799 3300026088 Bacteria 9582
470 Ga0207641_10076167 3300026088 Bacteria 2899
471 Ga0207641_10563026 3300026088 Bacteria 1112
472 Ga0207641_10777422 3300026088 Bacteria 946
473 Ga0207648_10000419 3300026089 Bacteria 46680
474 Ga0207648_10018549 3300026089 Bacteria 6297
475 Ga0207648_10051037 3300026089 Bacteria 3616
476 Ga0207648_10306586 3300026089 Bacteria 1425
477 Ga0207676_10002438 3300026095 Bacteria 13252
478 Ga0207676_10012441 3300026095 Bacteria 6098
479 Ga0207676_10013882 3300026095 Bacteria 5783
480 Ga0207676_10016864 3300026095 Bacteria 5288
481 Ga0207676_10064169 3300026095 Bacteria 2919
482 Ga0207676_10081670 3300026095 Bacteria 2626
483 Ga0207676_10294065 3300026095 Bacteria 1480
484 Ga0207674_10066252 3300026116 Bacteria 3638
485 Ga0207675_100000693 3300026118 Bacteria 33301
486 Ga0207675_100002360 3300026118 Bacteria 18687
487 Ga0207675_100002486 3300026118 Bacteria 18250
488 Ga0207675_100358152 3300026118 Bacteria 1431
489 Ga0207683_10002157 3300026121 Bacteria 17286
490 Ga0207683_10055151 3300026121 Bacteria 3485
491 Ga0207683_10084574 3300026121 Bacteria 2820
492 Ga0207683_10093009 3300026121 Bacteria 2687
493 Ga0207683_10124817 3300026121 Bacteria 2313
494 Ga0207683_10196292 3300026121 Bacteria 1834
495 Ga0207683_10200619 3300026121 Bacteria 1813
496 Ga0207683_10440416 3300026121 Bacteria 1201
497 Ga0207698_10007978 3300026142 Bacteria 6669
498 Ga0207698_10046432 3300026142 Bacteria 3280
499 Ga0207698_10104525 3300026142 Bacteria 2357
500 Ga0207698_10180043 3300026142 Bacteria 1871
501 Ga0207698_10253516 3300026142 Bacteria 1612
502 Ga0207698_10291483 3300026142 Bacteria 1515
503 Ga0207698_10535431 3300026142 Bacteria 1145
504 Ga0209281_1000935 3300027111 Bacteria 24025
505 Ga0209974_10002440 3300027876 Bacteria 6719
506 Ga0268265_10012152 3300028380 Bacteria 5831
507 Ga0268265_10013134 3300028380 Bacteria 5626
508 Ga0268265_10014510 3300028380 Bacteria 5370
509 Ga0268265_10058457 3300028380 Bacteria 2944
510 Ga0268265_10163438 3300028380 Bacteria 1894
511 Ga0268265_10474119 3300028380 Bacteria 1174
512 Ga0268264_10001738 3300028381 Bacteria 20024
513 Ga0268264_10007941 3300028381 Bacteria 8832
514 Ga0268264_10039249 3300028381 Bacteria 3912
515 Ga0268264_10102470 3300028381 Bacteria 2491
516 Ga0268264_10134746 3300028381 Bacteria 2194
517 Ga0268264_10291303 3300028381 Bacteria 1533
518 Ga0307515_10018987 3300028794 Bacteria 12405
519 Ga0265327_10164121 3300031251 Bacteria 1024
520 Ga0307408_100075271 3300031548 Bacteria 2508
521 Ga0307408_100221485 3300031548 Bacteria 1544
522 Ga0307408_100336262 3300031548 Bacteria 1277
523 Ga0307408_100353273 3300031548 Bacteria 1248
524 Ga0307410_10204103 3300031852 Bacteria 1511
525 Ga0307406_10019969 3300031901 Bacteria 3938
526 Ga0307406_10178724 3300031901 Bacteria 1543
527 Ga0307412_10026713 3300031911 Bacteria 3592
528 Ga0307412_10236052 3300031911 Bacteria 1411
529 Ga0307409_100003223 3300031995 Bacteria 8789
530 Ga0307416_100001157 3300032002 Bacteria 14184
531 Ga0307416_100090220 3300032002 Bacteria 2627
532 Ga0307416_101177055 3300032002 Bacteria 872
533 Ga0307411_10022265 3300032005 Bacteria 3727
534 Ga0307411_10212681 3300032005 Bacteria 1494
535 Ga0307411_10878749 3300032005 Bacteria 795
536 Ga0307415_100135773 3300032126 Bacteria 1870
537 Ga0307415_100323282 3300032126 Bacteria 1287
538 Ga0373948_0019368 3300034817 Bacteria 1287
539 Ga0373938_0004404 3300034957 Bacteria 2352
540 Ga0373952_0062208 3300035092 Bacteria 915
541 Ga0373923_0108112 3300035111 Bacteria 1233
542 Ga0373939_0074949 3300035114 Bacteria 1111
543 Ga0373945_0026236 3300035116 Bacteria 2029
544 Ga0373945_0193126 3300035116 Bacteria 842
545 Ga0373960_0023822 3300035121 Bacteria 1651
546 Ga0373943_0033638 3300035170 Bacteria 2443
547 Ga0373943_0225334 3300035170 Bacteria 1045
548 Ga0373931_0018622 3300035691 Bacteria 3455
549 Ga0373927_0183986 3300035695 Bacteria 1371
550 Ga0373947_0063240 3300035725 Bacteria 2254
551 Ga0373937_0067765 3300036401 Bacteria 3289
552 Ga0373937_0778759 3300036401 Bacteria 904
553 Ga0373925_0046026 3300037068 Bacteria 3243
554 Ga0395905_0043213 3300037471 Bacteria 4228
555 Ga0395905_0083762 3300037471 Bacteria 2987
556 Ga0395905_0294763 3300037471 Bacteria 1509
557 Ga0436365_1317424 3300039437 Bacteria 3014
558 Ga0436363_0116538 3300039450 Bacteria 2399
559 Ga0439465_0022571 3300041413 Bacteria 1978
560 Ga0439431_0014206 3300041997 Bacteria 1844
561 Ga0439441_017087 3300042001 Bacteria 1299
562 Ga0439462_0056101 3300042015 Bacteria 1063
563 Ga0450919_000090 3300042121 Bacteria 8867
564 Ga0450894_005548 3300042131 Bacteria 1632
565 Ga0450898_021514 3300042134 Bacteria 1137
566 Ga0451577_0019505 3300042876 Bacteria 6234
567 Ga0451577_0138750 3300042876 Bacteria 2184
568 Ga0466969_0000042 3300044656 Bacteria 69271
569 Ga0466972_0126098 3300044658 Bacteria 1206
570 Ga0466966_0060949 3300044684 Bacteria 2380
571 Ga0466961_0016008 3300044693 Bacteria 4814
572 Ga0453684_0126138 3300044712 Bacteria 3080
573 Ga0451576_0063338 3300045051 Bacteria 3854
574 Ga0451576_0317817 3300045051 Bacteria 1629
575 Ga0495629_0028744 3300046459 Bacteria 3947
576 Ga0495580_0422237 3300046472 Bacteria 897
577 Ga0495606_0001756 3300046507 Bacteria 27822
578 Ga0495628_0422893 3300046516 Bacteria 971
579 Ga0495586_0170313 3300046535 Bacteria 1230
580 Ga0495598_0039809 3300046537 Bacteria 1368
581 Ga0495598_0056259 3300046537 Bacteria 1200
582 Ga0495645_0013570 3300046543 Bacteria 5766
583 Ga0495645_0131443 3300046543 Bacteria 1753
584 Ga0495622_0000548 3300046557 Bacteria 22559
585 Ga0495647_0145359 3300046681 Bacteria 1013
586 Ga0495658_0014662 3300046683 Bacteria 4009
587 Ga0495658_0028575 3300046683 Bacteria 3012
588 Ga0495658_0106316 3300046683 Bacteria 1682
589 Ga0495658_0358347 3300046683 Bacteria 927
590 Ga0495613_0209940 3300046689 Bacteria 1370
591 Ga0495673_0000074 3300047469 Bacteria 210788
592 Ga0495681_0050673 3300047470 Bacteria 1956
593 Ga0495684_0011588 3300047471 Bacteria 6808
594 Ga0495684_0530748 3300047471 Bacteria 804
595 Ga0495615_0018856 3300048090 Bacteria 1525
596 Ga0496100_0056827 3300048903 Bacteria 2561
597 Ga0496100_0238573 3300048903 Bacteria 1341
598 Ga0496101_0009418 3300048904 Bacteria 6420
599 Ga0496102_0027006 3300048905 Bacteria 5126
600 Ga0496104_0170815 3300048907 Bacteria 2085
601 Ga0496105_0115513 3300048908 Bacteria 2214
602 Ga0496106_0005857 3300048909 Bacteria 9092
603 Ga0496107_0027177 3300048910 Bacteria 4063
604 Ga0496107_0690777 3300048910 Bacteria 751
605 Ga0496108_0021455 3300048911 Bacteria 5310
606 Ga0496108_0064837 3300048911 Bacteria 3078
607 Ga0496108_0221191 3300048911 Bacteria 1645
608 Ga0496108_0257570 3300048911 Bacteria 1518
609 Ga0496109_0029766 3300048912 Bacteria 4892
610 Ga0496109_0131042 3300048912 Bacteria 2340
611 Ga0496109_0170283 3300048912 Bacteria 2043
612 Ga0496110_0102205 3300048913 Bacteria 2570
613 Ga0496110_0303618 3300048913 Bacteria 1454
614 Ga0496112_0589124 3300048915 Bacteria 1044
615 Ga0496113_0065359 3300048916 Bacteria 2753
616 Ga0496113_0382817 3300048916 Bacteria 1129
617 Ga0496114_0006581 3300048917 Bacteria 9162
618 Ga0496114_0086137 3300048917 Bacteria 2662
619 Ga0496114_0091595 3300048917 Bacteria 2582
620 Ga0496114_0304126 3300048917 Bacteria 1408
621 Ga0496124_0192102 3300048927 Bacteria 1561
622 Ga0501305_052890 3300049161 Bacteria 685
623 Ga0501290_046462 3300049513 Bacteria 665
624 Ga0501292_020734 3300049515 Bacteria 1061
625 Ga0501033_0236757 3300049570 Bacteria 1295
626 Ga0501034_0372907 3300049571 Bacteria 1353
627 Ga0501036_0213592 3300049572 Bacteria 1621
628 Ga0501036_1256421 3300049572 Bacteria 603
629 Ga0501037_0187688 3300049573 Bacteria 1465
630 Ga0501039_0307911 3300049575 Bacteria 1245
631 Ga0501043_0000277 3300049579 Bacteria 46284
632 Ga0501046_0000345 3300049580 Bacteria 46730
633 Ga0501046_0252836 3300049580 Bacteria 1297
634 Ga0501047_0000395 3300049581 Bacteria 48969
635 Ga0501047_0006218 3300049581 Bacteria 11224
636 Ga0501048_0000111 3300049582 Bacteria 46009
637 Ga0501072_0467810 3300049588 Bacteria 998
638 Ga0501075_0022224 3300049591 Bacteria 4632
639 Ga0501198_000023 3300049649 Bacteria 69100
640 Ga0501207_014093 3300049654 Bacteria 1217
641 Ga0501253_013192 3300049683 Bacteria 1311
642 Ga0501257_016938 3300049686 Bacteria 1693
643 Ga0501262_013596 3300049759 Bacteria 1051
644 Ga0501035_0017204 3300049822 Bacteria 6664
645 Ga0501044_0030603 3300049823 Bacteria 5671
646 Ga0501045_0017605 3300049824 Bacteria 5074
647 Ga0501045_0763089 3300049824 Bacteria 713
648 nmdc:mga00v17_43511_c1 3300050491 Bacteria 2705
649 nmdc:mga0k408_146009_c1 3300050493 Bacteria 772
650 nmdc:mga0k408_249378_c1 3300050493 Bacteria 1060
651 nmdc:mga0k408_28834_c1 3300050493 Bacteria 3157
652 nmdc:mga0k408_9843_c1 3300050493 Bacteria 5161
653 nmdc:mga0n895_70256_c1 3300050512 Bacteria 3470
654 Ga0495601_0120834 3300053077 Bacteria 1701
655 Ga0495601_0430729 3300053077 Bacteria 854
656 Ga0495619_0025876 3300053085 Bacteria 3772
657 Ga0500627_0039830 3300053158 Bacteria 2014
658 Ga0500634_0084755 3300053161 Bacteria 1623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_1256421 Ga0501036_1256421_56_592 178
2 3300049824 Ga0501045_0017605 Ga0501045_0017605_4514_5056 180
3 3300042001 Ga0439441_017087 Ga0439441_017087_725_1270 181
4 3300025901 Ga0207688_10199000 Ga0207688_101990002 200
5 3300005456 Ga0070678_100090304 Ga0070678_1000903043 203
6 3300026121 Ga0207683_10055151 Ga0207683_100551513 203
7 iso_pu_bacteria 2643221644 2644247265 204
8 3300049654 Ga0501207_014093 Ga0501207_014093_571_1197 206
9 3300005354 Ga0070675_100190348 Ga0070675_1001903483 207
10 3300005459 Ga0068867_100236353 Ga0068867_1002363533 207
11 3300005844 Ga0068862_100491130 Ga0068862_1004911302 207
12 3300009147 Ga0114129_11688650 Ga0114129_116886501 207
13 3300009176 Ga0105242_10350864 Ga0105242_103508642 207
14 3300013308 Ga0157375_10966194 Ga0157375_109661942 207
15 3300025893 Ga0207682_10019663 Ga0207682_100196633 207
16 3300025926 Ga0207659_10183021 Ga0207659_101830213 207
17 3300028380 Ga0268265_10474119 Ga0268265_104741192 207
18 3300044656 Ga0466969_0000042 Ga0466969_0000042_57423_58046 207
19 3300044684 Ga0466966_0060949 Ga0466966_0060949_653_1276 207
20 3300044693 Ga0466961_0016008 Ga0466961_0016008_2810_3433 207
21 3300049824 Ga0501045_0763089 Ga0501045_0763089_70_693 207
22 3300003322 rootL2_10176069 rootL2_101760693 208
23 3300003775 Ga0055524_1000139 Ga0055524_100013966 208
24 3300003791 Ga0055530_10001259 Ga0055530_1000125910 208
25 3300003792 Ga0055540_1000090 Ga0055540_100009080 208
26 3300003792 Ga0055540_1000091 Ga0055540_100009178 208
27 3300003794 Ga0055531_10014159 Ga0055531_100141593 208
28 3300005327 Ga0070658_10006609 Ga0070658_100066093 208
29 3300005327 Ga0070658_10098024 Ga0070658_100980243 208
30 3300005328 Ga0070676_10007521 Ga0070676_100075214 208
31 3300005328 Ga0070676_10010297 Ga0070676_100102973 208
32 3300005328 Ga0070676_10259763 Ga0070676_102597632 208
33 3300005329 Ga0070683_100018476 Ga0070683_1000184763 208
34 3300005329 Ga0070683_100582306 Ga0070683_1005823062 208
35 3300005329 Ga0070683_100808641 Ga0070683_1008086412 208
36 3300005330 Ga0070690_100193669 Ga0070690_1001936692 208
37 3300005331 Ga0070670_100038384 Ga0070670_1000383844 208
38 3300005331 Ga0070670_100107954 Ga0070670_1001079543 208
39 3300005331 Ga0070670_100138295 Ga0070670_1001382952 208
40 3300005331 Ga0070670_100157782 Ga0070670_1001577822 208
41 3300005331 Ga0070670_100213390 Ga0070670_1002133903 208
42 3300005331 Ga0070670_100296994 Ga0070670_1002969943 208
43 3300005333 Ga0070677_10064905 Ga0070677_100649052 208
44 3300005334 Ga0068869_100004440 Ga0068869_1000044405 208
45 3300005334 Ga0068869_100012807 Ga0068869_1000128075 208
46 3300005334 Ga0068869_100020181 Ga0068869_1000201816 208
47 3300005335 Ga0070666_10002033 Ga0070666_100020336 208
48 3300005335 Ga0070666_10185178 Ga0070666_101851782 208
49 3300005338 Ga0068868_100001810 Ga0068868_1000018109 208
50 3300005338 Ga0068868_100007261 Ga0068868_1000072614 208
51 3300005338 Ga0068868_100072102 Ga0068868_1000721023 208
52 3300005338 Ga0068868_100126239 Ga0068868_1001262392 208
53 3300005338 Ga0068868_100161654 Ga0068868_1001616542 208
54 3300005338 Ga0068868_100183562 Ga0068868_1001835623 208
55 3300005338 Ga0068868_100955561 Ga0068868_1009555612 208
56 3300005339 Ga0070660_100022549 Ga0070660_1000225492 208
57 3300005340 Ga0070689_100093357 Ga0070689_1000933573 208
58 3300005343 Ga0070687_100007199 Ga0070687_1000071993 208
59 3300005344 Ga0070661_100005399 Ga0070661_1000053995 208
60 3300005344 Ga0070661_100055228 Ga0070661_1000552283 208
61 3300005344 Ga0070661_100093101 Ga0070661_1000931013 208
62 3300005344 Ga0070661_100659701 Ga0070661_1006597011 208
63 3300005345 Ga0070692_10139895 Ga0070692_101398951 208
64 3300005347 Ga0070668_100004185 Ga0070668_1000041855 208
65 3300005347 Ga0070668_100010936 Ga0070668_1000109363 208
66 3300005347 Ga0070668_100044298 Ga0070668_1000442983 208
67 3300005353 Ga0070669_100063158 Ga0070669_1000631582 208
68 3300005353 Ga0070669_100186002 Ga0070669_1001860022 208
69 3300005353 Ga0070669_100319221 Ga0070669_1003192212 208
70 3300005354 Ga0070675_100002331 Ga0070675_1000023316 208
71 3300005354 Ga0070675_100013401 Ga0070675_1000134016 208
72 3300005354 Ga0070675_100257834 Ga0070675_1002578342 208
73 3300005354 Ga0070675_100277368 Ga0070675_1002773682 208
74 3300005355 Ga0070671_100004867 Ga0070671_1000048675 208
75 3300005355 Ga0070671_100006569 Ga0070671_1000065695 208
76 3300005355 Ga0070671_100314287 Ga0070671_1003142872 208
77 3300005356 Ga0070674_100001965 Ga0070674_1000019656 208
78 3300005356 Ga0070674_100113475 Ga0070674_1001134753 208
79 3300005356 Ga0070674_100208739 Ga0070674_1002087392 208
80 3300005364 Ga0070673_100009152 Ga0070673_1000091526 208
81 3300005364 Ga0070673_100109832 Ga0070673_1001098323 208
82 3300005364 Ga0070673_100212439 Ga0070673_1002124393 208
83 3300005364 Ga0070673_100886691 Ga0070673_1008866911 208
84 3300005365 Ga0070688_100038594 Ga0070688_1000385943 208
85 3300005365 Ga0070688_100477381 Ga0070688_1004773812 208
86 3300005366 Ga0070659_100021242 Ga0070659_1000212422 208
87 3300005366 Ga0070659_100022737 Ga0070659_1000227375 208
88 3300005366 Ga0070659_100185871 Ga0070659_1001858712 208
89 3300005367 Ga0070667_100007789 Ga0070667_1000077892 208
90 3300005367 Ga0070667_100009094 Ga0070667_1000090945 208
91 3300005367 Ga0070667_100016258 Ga0070667_1000162584 208
92 3300005441 Ga0070700_100039713 Ga0070700_1000397133 208
93 3300005441 Ga0070700_100120998 Ga0070700_1001209982 208
94 3300005455 Ga0070663_100002951 Ga0070663_1000029518 208
95 3300005455 Ga0070663_100059788 Ga0070663_1000597883 208
96 3300005455 Ga0070663_100079636 Ga0070663_1000796362 208
97 3300005456 Ga0070678_100097700 Ga0070678_1000977003 208
98 3300005456 Ga0070678_100359330 Ga0070678_1003593303 208
99 3300005456 Ga0070678_100497193 Ga0070678_1004971931 208
100 3300005456 Ga0070678_100958460 Ga0070678_1009584601 208
101 3300005457 Ga0070662_100004754 Ga0070662_1000047547 208
102 3300005457 Ga0070662_100021079 Ga0070662_1000210795 208
103 3300005457 Ga0070662_100069085 Ga0070662_1000690852 208
104 3300005457 Ga0070662_100374633 Ga0070662_1003746332 208
105 3300005459 Ga0068867_100004555 Ga0068867_1000045555 208
106 3300005459 Ga0068867_100111341 Ga0068867_1001113412 208
107 3300005535 Ga0070684_100275307 Ga0070684_1002753072 208
108 3300005535 Ga0070684_100727427 Ga0070684_1007274272 208
109 3300005539 Ga0068853_100038341 Ga0068853_1000383415 208
110 3300005539 Ga0068853_100078421 Ga0068853_1000784213 208
111 3300005539 Ga0068853_100224810 Ga0068853_1002248102 208
112 3300005539 Ga0068853_100377449 Ga0068853_1003774492 208
113 3300005543 Ga0070672_100004824 Ga0070672_1000048243 208
114 3300005543 Ga0070672_100008163 Ga0070672_1000081633 208
115 3300005543 Ga0070672_100073815 Ga0070672_1000738153 208
116 3300005543 Ga0070672_100084070 Ga0070672_1000840702 208
117 3300005543 Ga0070672_100105115 Ga0070672_1001051153 208
118 3300005543 Ga0070672_100137927 Ga0070672_1001379272 208
119 3300005543 Ga0070672_100275152 Ga0070672_1002751522 208
120 3300005543 Ga0070672_100367085 Ga0070672_1003670852 208
121 3300005547 Ga0070693_100005436 Ga0070693_1000054364 208
122 3300005547 Ga0070693_100006153 Ga0070693_1000061532 208
123 3300005563 Ga0068855_100018722 Ga0068855_1000187228 208
124 3300005563 Ga0068855_100410942 Ga0068855_1004109422 208
125 3300005564 Ga0070664_100008904 Ga0070664_1000089048 208
126 3300005564 Ga0070664_100228096 Ga0070664_1002280963 208
127 3300005564 Ga0070664_100296020 Ga0070664_1002960202 208
128 3300005577 Ga0068857_100013495 Ga0068857_1000134957 208
129 3300005578 Ga0068854_100058976 Ga0068854_1000589762 208
130 3300005578 Ga0068854_100067551 Ga0068854_1000675513 208
131 3300005614 Ga0068856_100021431 Ga0068856_1000214314 208
132 3300005614 Ga0068856_100617867 Ga0068856_1006178672 208
133 3300005615 Ga0070702_100028970 Ga0070702_1000289703 208
134 3300005615 Ga0070702_100084844 Ga0070702_1000848442 208
135 3300005615 Ga0070702_100235883 Ga0070702_1002358833 208
136 3300005615 Ga0070702_100763831 Ga0070702_1007638311 208
137 3300005616 Ga0068852_100003024 Ga0068852_1000030248 208
138 3300005616 Ga0068852_100006821 Ga0068852_1000068213 208
139 3300005616 Ga0068852_100028674 Ga0068852_1000286741 208
140 3300005616 Ga0068852_100030751 Ga0068852_1000307515 208
141 3300005617 Ga0068859_100029554 Ga0068859_1000295545 208
142 3300005617 Ga0068859_100175376 Ga0068859_1001753762 208
143 3300005618 Ga0068864_100001527 Ga0068864_1000015275 208
144 3300005618 Ga0068864_100018338 Ga0068864_1000183385 208
145 3300005618 Ga0068864_100029588 Ga0068864_1000295885 208
146 3300005618 Ga0068864_100051719 Ga0068864_1000517192 208
147 3300005618 Ga0068864_100084251 Ga0068864_1000842513 208
148 3300005718 Ga0068866_10181765 Ga0068866_101817653 208
149 3300005719 Ga0068861_100001789 Ga0068861_1000017896 208
150 3300005719 Ga0068861_100046617 Ga0068861_1000466174 208
151 3300005834 Ga0068851_10008824 Ga0068851_100088245 208
152 3300005834 Ga0068851_10008978 Ga0068851_100089783 208
153 3300005834 Ga0068851_10025597 Ga0068851_100255974 208
154 3300005834 Ga0068851_10063620 Ga0068851_100636203 208
155 3300005840 Ga0068870_10092273 Ga0068870_100922733 208
156 3300005841 Ga0068863_100007547 Ga0068863_1000075474 208
157 3300005841 Ga0068863_100016334 Ga0068863_1000163343 208
158 3300005841 Ga0068863_100389591 Ga0068863_1003895912 208
159 3300005841 Ga0068863_100390450 Ga0068863_1003904502 208
160 3300005842 Ga0068858_100002470 Ga0068858_10000247012 208
161 3300005842 Ga0068858_100008215 Ga0068858_10000821510 208
162 3300005842 Ga0068858_100018020 Ga0068858_1000180206 208
163 3300005842 Ga0068858_100019820 Ga0068858_1000198206 208
164 3300005842 Ga0068858_100387342 Ga0068858_1003873423 208
165 3300005843 Ga0068860_100001365 Ga0068860_10000136510 208
166 3300005843 Ga0068860_100011663 Ga0068860_1000116639 208
167 3300005843 Ga0068860_100198116 Ga0068860_1001981163 208
168 3300005844 Ga0068862_100025242 Ga0068862_1000252423 208
169 3300005844 Ga0068862_100116699 Ga0068862_1001166993 208
170 3300005844 Ga0068862_100166779 Ga0068862_1001667793 208
171 3300006237 Ga0097621_100015141 Ga0097621_1000151414 208
172 3300006237 Ga0097621_100085384 Ga0097621_1000853844 208
173 3300006237 Ga0097621_100114484 Ga0097621_1001144842 208
174 3300006237 Ga0097621_100338545 Ga0097621_1003385452 208
175 3300006237 Ga0097621_100919178 Ga0097621_1009191781 208
176 3300006358 Ga0068871_100003520 Ga0068871_1000035208 208
177 3300006358 Ga0068871_100048486 Ga0068871_1000484862 208
178 3300006358 Ga0068871_100279766 Ga0068871_1002797662 208
179 3300006871 Ga0075434_100042080 Ga0075434_1000420803 208
180 3300006881 Ga0068865_100006734 Ga0068865_1000067343 208
181 3300006881 Ga0068865_100089552 Ga0068865_1000895522 208
182 3300006881 Ga0068865_100257112 Ga0068865_1002571122 208
183 3300006881 Ga0068865_100270221 Ga0068865_1002702211 208
184 3300006931 Ga0097620_100029554 Ga0097620_1000295543 208
185 3300006931 Ga0097620_100175378 Ga0097620_1001753782 208
186 3300006946 Ga0079104_1000916 Ga0079104_10009167 208
187 3300009093 Ga0105240_10328268 Ga0105240_103282683 208
188 3300009093 Ga0105240_10908394 Ga0105240_109083941 208
189 3300009098 Ga0105245_10016431 Ga0105245_100164316 208
190 3300009098 Ga0105245_10255931 Ga0105245_102559312 208
191 3300009098 Ga0105245_10746472 Ga0105245_107464722 208
192 3300009148 Ga0105243_10040884 Ga0105243_100408843 208
193 3300009148 Ga0105243_10648309 Ga0105243_106483092 208
194 3300009176 Ga0105242_10058845 Ga0105242_100588454 208
195 3300009177 Ga0105248_10011287 Ga0105248_100112878 208
196 3300009177 Ga0105248_10039414 Ga0105248_100394144 208
197 3300009177 Ga0105248_10047396 Ga0105248_100473965 208
198 3300009177 Ga0105248_10083807 Ga0105248_100838073 208
199 3300009177 Ga0105248_10186381 Ga0105248_101863813 208
200 3300009177 Ga0105248_10473151 Ga0105248_104731511 208
201 3300009177 Ga0105248_10522602 Ga0105248_105226023 208
202 3300009545 Ga0105237_10031046 Ga0105237_100310465 208
203 3300009551 Ga0105238_10093334 Ga0105238_100933343 208
204 3300009553 Ga0105249_10010587 Ga0105249_100105879 208
205 3300009553 Ga0105249_10015417 Ga0105249_100154172 208
206 3300010375 Ga0105239_10196056 Ga0105239_101960563 208
207 3300012512 Ga0157327_1003471 Ga0157327_10034712 208
208 3300013100 Ga0157373_10007411 Ga0157373_100074112 208
209 3300013102 Ga0157371_10130018 Ga0157371_101300183 208
210 3300013104 Ga0157370_10439805 Ga0157370_104398052 208
211 3300013105 Ga0157369_10049712 Ga0157369_100497122 208
212 3300013105 Ga0157369_10213729 Ga0157369_102137293 208
213 3300013296 Ga0157374_10006173 Ga0157374_100061739 208
214 3300013296 Ga0157374_10389084 Ga0157374_103890842 208
215 3300013296 Ga0157374_10709016 Ga0157374_107090162 208
216 3300013297 Ga0157378_10748716 Ga0157378_107487162 208
217 3300013306 Ga0163162_10006647 Ga0163162_100066478 208
218 3300013306 Ga0163162_10012295 Ga0163162_100122951 208
219 3300013306 Ga0163162_10019368 Ga0163162_100193687 208
220 3300013306 Ga0163162_10098355 Ga0163162_100983553 208
221 3300013306 Ga0163162_10193774 Ga0163162_101937743 208
222 3300013306 Ga0163162_10232968 Ga0163162_102329683 208
223 3300013307 Ga0157372_10008138 Ga0157372_100081389 208
224 3300013307 Ga0157372_10024157 Ga0157372_100241576 208
225 3300013308 Ga0157375_10011278 Ga0157375_100112787 208
226 3300013308 Ga0157375_10024455 Ga0157375_100244554 208
227 3300013308 Ga0157375_10040792 Ga0157375_100407925 208
228 3300013308 Ga0157375_10522370 Ga0157375_105223702 208
229 3300014325 Ga0163163_10001523 Ga0163163_1000152311 208
230 3300014325 Ga0163163_10077224 Ga0163163_100772243 208
231 3300014326 Ga0157380_10011942 Ga0157380_100119428 208
232 3300014326 Ga0157380_10036620 Ga0157380_100366204 208
233 3300014326 Ga0157380_10328842 Ga0157380_103288421 208
234 3300014326 Ga0157380_10487300 Ga0157380_104873002 208
235 3300014745 Ga0157377_10002400 Ga0157377_100024004 208
236 3300014968 Ga0157379_10002555 Ga0157379_100025559 208
237 3300014968 Ga0157379_10003481 Ga0157379_100034818 208
238 3300014968 Ga0157379_10007487 Ga0157379_100074875 208
239 3300014968 Ga0157379_10014842 Ga0157379_100148425 208
240 3300014968 Ga0157379_10141241 Ga0157379_101412412 208
241 3300014968 Ga0157379_10372931 Ga0157379_103729312 208
242 3300014969 Ga0157376_10005881 Ga0157376_100058816 208
243 3300014969 Ga0157376_10068596 Ga0157376_100685962 208
244 3300014969 Ga0157376_10171775 Ga0157376_101717753 208
245 3300014969 Ga0157376_10261357 Ga0157376_102613572 208
246 3300014969 Ga0157376_10385587 Ga0157376_103855871 208
247 3300017792 Ga0163161_10020312 Ga0163161_100203123 208
248 3300017792 Ga0163161_10042513 Ga0163161_100425132 208
249 3300017792 Ga0163161_10044600 Ga0163161_100446003 208
250 3300017792 Ga0163161_10712424 Ga0163161_107124242 208
251 3300025271 Ga0207666_1002213 Ga0207666_10022131 208
252 3300025298 Ga0209050_1000326 Ga0209050_100032610 208
253 3300025298 Ga0209050_1000967 Ga0209050_100096721 208
254 3300025298 Ga0209050_1036330 Ga0209050_10363303 208
255 3300025299 Ga0209256_1000019 Ga0209256_1000019456 208
256 3300025303 Ga0209051_1000133 Ga0209051_100013381 208
257 3300025304 Ga0209257_1000038 Ga0209257_100003881 208
258 3300025315 Ga0207697_10013496 Ga0207697_100134963 208
259 3300025315 Ga0207697_10145965 Ga0207697_101459652 208
260 3300025321 Ga0207656_10008357 Ga0207656_100083572 208
261 3300025321 Ga0207656_10009070 Ga0207656_100090704 208
262 3300025893 Ga0207682_10005021 Ga0207682_100050213 208
263 3300025893 Ga0207682_10036448 Ga0207682_100364483 208
264 3300025899 Ga0207642_10002738 Ga0207642_100027383 208
265 3300025901 Ga0207688_10007645 Ga0207688_100076456 208
266 3300025901 Ga0207688_10018395 Ga0207688_100183953 208
267 3300025903 Ga0207680_10003179 Ga0207680_100031793 208
268 3300025903 Ga0207680_10169734 Ga0207680_101697343 208
269 3300025907 Ga0207645_10007079 Ga0207645_100070798 208
270 3300025907 Ga0207645_10017927 Ga0207645_100179272 208
271 3300025907 Ga0207645_10184291 Ga0207645_101842912 208
272 3300025909 Ga0207705_10132723 Ga0207705_101327233 208
273 3300025911 Ga0207654_10037247 Ga0207654_100372473 208
274 3300025913 Ga0207695_10184325 Ga0207695_101843253 208
275 3300025914 Ga0207671_10080690 Ga0207671_100806903 208
276 3300025919 Ga0207657_10061349 Ga0207657_100613491 208
277 3300025919 Ga0207657_10112825 Ga0207657_101128253 208
278 3300025920 Ga0207649_10023850 Ga0207649_100238503 208
279 3300025920 Ga0207649_10038984 Ga0207649_100389843 208
280 3300025920 Ga0207649_10172645 Ga0207649_101726452 208
281 3300025923 Ga0207681_10003817 Ga0207681_100038175 208
282 3300025923 Ga0207681_10364662 Ga0207681_103646622 208
283 3300025924 Ga0207694_10015426 Ga0207694_100154265 208
284 3300025924 Ga0207694_10019601 Ga0207694_100196013 208
285 3300025925 Ga0207650_10000382 Ga0207650_100003828 208
286 3300025925 Ga0207650_10055425 Ga0207650_100554252 208
287 3300025925 Ga0207650_10072514 Ga0207650_100725143 208
288 3300025925 Ga0207650_10286547 Ga0207650_102865473 208
289 3300025925 Ga0207650_10379448 Ga0207650_103794482 208
290 3300025925 Ga0207650_10522543 Ga0207650_105225432 208
291 3300025926 Ga0207659_10002417 Ga0207659_100024174 208
292 3300025926 Ga0207659_10006243 Ga0207659_100062436 208
293 3300025926 Ga0207659_10007553 Ga0207659_100075533 208
294 3300025926 Ga0207659_10017327 Ga0207659_100173275 208
295 3300025926 Ga0207659_10027687 Ga0207659_100276875 208
296 3300025927 Ga0207687_10017347 Ga0207687_100173473 208
297 3300025927 Ga0207687_10032593 Ga0207687_100325933 208
298 3300025927 Ga0207687_10210725 Ga0207687_102107252 208
299 3300025931 Ga0207644_10009179 Ga0207644_100091793 208
300 3300025931 Ga0207644_10010498 Ga0207644_100104983 208
301 3300025931 Ga0207644_10367443 Ga0207644_103674432 208
302 3300025931 Ga0207644_10403898 Ga0207644_104038981 208
303 3300025932 Ga0207690_10005702 Ga0207690_100057022 208
304 3300025932 Ga0207690_10178692 Ga0207690_101786922 208
305 3300025933 Ga0207706_10001995 Ga0207706_1000199516 208
306 3300025933 Ga0207706_10009005 Ga0207706_100090056 208
307 3300025933 Ga0207706_10245012 Ga0207706_102450123 208
308 3300025933 Ga0207706_10340536 Ga0207706_103405363 208
309 3300025933 Ga0207706_10544722 Ga0207706_105447222 208
310 3300025934 Ga0207686_10024985 Ga0207686_100249853 208
311 3300025934 Ga0207686_11031600 Ga0207686_110316001 208
312 3300025935 Ga0207709_10010409 Ga0207709_100104094 208
313 3300025937 Ga0207669_10011790 Ga0207669_100117904 208
314 3300025937 Ga0207669_10090965 Ga0207669_100909653 208
315 3300025937 Ga0207669_10217933 Ga0207669_102179332 208
316 3300025938 Ga0207704_10002822 Ga0207704_100028225 208
317 3300025938 Ga0207704_10061980 Ga0207704_100619803 208
318 3300025938 Ga0207704_10111635 Ga0207704_101116353 208
319 3300025940 Ga0207691_10004985 Ga0207691_1000498511 208
320 3300025940 Ga0207691_10035897 Ga0207691_100358975 208
321 3300025940 Ga0207691_10098585 Ga0207691_100985853 208
322 3300025940 Ga0207691_10134093 Ga0207691_101340932 208
323 3300025940 Ga0207691_10138439 Ga0207691_101384393 208
324 3300025940 Ga0207691_10273601 Ga0207691_102736013 208
325 3300025940 Ga0207691_10295161 Ga0207691_102951612 208
326 3300025941 Ga0207711_10015498 Ga0207711_100154986 208
327 3300025941 Ga0207711_10043131 Ga0207711_100431315 208
328 3300025941 Ga0207711_10058166 Ga0207711_100581663 208
329 3300025941 Ga0207711_10084520 Ga0207711_100845203 208
330 3300025941 Ga0207711_10106031 Ga0207711_101060313 208
331 3300025941 Ga0207711_10127103 Ga0207711_101271032 208
332 3300025941 Ga0207711_10536062 Ga0207711_105360621 208
333 3300025942 Ga0207689_10000996 Ga0207689_1000099616 208
334 3300025942 Ga0207689_10005866 Ga0207689_100058665 208
335 3300025942 Ga0207689_10019786 Ga0207689_100197863 208
336 3300025944 Ga0207661_10119681 Ga0207661_101196812 208
337 3300025944 Ga0207661_10617496 Ga0207661_106174962 208
338 3300025945 Ga0207679_10023086 Ga0207679_100230864 208
339 3300025945 Ga0207679_10281902 Ga0207679_102819023 208
340 3300025945 Ga0207679_10352500 Ga0207679_103525002 208
341 3300025945 Ga0207679_10366783 Ga0207679_103667832 208
342 3300025945 Ga0207679_10571510 Ga0207679_105715102 208
343 3300025960 Ga0207651_10005465 Ga0207651_100054652 208
344 3300025960 Ga0207651_10033408 Ga0207651_100334085 208
345 3300025960 Ga0207651_10122313 Ga0207651_101223132 208
346 3300025961 Ga0207712_10002952 Ga0207712_100029523 208
347 3300025961 Ga0207712_10087613 Ga0207712_100876132 208
348 3300025972 Ga0207668_10018678 Ga0207668_100186785 208
349 3300025972 Ga0207668_10028532 Ga0207668_100285324 208
350 3300025972 Ga0207668_10172783 Ga0207668_101727832 208
351 3300025972 Ga0207668_10390918 Ga0207668_103909182 208
352 3300025981 Ga0207640_10005754 Ga0207640_100057546 208
353 3300025981 Ga0207640_10057330 Ga0207640_100573303 208
354 3300025986 Ga0207658_10000181 Ga0207658_1000018158 208
355 3300025986 Ga0207658_10007082 Ga0207658_1000708210 208
356 3300025986 Ga0207658_10030504 Ga0207658_100305043 208
357 3300026023 Ga0207677_10000853 Ga0207677_1000085318 208
358 3300026023 Ga0207677_10016079 Ga0207677_100160795 208
359 3300026023 Ga0207677_10035612 Ga0207677_100356123 208
360 3300026023 Ga0207677_10057068 Ga0207677_100570683 208
361 3300026023 Ga0207677_10591141 Ga0207677_105911412 208
362 3300026035 Ga0207703_10000907 Ga0207703_1000090722 208
363 3300026035 Ga0207703_10002895 Ga0207703_100028959 208
364 3300026035 Ga0207703_10003620 Ga0207703_1000362010 208
365 3300026035 Ga0207703_10026824 Ga0207703_100268244 208
366 3300026041 Ga0207639_10051155 Ga0207639_100511553 208
367 3300026041 Ga0207639_10553653 Ga0207639_105536532 208
368 3300026041 Ga0207639_10825815 Ga0207639_108258152 208
369 3300026067 Ga0207678_10003624 Ga0207678_100036249 208
370 3300026067 Ga0207678_10072781 Ga0207678_100727813 208
371 3300026067 Ga0207678_10126976 Ga0207678_101269763 208
372 3300026067 Ga0207678_10150777 Ga0207678_101507773 208
373 3300026075 Ga0207708_10030177 Ga0207708_100301773 208
374 3300026075 Ga0207708_10096148 Ga0207708_100961483 208
375 3300026078 Ga0207702_10011735 Ga0207702_100117353 208
376 3300026078 Ga0207702_10268091 Ga0207702_102680912 208
377 3300026078 Ga0207702_10551717 Ga0207702_105517172 208
378 3300026088 Ga0207641_10005494 Ga0207641_100054949 208
379 3300026088 Ga0207641_10006799 Ga0207641_100067995 208
380 3300026088 Ga0207641_10076167 Ga0207641_100761674 208
381 3300026088 Ga0207641_10563026 Ga0207641_105630262 208
382 3300026088 Ga0207641_10777422 Ga0207641_107774222 208
383 3300026089 Ga0207648_10018549 Ga0207648_100185494 208
384 3300026089 Ga0207648_10051037 Ga0207648_100510375 208
385 3300026089 Ga0207648_10306586 Ga0207648_103065862 208
386 3300026095 Ga0207676_10002438 Ga0207676_100024385 208
387 3300026095 Ga0207676_10012441 Ga0207676_100124414 208
388 3300026095 Ga0207676_10016864 Ga0207676_100168643 208
389 3300026095 Ga0207676_10064169 Ga0207676_100641692 208
390 3300026095 Ga0207676_10081670 Ga0207676_100816703 208
391 3300026095 Ga0207676_10294065 Ga0207676_102940653 208
392 3300026116 Ga0207674_10066252 Ga0207674_100662523 208
393 3300026118 Ga0207675_100002360 Ga0207675_10000236011 208
394 3300026118 Ga0207675_100002486 Ga0207675_1000024869 208
395 3300026118 Ga0207675_100358152 Ga0207675_1003581522 208
396 3300026121 Ga0207683_10002157 Ga0207683_1000215716 208
397 3300026121 Ga0207683_10084574 Ga0207683_100845744 208
398 3300026121 Ga0207683_10093009 Ga0207683_100930093 208
399 3300026121 Ga0207683_10196292 Ga0207683_101962923 208
400 3300026121 Ga0207683_10200619 Ga0207683_102006192 208
401 3300026121 Ga0207683_10440416 Ga0207683_104404161 208
402 3300026142 Ga0207698_10007978 Ga0207698_100079787 208
403 3300026142 Ga0207698_10104525 Ga0207698_101045252 208
404 3300026142 Ga0207698_10180043 Ga0207698_101800433 208
405 3300026142 Ga0207698_10291483 Ga0207698_102914832 208
406 3300026142 Ga0207698_10535431 Ga0207698_105354312 208
407 3300027111 Ga0209281_1000935 Ga0209281_100093519 208
408 3300027876 Ga0209974_10002440 Ga0209974_100024405 208
409 3300028380 Ga0268265_10012152 Ga0268265_100121523 208
410 3300028380 Ga0268265_10058457 Ga0268265_100584571 208
411 3300028381 Ga0268264_10001738 Ga0268264_1000173816 208
412 3300028381 Ga0268264_10007941 Ga0268264_100079416 208
413 3300028381 Ga0268264_10134746 Ga0268264_101347463 208
414 3300028381 Ga0268264_10291303 Ga0268264_102913033 208
415 3300031548 Ga0307408_100075271 Ga0307408_1000752712 208
416 3300031901 Ga0307406_10019969 Ga0307406_100199693 208
417 3300031911 Ga0307412_10026713 Ga0307412_100267134 208
418 3300031995 Ga0307409_100003223 Ga0307409_1000032231 208
419 3300032002 Ga0307416_100001157 Ga0307416_1000011576 208
420 3300032005 Ga0307411_10022265 Ga0307411_100222655 208
421 3300032126 Ga0307415_100135773 Ga0307415_1001357732 208
422 3300032126 Ga0307415_100323282 Ga0307415_1003232822 208
423 3300034817 Ga0373948_0019368 Ga0373948_0019368_278_916 208
424 3300034957 Ga0373938_0004404 Ga0373938_0004404_1003_1641 208
425 3300035092 Ga0373952_0062208 Ga0373952_0062208_128_766 208
426 3300035111 Ga0373923_0108112 Ga0373923_0108112_390_1028 208
427 3300035116 Ga0373945_0026236 Ga0373945_0026236_1257_1895 208
428 3300035121 Ga0373960_0023822 Ga0373960_0023822_490_1128 208
429 3300035170 Ga0373943_0033638 Ga0373943_0033638_931_1569 208
430 3300035691 Ga0373931_0018622 Ga0373931_0018622_1209_1847 208
431 3300035695 Ga0373927_0183986 Ga0373927_0183986_191_829 208
432 3300035725 Ga0373947_0063240 Ga0373947_0063240_1090_1728 208
433 3300036401 Ga0373937_0778759 Ga0373937_0778759_201_839 208
434 3300039437 Ga0436365_1317424 Ga0436365_1317424_213_851 208
435 3300039450 Ga0436363_0116538 Ga0436363_0116538_102_740 208
436 3300042121 Ga0450919_000090 Ga0450919_000090_3959_4585 208
437 3300042876 Ga0451577_0019505 Ga0451577_0019505_4831_5457 208
438 3300042876 Ga0451577_0138750 Ga0451577_0138750_1329_1955 208
439 3300044712 Ga0453684_0126138 Ga0453684_0126138_522_1148 208
440 3300045051 Ga0451576_0063338 Ga0451576_0063338_374_1012 208
441 3300045051 Ga0451576_0317817 Ga0451576_0317817_269_907 208
442 3300046472 Ga0495580_0422237 Ga0495580_0422237_143_781 208
443 3300046516 Ga0495628_0422893 Ga0495628_0422893_122_760 208
444 3300046537 Ga0495598_0039809 Ga0495598_0039809_62_700 208
445 3300046537 Ga0495598_0056259 Ga0495598_0056259_403_1041 208
446 3300046543 Ga0495645_0131443 Ga0495645_0131443_468_1106 208
447 3300046683 Ga0495658_0028575 Ga0495658_0028575_1234_1872 208
448 3300046683 Ga0495658_0106316 Ga0495658_0106316_389_1027 208
449 3300046689 Ga0495613_0209940 Ga0495613_0209940_19_657 208
450 3300047470 Ga0495681_0050673 Ga0495681_0050673_142_780 208
451 3300047471 Ga0495684_0011588 Ga0495684_0011588_990_1628 208
452 3300048090 Ga0495615_0018856 Ga0495615_0018856_126_764 208
453 3300048903 Ga0496100_0056827 Ga0496100_0056827_1550_2188 208
454 3300048903 Ga0496100_0238573 Ga0496100_0238573_566_1204 208
455 3300048904 Ga0496101_0009418 Ga0496101_0009418_3655_4293 208
456 3300048905 Ga0496102_0027006 Ga0496102_0027006_804_1430 208
457 3300048907 Ga0496104_0170815 Ga0496104_0170815_985_1623 208
458 3300048908 Ga0496105_0115513 Ga0496105_0115513_1219_1857 208
459 3300048909 Ga0496106_0005857 Ga0496106_0005857_7565_8203 208
460 3300048910 Ga0496107_0027177 Ga0496107_0027177_2098_2736 208
461 3300048910 Ga0496107_0690777 Ga0496107_0690777_65_703 208
462 3300048911 Ga0496108_0021455 Ga0496108_0021455_2032_2670 208
463 3300048911 Ga0496108_0064837 Ga0496108_0064837_2019_2657 208
464 3300048911 Ga0496108_0221191 Ga0496108_0221191_459_1142 208
465 3300048912 Ga0496109_0029766 Ga0496109_0029766_2986_3624 208
466 3300048912 Ga0496109_0170283 Ga0496109_0170283_662_1300 208
467 3300048913 Ga0496110_0102205 Ga0496110_0102205_437_1075 208
468 3300048915 Ga0496112_0589124 Ga0496112_0589124_362_1000 208
469 3300048916 Ga0496113_0065359 Ga0496113_0065359_45_683 208
470 3300048916 Ga0496113_0382817 Ga0496113_0382817_327_965 208
471 3300048917 Ga0496114_0006581 Ga0496114_0006581_1378_2004 208
472 3300048917 Ga0496114_0086137 Ga0496114_0086137_896_1534 208
473 3300048917 Ga0496114_0091595 Ga0496114_0091595_391_1029 208
474 3300048917 Ga0496114_0304126 Ga0496114_0304126_78_716 208
475 3300049575 Ga0501039_0307911 Ga0501039_0307911_127_768 208
476 3300049580 Ga0501046_0252836 Ga0501046_0252836_377_1018 208
477 3300049588 Ga0501072_0467810 Ga0501072_0467810_28_654 208
478 3300049591 Ga0501075_0022224 Ga0501075_0022224_2164_2790 208
479 3300050512 nmdc:mga0n895_70256_c1 nmdc:mga0n895_70256_c1_1654_2292 208
480 3300053077 Ga0495601_0120834 Ga0495601_0120834_929_1567 208
481 3300053085 Ga0495619_0025876 Ga0495619_0025876_2575_3213 208
482 3300053158 Ga0500627_0039830 Ga0500627_0039830_242_868 208
483 3300005334 Ga0068869_100375644 Ga0068869_1003756442 209
484 3300005336 Ga0070680_100006667 Ga0070680_1000066678 209
485 3300005530 Ga0070679_100017999 Ga0070679_1000179997 209
486 3300005547 Ga0070693_100070902 Ga0070693_1000709021 209
487 3300005563 Ga0068855_100851532 Ga0068855_1008515322 209
488 3300005564 Ga0070664_100282262 Ga0070664_1002822622 209
489 3300005842 Ga0068858_100005840 Ga0068858_10000584014 209
490 3300005843 Ga0068860_101230384 Ga0068860_1012303842 209
491 3300006195 Ga0075366_10010694 Ga0075366_100106945 209
492 3300006237 Ga0097621_101015610 Ga0097621_1010156101 209
493 3300009101 Ga0105247_10130196 Ga0105247_101301962 209
494 3300009147 Ga0114129_10084121 Ga0114129_100841213 209
495 3300009177 Ga0105248_10339087 Ga0105248_103390872 209
496 3300014326 Ga0157380_10063579 Ga0157380_100635793 209
497 3300014968 Ga0157379_10004289 Ga0157379_1000428914 209
498 3300025912 Ga0207707_10069401 Ga0207707_100694014 209
499 3300025917 Ga0207660_10013406 Ga0207660_100134066 209
500 3300025918 Ga0207662_10802386 Ga0207662_108023861 209
501 3300025921 Ga0207652_10030599 Ga0207652_100305993 209
502 3300025941 Ga0207711_10261101 Ga0207711_102611013 209
503 3300025986 Ga0207658_10137721 Ga0207658_101377212 209
504 3300031251 Ga0265327_10164121 Ga0265327_101641211 209
505 3300031548 Ga0307408_100353273 Ga0307408_1003532732 209
506 3300031852 Ga0307410_10204103 Ga0307410_102041032 209
507 3300031901 Ga0307406_10178724 Ga0307406_101787242 209
508 3300032002 Ga0307416_100090220 Ga0307416_1000902203 209
509 3300032005 Ga0307411_10212681 Ga0307411_102126812 209
510 3300035114 Ga0373939_0074949 Ga0373939_0074949_398_1027 209
511 3300037471 Ga0395905_0083762 Ga0395905_0083762_2119_2748 209
512 3300041413 Ga0439465_0022571 Ga0439465_0022571_216_845 209
513 3300044658 Ga0466972_0126098 Ga0466972_0126098_378_1007 209
514 3300049161 Ga0501305_052890 Ga0501305_052890_37_666 209
515 3300049513 Ga0501290_046462 Ga0501290_046462_22_651 209
516 3300049515 Ga0501292_020734 Ga0501292_020734_158_787 209
517 3300049649 Ga0501198_000023 Ga0501198_000023_42167_42811 209
518 3300049683 Ga0501253_013192 Ga0501253_013192_183_812 209
519 3300049686 Ga0501257_016938 Ga0501257_016938_570_1199 209
520 3300049759 Ga0501262_013596 Ga0501262_013596_26_655 209
521 3300050493 nmdc:mga0k408_9843_c1 nmdc:mga0k408_9843_c1_555_1184 209
522 3300005328 Ga0070676_10257501 Ga0070676_102575013 210
523 3300005331 Ga0070670_100000527 Ga0070670_1000005277 210
524 3300005333 Ga0070677_10039324 Ga0070677_100393243 210
525 3300005333 Ga0070677_10048834 Ga0070677_100488342 210
526 3300005334 Ga0068869_100217947 Ga0068869_1002179472 210
527 3300005338 Ga0068868_100129245 Ga0068868_1001292453 210
528 3300005354 Ga0070675_100011552 Ga0070675_1000115525 210
529 3300005355 Ga0070671_100038919 Ga0070671_1000389195 210
530 3300005355 Ga0070671_100176529 Ga0070671_1001765292 210
531 3300005364 Ga0070673_100225610 Ga0070673_1002256102 210
532 3300005441 Ga0070700_100014555 Ga0070700_1000145553 210
533 3300005456 Ga0070678_100007587 Ga0070678_1000075876 210
534 3300005456 Ga0070678_100102186 Ga0070678_1001021863 210
535 3300005456 Ga0070678_100139566 Ga0070678_1001395662 210
536 3300005457 Ga0070662_100048266 Ga0070662_1000482663 210
537 3300005459 Ga0068867_100020712 Ga0068867_1000207121 210
538 3300005543 Ga0070672_100001982 Ga0070672_10000198212 210
539 3300005543 Ga0070672_100028822 Ga0070672_1000288222 210
540 3300005543 Ga0070672_100688434 Ga0070672_1006884342 210
541 3300005616 Ga0068852_100129301 Ga0068852_1001293013 210
542 3300005616 Ga0068852_100423490 Ga0068852_1004234902 210
543 3300005617 Ga0068859_100042793 Ga0068859_1000427932 210
544 3300005617 Ga0068859_100115004 Ga0068859_1001150041 210
545 3300005618 Ga0068864_100018933 Ga0068864_1000189336 210
546 3300005718 Ga0068866_10002740 Ga0068866_100027408 210
547 3300005719 Ga0068861_100005508 Ga0068861_1000055086 210
548 3300005834 Ga0068851_10037992 Ga0068851_100379922 210
549 3300005834 Ga0068851_10113053 Ga0068851_101130532 210
550 3300005841 Ga0068863_100387218 Ga0068863_1003872182 210
551 3300005843 Ga0068860_100017835 Ga0068860_1000178354 210
552 3300005844 Ga0068862_100002626 Ga0068862_1000026263 210
553 3300005844 Ga0068862_100032603 Ga0068862_1000326033 210
554 3300005844 Ga0068862_100035259 Ga0068862_1000352594 210
555 3300006195 Ga0075366_10025447 Ga0075366_100254472 210
556 3300006237 Ga0097621_100026287 Ga0097621_1000262874 210
557 3300006931 Ga0097620_100042793 Ga0097620_1000427932 210
558 3300006931 Ga0097620_100114998 Ga0097620_1001149981 210
559 3300009094 Ga0111539_10581631 Ga0111539_105816311 210
560 3300009148 Ga0105243_10020108 Ga0105243_100201085 210
561 3300009148 Ga0105243_10353300 Ga0105243_103533002 210
562 3300009176 Ga0105242_10337409 Ga0105242_103374092 210
563 3300009553 Ga0105249_10017892 Ga0105249_100178924 210
564 3300009553 Ga0105249_10293441 Ga0105249_102934413 210
565 3300013297 Ga0157378_10003330 Ga0157378_100033303 210
566 3300013306 Ga0163162_10005003 Ga0163162_100050038 210
567 3300013308 Ga0157375_10062210 Ga0157375_100622103 210
568 3300013308 Ga0157375_10239374 Ga0157375_102393743 210
569 3300014326 Ga0157380_10061404 Ga0157380_100614043 210
570 3300014968 Ga0157379_10029042 Ga0157379_100290424 210
571 3300014968 Ga0157379_10052764 Ga0157379_100527645 210
572 3300014969 Ga0157376_10003563 Ga0157376_100035638 210
573 3300017792 Ga0163161_10080670 Ga0163161_100806702 210
574 3300025321 Ga0207656_10192548 Ga0207656_101925482 210
575 3300025893 Ga0207682_10032538 Ga0207682_100325383 210
576 3300025893 Ga0207682_10194352 Ga0207682_101943522 210
577 3300025899 Ga0207642_10016280 Ga0207642_100162802 210
578 3300025907 Ga0207645_10270625 Ga0207645_102706253 210
579 3300025925 Ga0207650_10017187 Ga0207650_100171876 210
580 3300025926 Ga0207659_10023241 Ga0207659_100232413 210
581 3300025931 Ga0207644_10042039 Ga0207644_100420392 210
582 3300025931 Ga0207644_10186631 Ga0207644_101866312 210
583 3300025933 Ga0207706_10075908 Ga0207706_100759083 210
584 3300025934 Ga0207686_10211559 Ga0207686_102115593 210
585 3300025935 Ga0207709_10229289 Ga0207709_102292893 210
586 3300025938 Ga0207704_10003481 Ga0207704_100034817 210
587 3300025940 Ga0207691_10010603 Ga0207691_1001060310 210
588 3300025940 Ga0207691_10044864 Ga0207691_100448642 210
589 3300025940 Ga0207691_10599137 Ga0207691_105991371 210
590 3300025945 Ga0207679_10274027 Ga0207679_102740272 210
591 3300025960 Ga0207651_10032421 Ga0207651_100324214 210
592 3300025961 Ga0207712_10165533 Ga0207712_101655332 210
593 3300025981 Ga0207640_10055919 Ga0207640_100559193 210
594 3300026075 Ga0207708_10013014 Ga0207708_100130144 210
595 3300026078 Ga0207702_10561089 Ga0207702_105610892 210
596 3300026089 Ga0207648_10000419 Ga0207648_1000041934 210
597 3300026095 Ga0207676_10013882 Ga0207676_100138822 210
598 3300026118 Ga0207675_100000693 Ga0207675_10000069312 210
599 3300026121 Ga0207683_10124817 Ga0207683_101248173 210
600 3300026142 Ga0207698_10046432 Ga0207698_100464323 210
601 3300026142 Ga0207698_10253516 Ga0207698_102535162 210
602 3300028380 Ga0268265_10013134 Ga0268265_100131344 210
603 3300028380 Ga0268265_10014510 Ga0268265_100145107 210
604 3300028380 Ga0268265_10163438 Ga0268265_101634383 210
605 3300028381 Ga0268264_10039249 Ga0268264_100392493 210
606 3300028381 Ga0268264_10102470 Ga0268264_101024703 210
607 3300031548 Ga0307408_100336262 Ga0307408_1003362622 210
608 3300032002 Ga0307416_101177055 Ga0307416_1011770552 210
609 3300035116 Ga0373945_0193126 Ga0373945_0193126_150_782 210
610 3300035170 Ga0373943_0225334 Ga0373943_0225334_130_762 210
611 3300036401 Ga0373937_0067765 Ga0373937_0067765_1301_1945 210
612 3300037068 Ga0373925_0046026 Ga0373925_0046026_181_813 210
613 3300037471 Ga0395905_0043213 Ga0395905_0043213_2237_2869 210
614 3300042015 Ga0439462_0056101 Ga0439462_0056101_179_811 210
615 3300042131 Ga0450894_005548 Ga0450894_005548_642_1274 210
616 3300042134 Ga0450898_021514 Ga0450898_021514_78_710 210
617 3300046459 Ga0495629_0028744 Ga0495629_0028744_1649_2293 210
618 3300046535 Ga0495586_0170313 Ga0495586_0170313_94_726 210
619 3300046543 Ga0495645_0013570 Ga0495645_0013570_1098_1742 210
620 3300046681 Ga0495647_0145359 Ga0495647_0145359_124_768 210
621 3300046683 Ga0495658_0014662 Ga0495658_0014662_325_957 210
622 3300046683 Ga0495658_0358347 Ga0495658_0358347_52_696 210
623 3300047471 Ga0495684_0530748 Ga0495684_0530748_78_722 210
624 3300048911 Ga0496108_0257570 Ga0496108_0257570_93_737 210
625 3300048912 Ga0496109_0131042 Ga0496109_0131042_176_820 210
626 3300048913 Ga0496110_0303618 Ga0496110_0303618_20_664 210
627 3300050493 nmdc:mga0k408_146009_c1 nmdc:mga0k408_146009_c1_105_737 210
628 3300050493 nmdc:mga0k408_249378_c1 nmdc:mga0k408_249378_c1_71_703 210
629 3300050493 nmdc:mga0k408_28834_c1 nmdc:mga0k408_28834_c1_1822_2454 210
630 3300053077 Ga0495601_0430729 Ga0495601_0430729_69_713 210
631 3300032005 Ga0307411_10878749 Ga0307411_108787491 211
632 3300037471 Ga0395905_0294763 Ga0395905_0294763_76_741 211
633 3300049572 Ga0501036_0213592 Ga0501036_0213592_511_1146 211
634 3300017792 Ga0163161_10144445 Ga0163161_101444453 212
635 3300028794 Ga0307515_10018987 Ga0307515_100189873 212
636 3300046557 Ga0495622_0000548 Ga0495622_0000548_1073_1732 212
637 iso_pu_bacteria 2855730933 2855735054 213
638 iso_pu_bacteria 2855767633 2855770838 213
639 iso_pu_bacteria 2881412998 2881418232 213
640 3300005295 Ga0065707_10083353 Ga0065707_100833538 214
641 3300031548 Ga0307408_100221485 Ga0307408_1002214852 214
642 3300031911 Ga0307412_10236052 Ga0307412_102360521 214
643 3300041997 Ga0439431_0014206 Ga0439431_0014206_1187_1831 214
644 3300046507 Ga0495606_0001756 Ga0495606_0001756_26301_26960 215
645 3300047469 Ga0495673_0000074 Ga0495673_0000074_99484_100143 215
646 3300053161 Ga0500634_0084755 Ga0500634_0084755_903_1550 215
647 3300003187 JGI25151J46595_10000137 JGI25151J46595_1000013776 217
648 3300006051 Ga0075364_10001290 Ga0075364_100012909 217
649 3300025294 Ga0209025_1000071 Ga0209025_1000071184 217
650 3300025298 Ga0209050_1001375 Ga0209050_100137521 217
651 3300048927 Ga0496124_0192102 Ga0496124_0192102_470_1123 217
652 3300049570 Ga0501033_0236757 Ga0501033_0236757_321_974 217
653 3300049571 Ga0501034_0372907 Ga0501034_0372907_140_793 217
654 3300049573 Ga0501037_0187688 Ga0501037_0187688_264_917 217
655 3300049579 Ga0501043_0000277 Ga0501043_0000277_12636_13289 217
656 3300049580 Ga0501046_0000345 Ga0501046_0000345_33442_34095 217
657 3300049581 Ga0501047_0000395 Ga0501047_0000395_12636_13289 217
658 3300049581 Ga0501047_0006218 Ga0501047_0006218_3725_4378 217
659 3300049582 Ga0501048_0000111 Ga0501048_0000111_12586_13239 217
660 3300049822 Ga0501035_0017204 Ga0501035_0017204_996_1649 217
661 3300049823 Ga0501044_0030603 Ga0501044_0030603_4281_4934 217
662 3300050491 nmdc:mga00v17_43511_c1 nmdc:mga00v17_43511_c1_59_712 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

28

220

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.9126 2 202
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.9121 2 202
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.8957 2 202
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.8949 2 201
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.8907 2 202
ID Description Score Start End Superfamily
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9107 1 201 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9051 1 201 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8978 2 202 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8928 2 201 3.90.280.10
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8883 3 202 3.90.280.10
ID Description Score Start End GO Terms
AF-C3X4Y9-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.998 1 206
AF-A0A257QJA4-F1-model_v4 Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) 0.9961 28 207 GO:0006090
GO:0050242
AF-A0A7I8ECA7-F1-model_v4 Phospholipid-binding protein 0.9956 1 207
AF-A0A4Y6PTT7-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9948 1 206
AF-I3U9P2-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9928 2 208

Feature Viewer

pLDDT pTM Quality
94.68 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map