F473394

General Info

Members Datasets Scaffolds Average Seq Length
661 292 601 300

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10001305|Ga0105243_1000130510
Length 322
Sequence MIETTLTRAAEGLVENMSDIRSLGYLKVQTQDVDRWRGLVVDGLGMAVGSGPDEDGLYLRIDERRSRLQVLPGEVDKVLAVGWEVRDQFALRAVHDELEKAGVEVRELSQGEADQRDVERVITFADPAGTTVEVFFGPVLDHSPVVTPHGGRFVTGPAGLGHVVLPTPHFQETYDFYTEVLGFLPRGAMRLGGPGAPGPALRVRFLGVNQRHHSLAICPAPPSEAPGMVHLMMEVDTLDAVGQALDRVGKLGFSISSTLGRHTNDKMVSFYVRAPGGWDLEFGTEGMLVDETHYTAEEITADSYWGHDWSGSEPLAAFTPES

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2643221561 Nocardioides sp. Root151 Isolate Unclassified
4 2643221692 Nocardia sp. Root136 Isolate Unclassified
5 2643221696 Nocardioides sp. Root140 Isolate Unclassified
6 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
7 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
8 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
9 2738541305 Nocardioides sp. CF167 Isolate Unclassified
10 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
11 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
12 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
13 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
14 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
15 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
16 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
17 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
18 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
19 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
20 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
21 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
22 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
23 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
24 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
25 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
26 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
27 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
28 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
29 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
30 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
31 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
32 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
33 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
34 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
35 2922554459 Rhodococcus sp. 66b Isolate Unclassified
36 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
37 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
38 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
39 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
40 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
204 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
286 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
289 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
291 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
292 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.07
Metatranscriptomes 0
Isolates 8.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.95
Nodule 0.15
Rhizoplane 12.25
Rhizosphere 57.49
Stem 0
Stem Tuber 0
Unclassified 18.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10005048 3300001991 Bacteria 2184
2 JGI24744J21845_10003180 3300002077 Bacteria 3369
3 JGI24744J21845_10007364 3300002077 Bacteria 2273
4 rootL2_10227700 3300003322 Bacteria 3218
5 Ga0055540_1000057 3300003792 Bacteria 136356
6 Ga0055540_1006615 3300003792 Bacteria 4555
7 Ga0070658_10012657 3300005327 Bacteria 6766
8 Ga0070676_10048013 3300005328 Bacteria 2495
9 Ga0070690_100204349 3300005330 Bacteria 1376
10 Ga0068869_100199301 3300005334 Bacteria 1578
11 Ga0070680_100252117 3300005336 Bacteria 1492
12 Ga0070682_100008009 3300005337 Bacteria 5949
13 Ga0070682_100190760 3300005337 Bacteria 1439
14 Ga0068868_100316946 3300005338 Bacteria 1328
15 Ga0070687_100167078 3300005343 Bacteria 1306
16 Ga0070668_100002095 3300005347 Bacteria 14582
17 Ga0070668_100030630 3300005347 Bacteria 4092
18 Ga0070668_100034174 3300005347 Bacteria 3874
19 Ga0070668_100042563 3300005347 Bacteria 3481
20 Ga0070668_100248568 3300005347 Bacteria 1476
21 Ga0070671_100001518 3300005355 Bacteria 17405
22 Ga0070674_100038952 3300005356 Bacteria 3207
23 Ga0070674_100241872 3300005356 Bacteria 1413
24 Ga0070673_100100056 3300005364 Bacteria 2386
25 Ga0070667_100000723 3300005367 Bacteria 31728
26 Ga0070667_100000875 3300005367 Bacteria 27853
27 Ga0070667_100005037 3300005367 Bacteria 11056
28 Ga0070667_100010043 3300005367 Bacteria 7845
29 Ga0070667_100221479 3300005367 Bacteria 1684
30 Ga0070709_10113630 3300005434 Bacteria 1824
31 Ga0070709_10189390 3300005434 Bacteria 1450
32 Ga0070714_100020878 3300005435 Bacteria 5354
33 Ga0070714_100047988 3300005435 Bacteria 3630
34 Ga0070714_100212829 3300005435 Bacteria 1772
35 Ga0070713_100424198 3300005436 Bacteria 1245
36 Ga0070701_10000189 3300005438 Bacteria 19148
37 Ga0070711_100001473 3300005439 Bacteria 12936
38 Ga0070711_100018206 3300005439 Bacteria 4481
39 Ga0070705_100014479 3300005440 Bacteria 4058
40 Ga0070700_100002302 3300005441 Bacteria 9718
41 Ga0070694_100029027 3300005444 Bacteria 3607
42 Ga0070663_100153008 3300005455 Bacteria 1770
43 Ga0070663_100465125 3300005455 Bacteria 1045
44 Ga0070678_100003573 3300005456 Bacteria 8674
45 Ga0070678_100198970 3300005456 Bacteria 1652
46 Ga0070662_100081125 3300005457 Bacteria 2416
47 Ga0068867_100111685 3300005459 Bacteria 2100
48 Ga0070685_10071723 3300005466 Bacteria 2054
49 Ga0070706_100225049 3300005467 Bacteria 1751
50 Ga0070698_100002017 3300005471 Bacteria 22571
51 Ga0068853_100017858 3300005539 Bacteria 5861
52 Ga0068853_100246197 3300005539 Bacteria 1639
53 Ga0070672_100193027 3300005543 Bacteria 1701
54 Ga0070695_100001590 3300005545 Bacteria 12700
55 Ga0070693_100006988 3300005547 Bacteria 5496
56 Ga0070665_100001909 3300005548 Bacteria 23561
57 Ga0070665_100004795 3300005548 Bacteria 14074
58 Ga0070665_100019990 3300005548 Bacteria 6725
59 Ga0070665_100033980 3300005548 Bacteria 5129
60 Ga0070665_100066504 3300005548 Bacteria 3616
61 Ga0070704_100004448 3300005549 Bacteria 8095
62 Ga0070704_100378080 3300005549 Bacteria 1202
63 Ga0068855_100076996 3300005563 Bacteria 3870
64 Ga0068854_100052285 3300005578 Bacteria 2929
65 Ga0068854_100090911 3300005578 Bacteria 2271
66 Ga0070702_100050262 3300005615 Bacteria 2381
67 Ga0068852_100526449 3300005616 Bacteria 1180
68 Ga0068859_100002020 3300005617 Bacteria 20708
69 Ga0068859_100017543 3300005617 Bacteria 7196
70 Ga0068859_100036533 3300005617 Bacteria 4932
71 Ga0068859_100218540 3300005617 Bacteria 1993
72 Ga0068866_10026118 3300005718 Bacteria 2754
73 Ga0068851_10054290 3300005834 Bacteria 2041
74 Ga0068863_100000305 3300005841 Bacteria 50559
75 Ga0068863_100002102 3300005841 Bacteria 19738
76 Ga0068863_100177326 3300005841 Bacteria 2045
77 Ga0068858_100003983 3300005842 Bacteria 14577
78 Ga0068858_100005093 3300005842 Bacteria 12877
79 Ga0068858_100046322 3300005842 Bacteria 4031
80 Ga0068858_100087082 3300005842 Bacteria 2905
81 Ga0068860_100000023 3300005843 Bacteria 279076
82 Ga0068860_100000287 3300005843 Bacteria 71871
83 Ga0068860_100003750 3300005843 Bacteria 15629
84 Ga0068860_100022412 3300005843 Bacteria 6109
85 Ga0068860_100077672 3300005843 Bacteria 3158
86 Ga0068860_100128026 3300005843 Bacteria 2434
87 Ga0068862_100000296 3300005844 Bacteria 54630
88 Ga0068862_100001398 3300005844 Bacteria 22381
89 Ga0068862_100004148 3300005844 Bacteria 12276
90 Ga0081455_10042478 3300005937 Bacteria 3987
91 Ga0081455_10208533 3300005937 Bacteria 1457
92 Ga0075365_10000556 3300006038 Bacteria 14422
93 Ga0075365_10006913 3300006038 Bacteria 6299
94 Ga0075365_10029812 3300006038 Bacteria 3490
95 Ga0075365_10040431 3300006038 Bacteria 3041
96 Ga0075365_10073949 3300006038 Bacteria 2298
97 Ga0075365_10212250 3300006038 Bacteria 1357
98 Ga0075363_100000194 3300006048 Bacteria 16409
99 Ga0075363_100005743 3300006048 Bacteria 5563
100 Ga0075363_100022185 3300006048 Bacteria 3207
101 Ga0075363_100039539 3300006048 Bacteria 2483
102 Ga0075363_100067898 3300006048 Bacteria 1932
103 Ga0075363_100088578 3300006048 Bacteria 1701
104 Ga0075364_10000231 3300006051 Bacteria 26472
105 Ga0075364_10001588 3300006051 Bacteria 12422
106 Ga0075364_10005515 3300006051 Bacteria 7363
107 Ga0075364_10008632 3300006051 Bacteria 6095
108 Ga0075364_10013977 3300006051 Bacteria 4948
109 Ga0075364_10148405 3300006051 Bacteria 1580
110 Ga0075364_10237194 3300006051 Bacteria 1238
111 Ga0075364_10248916 3300006051 Bacteria 1208
112 Ga0070716_100044694 3300006173 Bacteria 2482
113 Ga0070716_100082498 3300006173 Bacteria 1923
114 Ga0070712_100003572 3300006175 Bacteria 9577
115 Ga0070712_100023599 3300006175 Bacteria 4066
116 Ga0075362_10100195 3300006177 Bacteria 1354
117 Ga0075362_10122666 3300006177 Bacteria 1231
118 Ga0075362_10145958 3300006177 Bacteria 1133
119 Ga0075367_10015197 3300006178 Bacteria 4179
120 Ga0075367_10015350 3300006178 Bacteria 4161
121 Ga0075367_10146986 3300006178 Bacteria 1462
122 Ga0075369_10003427 3300006186 Bacteria 5775
123 Ga0075369_10004740 3300006186 Bacteria 5048
124 Ga0075369_10006710 3300006186 Bacteria 4364
125 Ga0075369_10009003 3300006186 Bacteria 3863
126 Ga0075369_10032085 3300006186 Bacteria 2221
127 Ga0075369_10075285 3300006186 Bacteria 1490
128 Ga0075370_10004289 3300006353 Bacteria 6908
129 Ga0075370_10021536 3300006353 Bacteria 3532
130 Ga0075370_10046207 3300006353 Bacteria 2464
131 Ga0075370_10107315 3300006353 Bacteria 1619
132 Ga0075428_100001554 3300006844 Bacteria 24580
133 Ga0075430_100003634 3300006846 Bacteria 12939
134 Ga0075430_100112451 3300006846 Bacteria 2270
135 Ga0075431_100074570 3300006847 Bacteria 3501
136 Ga0075433_10059269 3300006852 Bacteria 3349
137 Ga0075433_10095027 3300006852 Bacteria 2638
138 Ga0075434_100003638 3300006871 Bacteria 13765
139 Ga0068865_100034496 3300006881 Bacteria 3395
140 Ga0075436_100019263 3300006914 Bacteria 4676
141 Ga0097620_100002020 3300006931 Bacteria 20708
142 Ga0097620_100017544 3300006931 Bacteria 7196
143 Ga0097620_100036528 3300006931 Bacteria 4932
144 Ga0097620_100218537 3300006931 Bacteria 1993
145 Ga0075435_100004834 3300007076 Bacteria 9325
146 Ga0099795_10070507 3300007788 Bacteria 1318
147 Ga0105251_10014636 3300009011 Bacteria 4325
148 Ga0105250_10029988 3300009092 Bacteria 2188
149 Ga0105245_10063941 3300009098 Bacteria 3325
150 Ga0105245_10408001 3300009098 Bacteria 1359
151 Ga0105247_10000134 3300009101 Bacteria 71986
152 Ga0105247_10000797 3300009101 Bacteria 24162
153 Ga0114129_10035925 3300009147 Bacteria 6998
154 Ga0114129_10160468 3300009147 Bacteria 3072
155 Ga0114129_10305578 3300009147 Bacteria 2119
156 Ga0105243_10001305 3300009148 Bacteria 22267
157 Ga0105243_10005168 3300009148 Bacteria 10222
158 Ga0105243_10005417 3300009148 Bacteria 9960
159 Ga0105241_10198389 3300009174 Bacteria 1674
160 Ga0105242_10000505 3300009176 Bacteria 30808
161 Ga0105248_10000181 3300009177 Bacteria 73501
162 Ga0105248_10015076 3300009177 Bacteria 8510
163 Ga0105248_10092287 3300009177 Bacteria 3410
164 Ga0105237_10001013 3300009545 Bacteria 37790
165 Ga0105237_10002160 3300009545 Bacteria 24750
166 Ga0105237_10004282 3300009545 Bacteria 16557
167 Ga0105249_10000189 3300009553 Bacteria 70627
168 Ga0105249_10075650 3300009553 Bacteria 3119
169 Ga0105249_10190602 3300009553 Bacteria 2001
170 Ga0105239_10000626 3300010375 Bacteria 50329
171 Ga0105239_10001157 3300010375 Bacteria 36242
172 Ga0105239_10031749 3300010375 Bacteria 5803
173 Ga0105239_10161431 3300010375 Bacteria 2504
174 Ga0105239_10280109 3300010375 Bacteria 1877
175 Ga0105239_10517782 3300010375 Bacteria 1357
176 Ga0105246_10173234 3300011119 Bacteria 1655
177 Ga0157369_10042531 3300013105 Bacteria 4956
178 Ga0157369_10230381 3300013105 Bacteria 1937
179 Ga0157374_10135432 3300013296 Bacteria 2387
180 Ga0157378_10000302 3300013297 Bacteria 47818
181 Ga0157378_10032709 3300013297 Bacteria 4596
182 Ga0163162_10008140 3300013306 Bacteria 10231
183 Ga0163162_10156085 3300013306 Bacteria 2402
184 Ga0163162_10344276 3300013306 Bacteria 1623
185 Ga0163162_10535256 3300013306 Bacteria 1300
186 Ga0157375_10005938 3300013308 Bacteria 10640
187 Ga0157375_10171318 3300013308 Bacteria 2318
188 Ga0163163_10022198 3300014325 Bacteria 6005
189 Ga0163163_10187866 3300014325 Bacteria 2114
190 Ga0157380_10003367 3300014326 Bacteria 10968
191 Ga0157377_10028880 3300014745 Bacteria 2989
192 Ga0157379_10014856 3300014968 Bacteria 6829
193 Ga0157379_10034528 3300014968 Bacteria 4509
194 Ga0157379_10198896 3300014968 Bacteria 1812
195 Ga0157379_10225587 3300014968 Bacteria 1698
196 Ga0163161_10000294 3300017792 Bacteria 43680
197 Ga0213876_10027318 3300021384 Bacteria 3013
198 Ga0213875_10014815 3300021388 Bacteria 3800
199 Ga0213875_10033637 3300021388 Bacteria 2422
200 Ga0209051_1000075 3300025303 Bacteria 205011
201 Ga0209051_1009045 3300025303 Bacteria 5186
202 Ga0207713_1039914 3300025735 Bacteria 1975
203 Ga0207653_10065094 3300025885 Bacteria 1237
204 Ga0207692_10014424 3300025898 Bacteria 3453
205 Ga0207692_10097877 3300025898 Bacteria 1604
206 Ga0207642_10064422 3300025899 Bacteria 1718
207 Ga0207710_10000163 3300025900 Bacteria 70646
208 Ga0207710_10000292 3300025900 Bacteria 40483
209 Ga0207710_10000614 3300025900 Bacteria 20855
210 Ga0207710_10024150 3300025900 Bacteria 2616
211 Ga0207710_10095645 3300025900 Bacteria 1396
212 Ga0207688_10001011 3300025901 Bacteria 14334
213 Ga0207688_10001349 3300025901 Bacteria 12759
214 Ga0207680_10031553 3300025903 Bacteria 3002
215 Ga0207647_10029068 3300025904 Bacteria 3582
216 Ga0207647_10033537 3300025904 Bacteria 3287
217 Ga0207685_10032971 3300025905 Bacteria 1868
218 Ga0207699_10034658 3300025906 Bacteria 2865
219 Ga0207705_10038361 3300025909 Bacteria 3430
220 Ga0207684_10533153 3300025910 Bacteria 1005
221 Ga0207671_10004785 3300025914 Bacteria 12762
222 Ga0207671_10006971 3300025914 Bacteria 9920
223 Ga0207671_10035291 3300025914 Bacteria 3712
224 Ga0207671_10130026 3300025914 Bacteria 1932
225 Ga0207693_10000441 3300025915 Bacteria 37916
226 Ga0207693_10003317 3300025915 Bacteria 13772
227 Ga0207662_10201264 3300025918 Bacteria 1289
228 Ga0207687_10016144 3300025927 Bacteria 4902
229 Ga0207687_10123747 3300025927 Bacteria 1938
230 Ga0207700_10404966 3300025928 Bacteria 1196
231 Ga0207664_10086937 3300025929 Bacteria 2555
232 Ga0207664_10100714 3300025929 Bacteria 2386
233 Ga0207664_10235637 3300025929 Bacteria 1592
234 Ga0207664_10556386 3300025929 Bacteria 1029
235 Ga0207644_10003664 3300025931 Bacteria 9959
236 Ga0207644_10019916 3300025931 Bacteria 4556
237 Ga0207706_10007290 3300025933 Bacteria 10225
238 Ga0207706_10026745 3300025933 Bacteria 5165
239 Ga0207709_10002791 3300025935 Bacteria 10754
240 Ga0207709_10006535 3300025935 Bacteria 6549
241 Ga0207709_10024191 3300025935 Bacteria 3466
242 Ga0207669_10017808 3300025937 Bacteria 3654
243 Ga0207669_10113731 3300025937 Bacteria 1820
244 Ga0207704_10025436 3300025938 Bacteria 3229
245 Ga0207665_10023426 3300025939 Bacteria 4068
246 Ga0207665_10227696 3300025939 Bacteria 1369
247 Ga0207691_10194606 3300025940 Bacteria 1767
248 Ga0207711_10000043 3300025941 Bacteria 157580
249 Ga0207711_10000228 3300025941 Bacteria 60300
250 Ga0207711_10013490 3300025941 Bacteria 6785
251 Ga0207711_10041802 3300025941 Bacteria 3904
252 Ga0207689_10030924 3300025942 Bacteria 4460
253 Ga0207667_10157903 3300025949 Bacteria 2333
254 Ga0207667_10398394 3300025949 Bacteria 1402
255 Ga0207651_10115181 3300025960 Bacteria 2027
256 Ga0207712_10000006 3300025961 Bacteria 573204
257 Ga0207712_10017821 3300025961 Bacteria 4618
258 Ga0207668_10029135 3300025972 Bacteria 3615
259 Ga0207668_10032903 3300025972 Bacteria 3432
260 Ga0207668_10152934 3300025972 Bacteria 1788
261 Ga0207668_10397015 3300025972 Bacteria 1165
262 Ga0207658_10001732 3300025986 Bacteria 16451
263 Ga0207658_10002342 3300025986 Bacteria 13916
264 Ga0207658_10006674 3300025986 Bacteria 7863
265 Ga0207658_10035671 3300025986 Bacteria 3563
266 Ga0207677_10032601 3300026023 Bacteria 3351
267 Ga0207703_10000021 3300026035 Bacteria 247414
268 Ga0207703_10010908 3300026035 Bacteria 7081
269 Ga0207703_10030013 3300026035 Bacteria 4294
270 Ga0207703_10116642 3300026035 Bacteria 2286
271 Ga0207639_10009957 3300026041 Bacteria 6569
272 Ga0207639_10228546 3300026041 Bacteria 1611
273 Ga0207678_10009087 3300026067 Bacteria 8749
274 Ga0207678_10033853 3300026067 Bacteria 4450
275 Ga0207678_10091483 3300026067 Bacteria 2600
276 Ga0207708_10003545 3300026075 Bacteria 11496
277 Ga0207641_10001160 3300026088 Bacteria 26484
278 Ga0207641_10008714 3300026088 Bacteria 8379
279 Ga0207641_10033592 3300026088 Bacteria 4261
280 Ga0207641_10576217 3300026088 Bacteria 1100
281 Ga0207648_10001766 3300026089 Bacteria 23675
282 Ga0207648_10112535 3300026089 Bacteria 2390
283 Ga0207676_10326587 3300026095 Bacteria 1410
284 Ga0207675_100000532 3300026118 Bacteria 37041
285 Ga0207675_100010969 3300026118 Bacteria 8488
286 Ga0207675_100124883 3300026118 Bacteria 2437
287 Ga0207683_10000474 3300026121 Bacteria 37371
288 Ga0207698_10241242 3300026142 Bacteria 1647
289 Ga0207698_10261325 3300026142 Bacteria 1590
290 Ga0209371_1014882 3300027312 Bacteria 2114
291 Ga0268266_10002871 3300028379 Bacteria 17908
292 Ga0268266_10057334 3300028379 Bacteria 3352
293 Ga0268266_10126947 3300028379 Bacteria 2277
294 Ga0268265_10000192 3300028380 Bacteria 71772
295 Ga0268265_10000276 3300028380 Bacteria 58368
296 Ga0268265_10169373 3300028380 Bacteria 1865
297 Ga0268264_10000008 3300028381 Bacteria 773387
298 Ga0268264_10000339 3300028381 Bacteria 71891
299 Ga0268264_10014172 3300028381 Bacteria 6556
300 Ga0268264_10015870 3300028381 Bacteria 6168
301 Ga0268256_1017453 3300030500 Bacteria 2020
302 Ga0265327_10000004 3300031251 Bacteria 803973
303 Ga0265327_10000363 3300031251 Bacteria 86525
304 Ga0265327_10002825 3300031251 Bacteria 17527
305 Ga0265327_10019936 3300031251 Bacteria 4105
306 Ga0307518_10149744 3300031838 Bacteria 1616
307 Ga0307410_10032324 3300031852 Bacteria 3366
308 Ga0307410_10200032 3300031852 Bacteria 1525
309 Ga0307406_10051168 3300031901 Bacteria 2622
310 Ga0307406_10193111 3300031901 Bacteria 1492
311 Ga0307407_10082044 3300031903 Bacteria 1953
312 Ga0307412_10325979 3300031911 Bacteria 1224
313 Ga0307409_100004944 3300031995 Bacteria 7587
314 Ga0307416_100038803 3300032002 Bacteria 3678
315 Ga0307411_10301757 3300032005 Bacteria 1285
316 Ga0307415_100188783 3300032126 Bacteria 1624
317 Ga0373949_0004947 3300035090 Bacteria 3008
318 Ga0316584_0018128 3300036712 Bacteria 5075
319 Ga0395900_0031002 3300037418 Bacteria 5492
320 Ga0395898_0035950 3300037466 Bacteria 4923
321 Ga0395898_0037184 3300037466 Bacteria 4831
322 Ga0395898_0118833 3300037466 Bacteria 2532
323 Ga0395905_0363908 3300037471 Bacteria 1339
324 Ga0436364_0157880 3300037853 Bacteria 17628
325 Ga0436364_0848265 3300037853 Bacteria 3441
326 Ga0436364_1229776 3300037853 Bacteria 2667
327 Ga0395901_0015044 3300038443 Bacteria 7867
328 Ga0395901_0078462 3300038443 Bacteria 3448
329 Ga0436365_0246124 3300039437 Bacteria 99631
330 Ga0436365_0560586 3300039437 Bacteria 1569
331 Ga0436365_1111259 3300039437 Bacteria 5270
332 Ga0439466_0001043 3300041411 Bacteria 10696
333 Ga0439466_0005026 3300041411 Bacteria 5074
334 Ga0439466_0017265 3300041411 Bacteria 2602
335 Ga0439465_0000229 3300041413 Bacteria 15154
336 Ga0439465_0002796 3300041413 Bacteria 5718
337 Ga0439465_0011612 3300041413 Bacteria 2764
338 Ga0451853_3273662 3300041512 Bacteria 1080
339 Ga0439431_0002101 3300041997 Bacteria 4401
340 Ga0439442_001213 3300042002 Bacteria 5130
341 Ga0439448_0005972 3300042005 Bacteria 3488
342 Ga0439434_0048997 3300042435 Bacteria 1307
343 Ga0466972_0022620 3300044658 Bacteria 3128
344 Ga0466972_0044816 3300044658 Bacteria 2144
345 Ga0466972_0194303 3300044658 Bacteria 951
346 Ga0466965_0001714 3300044683 Bacteria 9014
347 Ga0466965_0005404 3300044683 Bacteria 5757
348 Ga0466965_0018541 3300044683 Bacteria 3337
349 Ga0466965_0039644 3300044683 Bacteria 2316
350 Ga0466966_0018248 3300044684 Bacteria 4629
351 Ga0466966_0187620 3300044684 Bacteria 1253
352 Ga0466961_0012209 3300044693 Bacteria 5492
353 Ga0466961_0146832 3300044693 Bacteria 1474
354 Ga0466963_0047907 3300044694 Bacteria 2822
355 Ga0466963_0099325 3300044694 Bacteria 1991
356 Ga0466963_0209930 3300044694 Bacteria 1362
357 Ga0466971_0021833 3300044719 Bacteria 2849
358 Ga0466971_0131902 3300044719 Bacteria 1160
359 Ga0466968_0005238 3300044735 Bacteria 4857
360 Ga0466968_0079886 3300044735 Bacteria 1435
361 Ga0466957_0005244 3300044842 Bacteria 7257
362 Ga0466957_0076983 3300044842 Bacteria 2072
363 Ga0466960_0001288 3300044901 Bacteria 9099
364 Ga0466960_0015609 3300044901 Bacteria 3277
365 Ga0466959_0015175 3300045049 Bacteria 5611
366 Ga0466959_0022218 3300045049 Bacteria 4687
367 Ga0466959_0068946 3300045049 Bacteria 2562
368 Ga0466958_0001440 3300045836 Bacteria 11285
369 Ga0466958_0005494 3300045836 Bacteria 6835
370 Ga0466967_0079043 3300045976 Bacteria 2964
371 Ga0466967_0139427 3300045976 Bacteria 2257
372 Ga0466967_0213283 3300045976 Bacteria 1832
373 Ga0495603_0000635 3300046455 Bacteria 19745
374 Ga0495629_0036054 3300046459 Bacteria 3493
375 Ga0495638_0005992 3300046460 Bacteria 8911
376 Ga0495638_0022027 3300046460 Bacteria 4188
377 Ga0495665_0010350 3300046531 Bacteria 5048
378 Ga0495665_0116817 3300046531 Bacteria 1397
379 Ga0495668_0000237 3300046616 Bacteria 78532
380 Ga0495588_0108794 3300046674 Bacteria 1459
381 Ga0495613_0019936 3300046689 Bacteria 4998
382 Ga0495581_0066506 3300047315 Bacteria 2084
383 Ga0495672_0007294 3300047320 Bacteria 8340
384 Ga0495676_0001286 3300047321 Bacteria 21528
385 Ga0495614_0000417 3300048089 Bacteria 17451
386 Ga0496100_0000009 3300048903 Bacteria 225785
387 Ga0496100_0001621 3300048903 Bacteria 11129
388 Ga0496100_0004371 3300048903 Bacteria 7484
389 Ga0496100_0005328 3300048903 Bacteria 6914
390 Ga0496100_0008313 3300048903 Bacteria 5786
391 Ga0496100_0015718 3300048903 Bacteria 4424
392 Ga0496100_0122206 3300048903 Bacteria 1823
393 Ga0496100_0152908 3300048903 Bacteria 1648
394 Ga0496100_0162809 3300048903 Bacteria 1601
395 Ga0496101_0000018 3300048904 Bacteria 236102
396 Ga0496101_0000099 3300048904 Bacteria 90235
397 Ga0496101_0000333 3300048904 Bacteria 32315
398 Ga0496101_0006835 3300048904 Bacteria 7363
399 Ga0496101_0008486 3300048904 Bacteria 6714
400 Ga0496101_0013378 3300048904 Bacteria 5494
401 Ga0496101_0048545 3300048904 Bacteria 3051
402 Ga0496102_0000056 3300048905 Bacteria 172707
403 Ga0496102_0000102 3300048905 Bacteria 122251
404 Ga0496102_0000509 3300048905 Bacteria 42554
405 Ga0496102_0003699 3300048905 Bacteria 12932
406 Ga0496102_0033688 3300048905 Bacteria 4605
407 Ga0496102_0055076 3300048905 Bacteria 3627
408 Ga0496102_0116255 3300048905 Bacteria 2496
409 Ga0496102_0150092 3300048905 Bacteria 2189
410 Ga0496102_0236313 3300048905 Bacteria 1723
411 Ga0496103_0000040 3300048906 Bacteria 172148
412 Ga0496103_0000090 3300048906 Bacteria 101941
413 Ga0496103_0000116 3300048906 Bacteria 86969
414 Ga0496103_0000215 3300048906 Bacteria 57372
415 Ga0496103_0000666 3300048906 Bacteria 25814
416 Ga0496103_0081702 3300048906 Bacteria 2033
417 Ga0496104_0005495 3300048907 Bacteria 11098
418 Ga0496105_0016138 3300048908 Bacteria 5957
419 Ga0496105_0079816 3300048908 Bacteria 2702
420 Ga0496105_0172770 3300048908 Bacteria 1771
421 Ga0496105_0289806 3300048908 Bacteria 1318
422 Ga0496105_0298278 3300048908 Bacteria 1296
423 Ga0496105_0436839 3300048908 Bacteria 1035
424 Ga0496106_0000522 3300048909 Bacteria 27324
425 Ga0496106_0001318 3300048909 Bacteria 18610
426 Ga0496106_0007583 3300048909 Bacteria 8027
427 Ga0496106_0009318 3300048909 Bacteria 7258
428 Ga0496106_0015689 3300048909 Bacteria 5604
429 Ga0496106_0042168 3300048909 Bacteria 3422
430 Ga0496106_0071977 3300048909 Bacteria 2643
431 Ga0496107_0002302 3300048910 Bacteria 12325
432 Ga0496107_0005035 3300048910 Bacteria 9005
433 Ga0496107_0007957 3300048910 Bacteria 7316
434 Ga0496107_0016701 3300048910 Bacteria 5160
435 Ga0496107_0020492 3300048910 Bacteria 4671
436 Ga0496107_0027130 3300048910 Bacteria 4066
437 Ga0496107_0037026 3300048910 Bacteria 3501
438 Ga0496107_0047282 3300048910 Bacteria 3099
439 Ga0496107_0079251 3300048910 Bacteria 2394
440 Ga0496108_0001969 3300048911 Bacteria 16447
441 Ga0496108_0011618 3300048911 Bacteria 7163
442 Ga0496108_0020335 3300048911 Bacteria 5457
443 Ga0496108_0051127 3300048911 Bacteria 3462
444 Ga0496108_0186417 3300048911 Bacteria 1797
445 Ga0496109_0000136 3300048912 Bacteria 73612
446 Ga0496109_0005213 3300048912 Bacteria 10857
447 Ga0496109_0013726 3300048912 Bacteria 7038
448 Ga0496110_0000204 3300048913 Bacteria 37863
449 Ga0496110_0000744 3300048913 Bacteria 22489
450 Ga0496110_0066544 3300048913 Bacteria 3187
451 Ga0496111_0003083 3300048914 Bacteria 10241
452 Ga0496111_0013455 3300048914 Bacteria 5569
453 Ga0496111_0244997 3300048914 Bacteria 1331
454 Ga0496111_0534301 3300048914 Bacteria 862
455 Ga0496112_0073074 3300048915 Bacteria 3390
456 Ga0496113_0025972 3300048916 Bacteria 4183
457 Ga0496113_0100360 3300048916 Bacteria 2243
458 Ga0496113_0123295 3300048916 Bacteria 2028
459 Ga0496114_0000116 3300048917 Bacteria 57632
460 Ga0496114_0000781 3300048917 Bacteria 23730
461 Ga0496114_0001503 3300048917 Bacteria 17692
462 Ga0496114_0026468 3300048917 Bacteria 4749
463 Ga0496114_0198934 3300048917 Bacteria 1755
464 Ga0496115_0013794 3300048918 Bacteria 6119
465 Ga0496115_0018414 3300048918 Bacteria 5362
466 Ga0496115_0325556 3300048918 Bacteria 1256
467 Ga0496116_0000056 3300048919 Bacteria 282554
468 Ga0496116_0000364 3300048919 Bacteria 69617
469 Ga0496116_0000720 3300048919 Bacteria 42406
470 Ga0496116_0000773 3300048919 Bacteria 40648
471 Ga0496116_0012120 3300048919 Bacteria 7061
472 Ga0496116_0094617 3300048919 Bacteria 1805
473 Ga0496117_0000003 3300048920 Bacteria 1881097
474 Ga0496117_0000148 3300048920 Bacteria 149369
475 Ga0496117_0002172 3300048920 Bacteria 25568
476 Ga0496117_0005624 3300048920 Bacteria 13086
477 Ga0496117_0078422 3300048920 Bacteria 2180
478 Ga0496117_0103556 3300048920 Bacteria 1793
479 Ga0496117_0173893 3300048920 Bacteria 1246
480 Ga0496118_0000001 3300048921 Bacteria 1881100
481 Ga0496118_0000042 3300048921 Bacteria 287521
482 Ga0496118_0001419 3300048921 Bacteria 36163
483 Ga0496118_0001817 3300048921 Bacteria 30722
484 Ga0496118_0004013 3300048921 Bacteria 17905
485 Ga0496118_0009738 3300048921 Bacteria 9643
486 Ga0496118_0018820 3300048921 Bacteria 6201
487 Ga0496118_0033733 3300048921 Bacteria 4192
488 Ga0496118_0074698 3300048921 Bacteria 2421
489 Ga0496118_0174604 3300048921 Bacteria 1307
490 Ga0496119_0000263 3300048922 Bacteria 74497
491 Ga0496119_0003470 3300048922 Bacteria 16353
492 Ga0496119_0006001 3300048922 Bacteria 11414
493 Ga0496119_0022591 3300048922 Bacteria 4494
494 Ga0496119_0029441 3300048922 Bacteria 3723
495 Ga0496119_0099044 3300048922 Bacteria 1640
496 Ga0496120_0000318 3300048923 Bacteria 79637
497 Ga0496120_0001788 3300048923 Bacteria 24161
498 Ga0496120_0014005 3300048923 Bacteria 5365
499 Ga0496120_0016163 3300048923 Bacteria 4886
500 Ga0496120_0027150 3300048923 Bacteria 3527
501 Ga0496120_0033872 3300048923 Bacteria 3065
502 Ga0496121_0000016 3300048924 Bacteria 562911
503 Ga0496121_0000023 3300048924 Bacteria 463448
504 Ga0496121_0000121 3300048924 Bacteria 172480
505 Ga0496121_0001422 3300048924 Bacteria 40504
506 Ga0496121_0019283 3300048924 Bacteria 6826
507 Ga0496122_0000038 3300048925 Bacteria 295624
508 Ga0496122_0000284 3300048925 Bacteria 113244
509 Ga0496122_0003651 3300048925 Bacteria 19996
510 Ga0496123_0005397 3300048926 Bacteria 12882
511 Ga0496123_0007347 3300048926 Bacteria 10431
512 Ga0496123_0029725 3300048926 Bacteria 4013
513 Ga0496124_0000014 3300048927 Bacteria 463448
514 Ga0496124_0000015 3300048927 Bacteria 460700
515 Ga0496124_0155161 3300048927 Bacteria 1791
516 Ga0496125_0000020 3300048928 Bacteria 463448
517 Ga0496125_0000021 3300048928 Bacteria 460688
518 Ga0496125_0008825 3300048928 Bacteria 10481
519 Ga0496125_0019227 3300048928 Bacteria 6451
520 Ga0496125_0020322 3300048928 Bacteria 6233
521 Ga0496125_0104838 3300048928 Bacteria 2069
522 Ga0496126_0000015 3300048929 Bacteria 663212
523 Ga0496126_0000023 3300048929 Bacteria 463448
524 Ga0496126_0001128 3300048929 Bacteria 44671
525 Ga0496126_0001819 3300048929 Bacteria 31173
526 Ga0496126_0002192 3300048929 Bacteria 27135
527 Ga0496126_0003310 3300048929 Bacteria 20519
528 Ga0496126_0005274 3300048929 Bacteria 14845
529 Ga0496126_0050884 3300048929 Bacteria 3774
530 Ga0496126_0054571 3300048929 Bacteria 3618
531 Ga0496126_0246681 3300048929 Bacteria 1490
532 Ga0501033_0000422 3300049570 Bacteria 40484
533 Ga0501033_0022206 3300049570 Bacteria 4788
534 Ga0501033_0180899 3300049570 Bacteria 1511
535 Ga0501033_0247978 3300049570 Bacteria 1263
536 Ga0501034_0006769 3300049571 Bacteria 12259
537 Ga0501037_0031554 3300049573 Bacteria 3911
538 Ga0501037_0347697 3300049573 Bacteria 1023
539 Ga0501039_0057378 3300049575 Bacteria 3015
540 Ga0501041_0293971 3300049577 Bacteria 1023
541 Ga0501046_0000104 3300049580 Bacteria 89700
542 Ga0501047_0013512 3300049581 Bacteria 7740
543 Ga0501047_0070062 3300049581 Bacteria 3376
544 Ga0501047_0491089 3300049581 Bacteria 1055
545 Ga0501048_0028520 3300049582 Bacteria 4052
546 Ga0501070_0005540 3300049586 Bacteria 10764
547 Ga0501071_0193493 3300049587 Bacteria 1526
548 Ga0501074_0547978 3300049590 Bacteria 819
549 Ga0501035_0025498 3300049822 Bacteria 5419
550 Ga0501035_0173350 3300049822 Bacteria 1863
551 Ga0501044_0009965 3300049823 Bacteria 10323
552 Ga0501044_0093610 3300049823 Bacteria 3030
553 nmdc:mga03683_100286_c1 3300050489 Bacteria 1272
554 nmdc:mga03n38_1104_c1 3300050490 Bacteria 7458
555 nmdc:mga03n38_207795_c1 3300050490 Bacteria 1016
556 nmdc:mga03n38_3072_c1 3300050490 Bacteria 5292
557 nmdc:mga03n38_47366_c1 3300050490 Bacteria 1902
558 nmdc:mga03n38_6608_c1 3300050490 Bacteria 4043
559 nmdc:mga03n38_66230_c1 3300050490 Bacteria 1658
560 nmdc:mga03n38_7493_c1 3300050490 Bacteria 3865
561 nmdc:mga00v17_25954_c1 3300050491 Bacteria 3409
562 nmdc:mga00v17_27394_c1 3300050491 Bacteria 3327
563 nmdc:mga00v17_55471_c1 3300050491 Bacteria 2420
564 nmdc:mga0yw44_192929_c1 3300050492 Bacteria 1344
565 nmdc:mga0yw44_32704_c1 3300050492 Bacteria 3033
566 nmdc:mga0yw44_3391_c1 3300050492 Bacteria 7072
567 nmdc:mga0yw44_34121_c1 3300050492 Bacteria 2979
568 nmdc:mga0yw44_947_c1 3300050492 Bacteria 11013
569 nmdc:mga06z11_15531_c1 3300050494 Bacteria 2320
570 nmdc:mga06z11_273931_c1 3300050494 Bacteria 998
571 nmdc:mga06z11_3823_c1 3300050494 Bacteria 5864
572 nmdc:mga07m45_124233_c1 3300050496 Bacteria 1492
573 nmdc:mga07m45_12857_c1 3300050496 Bacteria 4428
574 nmdc:mga07m45_1930_c1 3300050496 Bacteria 6915
575 nmdc:mga07m45_6606_c1 3300050496 Bacteria 5878
576 nmdc:mga05p37_26824_c1 3300050507 Bacteria 7008
577 nmdc:mga0qj67_111112_c1 3300050509 Bacteria 2213
578 nmdc:mga0qj67_1960_c1 3300050509 Bacteria 14659
579 nmdc:mga06r32_900817_c1 3300050510 Bacteria 841
580 nmdc:mga06r32_9678_c1 3300050510 Bacteria 8707
581 nmdc:mga0n895_2218_c1 3300050512 Bacteria 15021
582 nmdc:mga0rr50_5511_c1 3300050513 Bacteria 7560
583 nmdc:mga08x19_56423_c1 3300050514 Bacteria 2535
584 nmdc:mga0a205_32366_c2 3300050515 Bacteria 2683
585 nmdc:mga0a205_80048_c1 3300050515 Bacteria 3157
586 nmdc:mga0sz30_10235_c1 3300050516 Bacteria 3590
587 nmdc:mga0sz30_113834_c1 3300050516 Bacteria 1187
588 nmdc:mga0sz30_227_c1 3300050516 Bacteria 21431
589 nmdc:mga0sz30_39313_c1 3300050516 Bacteria 1984
590 nmdc:mga0sz30_8067_c1 3300050516 Bacteria 3967
591 nmdc:mga0sz30_81355_c1 3300050516 Bacteria 1402
592 nmdc:mga0sz30_8704_c1 3300050516 Bacteria 3839
593 Ga0500643_009959 3300053087 Bacteria 3583
594 Ga0500652_007981 3300053131 Bacteria 3502
595 Ga0500559_0113175 3300053136 Bacteria 1258
596 Ga0500568_0082772 3300053139 Bacteria 1217
597 Ga0500627_0008006 3300053158 Bacteria 3725
598 Ga0500627_0014230 3300053158 Bacteria 3042
599 Ga0500645_000035 3300053730 Bacteria 113679
600 Ga0500645_049038 3300053730 Bacteria 1235
601 Ga0466962_0012329 3300061719 Bacteria 4110

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0363908 Ga0395905_0363908_38_775 242
2 3300049581 Ga0501047_0491089 Ga0501047_0491089_44_802 246
3 3300042435 Ga0439434_0048997 Ga0439434_0048997_544_1296 250
4 3300009147 Ga0114129_10305578 Ga0114129_103055783 251
5 3300050510 nmdc:mga06r32_900817_c1 nmdc:mga06r32_900817_c1_58_822 251
6 3300050512 nmdc:mga0n895_2218_c1 nmdc:mga0n895_2218_c1_1742_2506 251
7 3300048908 Ga0496105_0289806 Ga0496105_0289806_401_1180 254
8 3300005338 Ga0068868_100316946 Ga0068868_1003169461 258
9 3300048908 Ga0496105_0436839 Ga0496105_0436839_70_846 258
10 3300048914 Ga0496111_0534301 Ga0496111_0534301_12_788 258
11 3300048920 Ga0496117_0173893 Ga0496117_0173893_364_1140 258
12 3300049590 Ga0501074_0547978 Ga0501074_0547978_29_805 258
13 3300050513 nmdc:mga0rr50_5511_c1 nmdc:mga0rr50_5511_c1_1730_2554 271
14 3300050514 nmdc:mga08x19_56423_c1 nmdc:mga08x19_56423_c1_123_947 271
15 3300050515 nmdc:mga0a205_32366_c2 nmdc:mga0a205_32366_c2_1516_2340 271
16 3300049575 Ga0501039_0057378 Ga0501039_0057378_2040_2927 274
17 3300049577 Ga0501041_0293971 Ga0501041_0293971_51_938 274
18 3300050515 nmdc:mga0a205_80048_c1 nmdc:mga0a205_80048_c1_1160_1993 274
19 3300044658 Ga0466972_0194303 Ga0466972_0194303_93_920 275
20 3300044693 Ga0466961_0146832 Ga0466961_0146832_627_1454 275
21 3300053730 Ga0500645_049038 Ga0500645_049038_11_838 275
22 3300005843 Ga0068860_100000023 Ga0068860_100000023259 278
23 3300006852 Ga0075433_10059269 Ga0075433_100592693 278
24 3300006852 Ga0075433_10095027 Ga0075433_100950272 278
25 3300006871 Ga0075434_100003638 Ga0075434_10000363813 278
26 3300006914 Ga0075436_100019263 Ga0075436_1000192634 278
27 3300007076 Ga0075435_100004834 Ga0075435_1000048347 278
28 3300009147 Ga0114129_10160468 Ga0114129_101604682 278
29 3300025949 Ga0207667_10398394 Ga0207667_103983942 278
30 3300028381 Ga0268264_10000008 Ga0268264_100000082 278
31 3300048921 Ga0496118_0174604 Ga0496118_0174604_18_857 279
32 3300006038 Ga0075365_10006913 Ga0075365_100069136 280
33 3300006177 Ga0075362_10100195 Ga0075362_101001952 280
34 3300006178 Ga0075367_10015350 Ga0075367_100153503 280
35 3300009011 Ga0105251_10014636 Ga0105251_100146362 280
36 3300009553 Ga0105249_10075650 Ga0105249_100756503 280
37 3300014968 Ga0157379_10225587 Ga0157379_102255872 280
38 3300048905 Ga0496102_0033688 Ga0496102_0033688_2157_2999 280
39 3300048909 Ga0496106_0042168 Ga0496106_0042168_1195_2037 280
40 3300048910 Ga0496107_0047282 Ga0496107_0047282_1621_2463 280
41 3300048919 Ga0496116_0000773 Ga0496116_0000773_28658_29500 280
42 3300048921 Ga0496118_0009738 Ga0496118_0009738_702_1544 280
43 3300048922 Ga0496119_0022591 Ga0496119_0022591_3234_4076 280
44 3300048922 Ga0496119_0029441 Ga0496119_0029441_12_854 280
45 3300048923 Ga0496120_0001788 Ga0496120_0001788_17502_18344 280
46 3300050489 nmdc:mga03683_100286_c1 nmdc:mga03683_100286_c1_106_1014 280
47 3300050494 nmdc:mga06z11_3823_c1 nmdc:mga06z11_3823_c1_3863_4771 280
48 3300006048 Ga0075363_100005743 Ga0075363_1000057432 281
49 3300006186 Ga0075369_10009003 Ga0075369_100090033 281
50 3300006353 Ga0075370_10004289 Ga0075370_100042895 281
51 3300050490 nmdc:mga03n38_7493_c1 nmdc:mga03n38_7493_c1_2351_3259 281
52 3300050491 nmdc:mga00v17_27394_c1 nmdc:mga00v17_27394_c1_1170_2078 281
53 3300050496 nmdc:mga07m45_6606_c1 nmdc:mga07m45_6606_c1_4088_4996 281
54 3300050516 nmdc:mga0sz30_8067_c1 nmdc:mga0sz30_8067_c1_1500_2408 281
55 iso_pu_bacteria 2818991462 2819689298 281
56 3300049570 Ga0501033_0000422 Ga0501033_0000422_13451_14326 283
57 3300049580 Ga0501046_0000104 Ga0501046_0000104_76446_77321 283
58 3300037418 Ga0395900_0031002 Ga0395900_0031002_4306_5175 284
59 3300037466 Ga0395898_0118833 Ga0395898_0118833_965_1834 284
60 3300038443 Ga0395901_0015044 Ga0395901_0015044_907_1776 284
61 3300048908 Ga0496105_0172770 Ga0496105_0172770_601_1470 284
62 3300005435 Ga0070714_100047988 Ga0070714_1000479882 287
63 3300025929 Ga0207664_10086937 Ga0207664_100869372 287
64 iso_pu_bacteria 2547132424 2548698135 288
65 iso_pu_bacteria 2919713450 2919715672 288
66 iso_pu_bacteria 2873314349 2873314574 291
67 iso_pu_bacteria 2811994874 2812333742 292
68 iso_pu_bacteria 8056207758 8056213061 292
69 3300046455 Ga0495603_0000635 Ga0495603_0000635_17300_18244 293
70 3300046459 Ga0495629_0036054 Ga0495629_0036054_957_1901 293
71 3300046689 Ga0495613_0019936 Ga0495613_0019936_1514_2458 293
72 3300047321 Ga0495676_0001286 Ga0495676_0001286_1503_2447 293
73 3300048089 Ga0495614_0000417 Ga0495614_0000417_1541_2485 293
74 iso_pu_bacteria 2738541305 2738870761 293
75 iso_pu_bacteria 2738543005 2739206923 293
76 iso_pu_bacteria 2811994874 2812331084 293
77 iso_pu_bacteria 2738543005 2739206048 294
78 iso_pu_bacteria 2928142448 2928143823 294
79 3300005841 Ga0068863_100002102 Ga0068863_1000021022 295
80 3300009545 Ga0105237_10001013 Ga0105237_100010134 295
81 3300009545 Ga0105237_10004282 Ga0105237_1000428212 295
82 3300010375 Ga0105239_10000626 Ga0105239_1000062627 295
83 3300010375 Ga0105239_10001157 Ga0105239_100011574 295
84 3300013306 Ga0163162_10535256 Ga0163162_105352561 295
85 3300025914 Ga0207671_10004785 Ga0207671_100047857 295
86 3300025914 Ga0207671_10006971 Ga0207671_100069717 295
87 3300025941 Ga0207711_10000043 Ga0207711_10000043133 295
88 3300026088 Ga0207641_10008714 Ga0207641_100087148 295
89 3300027312 Ga0209371_1014882 Ga0209371_10148822 295
90 3300030500 Ga0268256_1017453 Ga0268256_10174532 295
91 3300048918 Ga0496115_0325556 Ga0496115_0325556_52_939 295
92 3300048929 Ga0496126_0003310 Ga0496126_0003310_12475_13362 295
93 iso_pu_bacteria 2565956761 2566995163 295
94 iso_pu_bacteria 2643221561 2643823696 295
95 iso_pu_bacteria 2643221561 2643824432 295
96 iso_pu_bacteria 2643221696 2644535376 295
97 iso_pu_bacteria 2643221696 2644535771 295
98 iso_pu_bacteria 2751185725 2753036063 295
99 iso_pu_bacteria 2751185792 2753323935 295
100 iso_pu_bacteria 2889300758 2889304707 295
101 iso_pu_bacteria 2891395885 2891398340 295
102 iso_pu_bacteria 2904535858 2904537313 295
103 iso_pu_bacteria 2917736166 2917744593 295
104 iso_pu_bacteria 2922554459 2922559072 295
105 iso_pu_bacteria 8055172936 8055177817 295
106 3300005617 Ga0068859_100036533 Ga0068859_1000365334 296
107 3300005844 Ga0068862_100001398 Ga0068862_10000139818 296
108 3300006931 Ga0097620_100036528 Ga0097620_1000365284 296
109 3300014325 Ga0163163_10187866 Ga0163163_101878663 296
110 3300025735 Ga0207713_1039914 Ga0207713_10399142 296
111 3300025900 Ga0207710_10000292 Ga0207710_1000029229 296
112 3300025900 Ga0207710_10000614 Ga0207710_100006143 296
113 3300025941 Ga0207711_10013490 Ga0207711_100134903 296
114 3300026035 Ga0207703_10000021 Ga0207703_10000021151 296
115 3300028380 Ga0268265_10000276 Ga0268265_1000027618 296
116 3300037466 Ga0395898_0035950 Ga0395898_0035950_1670_2581 296
117 3300038443 Ga0395901_0078462 Ga0395901_0078462_466_1377 296
118 3300050516 nmdc:mga0sz30_8704_c1 nmdc:mga0sz30_8704_c1_581_1471 296
119 iso_pu_bacteria 2547132424 2548696731 296
120 iso_pu_bacteria 2643221692 2644512003 296
121 iso_pu_bacteria 2738543011 2739236118 296
122 iso_pu_bacteria 2744054611 2744953504 296
123 iso_pu_bacteria 2842888712 2842890535 296
124 iso_pu_bacteria 2889300758 2889304486 296
125 iso_pu_bacteria 2939743619 2939745116 296
126 3300005347 Ga0070668_100042563 Ga0070668_1000425634 297
127 3300025972 Ga0207668_10152934 Ga0207668_101529341 297
128 3300048911 Ga0496108_0186417 Ga0496108_0186417_305_1201 297
129 3300003322 rootL2_10227700 rootL2_102277002 298
130 3300005548 Ga0070665_100001909 Ga0070665_1000019095 298
131 3300005841 Ga0068863_100177326 Ga0068863_1001773262 298
132 3300005843 Ga0068860_100022412 Ga0068860_1000224124 298
133 3300014968 Ga0157379_10034528 Ga0157379_100345282 298
134 3300025931 Ga0207644_10003664 Ga0207644_100036645 298
135 3300026088 Ga0207641_10033592 Ga0207641_100335925 298
136 3300028380 Ga0268265_10169373 Ga0268265_101693732 298
137 3300028381 Ga0268264_10015870 Ga0268264_100158704 298
138 3300031251 Ga0265327_10000363 Ga0265327_1000036362 298
139 3300031251 Ga0265327_10019936 Ga0265327_100199365 298
140 3300046531 Ga0495665_0010350 Ga0495665_0010350_966_1877 298
141 3300048903 Ga0496100_0015718 Ga0496100_0015718_120_1019 298
142 3300048904 Ga0496101_0006835 Ga0496101_0006835_3290_4189 298
143 3300048905 Ga0496102_0000102 Ga0496102_0000102_118350_119249 298
144 3300048906 Ga0496103_0000090 Ga0496103_0000090_97759_98658 298
145 3300048908 Ga0496105_0298278 Ga0496105_0298278_85_984 298
146 3300048910 Ga0496107_0037026 Ga0496107_0037026_155_1054 298
147 3300048919 Ga0496116_0000364 Ga0496116_0000364_65752_66651 298
148 3300048920 Ga0496117_0000148 Ga0496117_0000148_62120_63019 298
149 3300048921 Ga0496118_0000042 Ga0496118_0000042_256569_257468 298
150 3300048922 Ga0496119_0006001 Ga0496119_0006001_539_1438 298
151 3300048923 Ga0496120_0027150 Ga0496120_0027150_420_1319 298
152 3300048924 Ga0496121_0019283 Ga0496121_0019283_4505_5404 298
153 3300048927 Ga0496124_0155161 Ga0496124_0155161_370_1269 298
154 3300048929 Ga0496126_0001819 Ga0496126_0001819_30040_30939 298
155 3300049573 Ga0501037_0347697 Ga0501037_0347697_20_928 298
156 3300049581 Ga0501047_0070062 Ga0501047_0070062_1833_2741 298
157 iso_pu_bacteria 2565956761 2566991683 298
158 iso_pu_bacteria 2643221715 2644636773 298
159 iso_pu_bacteria 2738541264 2738667435 298
160 iso_pu_bacteria 2738541274 2738704608 298
161 iso_pu_bacteria 2738541274 2738704616 298
162 iso_pu_bacteria 2738541308 2738887945 298
163 iso_pu_bacteria 2738541356 2739146505 298
164 iso_pu_bacteria 2738543028 2739330900 298
165 iso_pu_bacteria 2738543028 2739330909 298
166 iso_pu_bacteria 2842134933 2842135432 298
167 iso_pu_bacteria 2902792274 2902796374 298
168 iso_pu_bacteria 2902799365 2902802088 298
169 iso_pu_bacteria 2902799365 2902802098 298
170 iso_pu_bacteria 2902810491 2902816252 298
171 iso_pu_bacteria 2902837492 2902843277 298
172 iso_pu_bacteria 2904535858 2904541190 298
173 iso_pu_bacteria 2904765812 2904770346 298
174 iso_pu_bacteria 2919420072 2919422355 298
175 iso_pu_bacteria 2919432681 2919435392 298
176 iso_pu_bacteria 2922554459 2922560835 298
177 iso_pu_bacteria 2939582691 2939589275 298
178 3300005327 Ga0070658_10012657 Ga0070658_100126575 299
179 3300005455 Ga0070663_100153008 Ga0070663_1001530082 299
180 3300005467 Ga0070706_100225049 Ga0070706_1002250491 299
181 3300005471 Ga0070698_100002017 Ga0070698_10000201719 299
182 3300006048 Ga0075363_100067898 Ga0075363_1000678982 299
183 3300006051 Ga0075364_10237194 Ga0075364_102371941 299
184 3300009148 Ga0105243_10001305 Ga0105243_1000130510 299
185 3300025909 Ga0207705_10038361 Ga0207705_100383613 299
186 3300025910 Ga0207684_10533153 Ga0207684_105331531 299
187 3300025929 Ga0207664_10556386 Ga0207664_105563861 299
188 3300025935 Ga0207709_10006535 Ga0207709_100065356 299
189 3300026067 Ga0207678_10091483 Ga0207678_100914832 299
190 3300031838 Ga0307518_10149744 Ga0307518_101497442 299
191 3300037466 Ga0395898_0037184 Ga0395898_0037184_132_1064 299
192 3300041512 Ga0451853_3273662 Ga0451853_3273662_107_1018 299
193 3300048916 Ga0496113_0100360 Ga0496113_0100360_1065_1985 299
194 3300048928 Ga0496125_0008825 Ga0496125_0008825_6841_7761 299
195 3300049570 Ga0501033_0180899 Ga0501033_0180899_204_1127 299
196 3300049823 Ga0501044_0093610 Ga0501044_0093610_1701_2624 299
197 3300050496 nmdc:mga07m45_124233_c1 nmdc:mga07m45_124233_c1_245_1165 299
198 iso_pu_bacteria 2738543011 2739239616 299
199 iso_pu_bacteria 2939743619 2939744907 299
200 3300006038 Ga0075365_10212250 Ga0075365_102122502 300
201 3300006048 Ga0075363_100088578 Ga0075363_1000885782 300
202 3300006178 Ga0075367_10146986 Ga0075367_101469861 300
203 3300006353 Ga0075370_10021536 Ga0075370_100215362 300
204 3300009148 Ga0105243_10005168 Ga0105243_100051684 300
205 3300021388 Ga0213875_10033637 Ga0213875_100336372 300
206 3300025935 Ga0207709_10002791 Ga0207709_100027919 300
207 3300031251 Ga0265327_10000004 Ga0265327_10000004205 300
208 3300037853 Ga0436364_1229776 Ga0436364_1229776_1215_2120 300
209 3300044683 Ga0466965_0018541 Ga0466965_0018541_969_1871 300
210 3300044901 Ga0466960_0001288 Ga0466960_0001288_7219_8121 300
211 3300046531 Ga0495665_0116817 Ga0495665_0116817_42_947 300
212 3300046616 Ga0495668_0000237 Ga0495668_0000237_21152_22063 300
213 3300046674 Ga0495588_0108794 Ga0495588_0108794_177_1082 300
214 3300047315 Ga0495581_0066506 Ga0495581_0066506_1115_2020 300
215 3300048903 Ga0496100_0001621 Ga0496100_0001621_3142_4044 300
216 3300048904 Ga0496101_0000099 Ga0496101_0000099_3144_4046 300
217 3300048905 Ga0496102_0055076 Ga0496102_0055076_2696_3598 300
218 3300048906 Ga0496103_0000116 Ga0496103_0000116_43272_44174 300
219 3300048909 Ga0496106_0001318 Ga0496106_0001318_3124_4026 300
220 3300048910 Ga0496107_0005035 Ga0496107_0005035_4996_5898 300
221 3300048911 Ga0496108_0001969 Ga0496108_0001969_14340_15242 300
222 3300048911 Ga0496108_0051127 Ga0496108_0051127_1183_2094 300
223 3300048912 Ga0496109_0005213 Ga0496109_0005213_3155_4057 300
224 3300048913 Ga0496110_0000744 Ga0496110_0000744_3157_4059 300
225 3300048914 Ga0496111_0003083 Ga0496111_0003083_3463_4365 300
226 3300048917 Ga0496114_0000116 Ga0496114_0000116_3133_4035 300
227 3300048919 Ga0496116_0012120 Ga0496116_0012120_3336_4238 300
228 3300048920 Ga0496117_0005624 Ga0496117_0005624_11946_12848 300
229 3300048921 Ga0496118_0033733 Ga0496118_0033733_3052_3954 300
230 3300048923 Ga0496120_0014005 Ga0496120_0014005_1331_2233 300
231 3300048924 Ga0496121_0000016 Ga0496121_0000016_374334_375236 300
232 3300048925 Ga0496122_0000284 Ga0496122_0000284_88253_89155 300
233 3300048926 Ga0496123_0029725 Ga0496123_0029725_1928_2830 300
234 3300048927 Ga0496124_0000015 Ga0496124_0000015_3154_4056 300
235 3300048928 Ga0496125_0000021 Ga0496125_0000021_456645_457547 300
236 3300048928 Ga0496125_0019227 Ga0496125_0019227_1200_2111 300
237 3300048929 Ga0496126_0000015 Ga0496126_0000015_456645_457547 300
238 3300048929 Ga0496126_0246681 Ga0496126_0246681_53_964 300
239 3300050490 nmdc:mga03n38_47366_c1 nmdc:mga03n38_47366_c1_171_1082 300
240 3300050494 nmdc:mga06z11_273931_c1 nmdc:mga06z11_273931_c1_44_955 300
241 iso_pu_bacteria 2738541264 2738663953 300
242 iso_pu_bacteria 2738541356 2739143088 300
243 iso_pu_bacteria 2738543005 2739207275 300
244 iso_pu_bacteria 2928142448 2928143441 300
245 3300005367 Ga0070667_100000723 Ga0070667_10000072324 301
246 3300005548 Ga0070665_100033980 Ga0070665_1000339804 301
247 3300005617 Ga0068859_100002020 Ga0068859_10000202015 301
248 3300005841 Ga0068863_100000305 Ga0068863_1000003056 301
249 3300005842 Ga0068858_100005093 Ga0068858_1000050932 301
250 3300005843 Ga0068860_100000287 Ga0068860_1000002876 301
251 3300005844 Ga0068862_100000296 Ga0068862_10000029650 301
252 3300006931 Ga0097620_100002020 Ga0097620_1000020204 301
253 3300009101 Ga0105247_10000134 Ga0105247_100001347 301
254 3300009177 Ga0105248_10000181 Ga0105248_100001817 301
255 3300009553 Ga0105249_10000189 Ga0105249_100001896 301
256 3300014325 Ga0163163_10022198 Ga0163163_100221982 301
257 3300025900 Ga0207710_10000163 Ga0207710_1000016369 301
258 3300025941 Ga0207711_10000228 Ga0207711_100002284 301
259 3300025961 Ga0207712_10000006 Ga0207712_10000006498 301
260 3300025986 Ga0207658_10002342 Ga0207658_1000234210 301
261 3300026035 Ga0207703_10010908 Ga0207703_100109082 301
262 3300026088 Ga0207641_10001160 Ga0207641_100011602 301
263 3300028379 Ga0268266_10126947 Ga0268266_101269472 301
264 3300028380 Ga0268265_10000192 Ga0268265_100001926 301
265 3300028381 Ga0268264_10000339 Ga0268264_100003396 301
266 3300044683 Ga0466965_0039644 Ga0466965_0039644_992_1921 301
267 3300048903 Ga0496100_0122206 Ga0496100_0122206_777_1682 301
268 3300048904 Ga0496101_0048545 Ga0496101_0048545_1925_2830 301
269 3300048905 Ga0496102_0000509 Ga0496102_0000509_36196_37101 301
270 3300048906 Ga0496103_0000215 Ga0496103_0000215_41392_42297 301
271 3300048910 Ga0496107_0016701 Ga0496107_0016701_3621_4526 301
272 3300048917 Ga0496114_0198934 Ga0496114_0198934_354_1259 301
273 3300048919 Ga0496116_0094617 Ga0496116_0094617_305_1210 301
274 3300048920 Ga0496117_0002172 Ga0496117_0002172_5400_6305 301
275 3300048921 Ga0496118_0004013 Ga0496118_0004013_12414_13319 301
276 3300048922 Ga0496119_0003470 Ga0496119_0003470_9944_10849 301
277 3300048923 Ga0496120_0016163 Ga0496120_0016163_3236_4141 301
278 3300048924 Ga0496121_0001422 Ga0496121_0001422_33927_34832 301
279 3300048928 Ga0496125_0020322 Ga0496125_0020322_831_1736 301
280 3300048929 Ga0496126_0005274 Ga0496126_0005274_5355_6260 301
281 3300049587 Ga0501071_0193493 Ga0501071_0193493_507_1427 301
282 iso_pu_bacteria 2928142448 2928146722 301
283 3300001991 JGI24743J22301_10005048 JGI24743J22301_100050482 302
284 3300002077 JGI24744J21845_10003180 JGI24744J21845_100031802 302
285 3300002077 JGI24744J21845_10007364 JGI24744J21845_100073642 302
286 3300003792 Ga0055540_1000057 Ga0055540_1000057124 302
287 3300003792 Ga0055540_1006615 Ga0055540_10066154 302
288 3300005328 Ga0070676_10048013 Ga0070676_100480132 302
289 3300005330 Ga0070690_100204349 Ga0070690_1002043491 302
290 3300005334 Ga0068869_100199301 Ga0068869_1001993012 302
291 3300005336 Ga0070680_100252117 Ga0070680_1002521172 302
292 3300005337 Ga0070682_100008009 Ga0070682_1000080094 302
293 3300005337 Ga0070682_100190760 Ga0070682_1001907602 302
294 3300005343 Ga0070687_100167078 Ga0070687_1001670781 302
295 3300005347 Ga0070668_100002095 Ga0070668_1000020952 302
296 3300005347 Ga0070668_100030630 Ga0070668_1000306303 302
297 3300005347 Ga0070668_100034174 Ga0070668_1000341743 302
298 3300005347 Ga0070668_100248568 Ga0070668_1002485682 302
299 3300005355 Ga0070671_100001518 Ga0070671_1000015182 302
300 3300005356 Ga0070674_100038952 Ga0070674_1000389522 302
301 3300005356 Ga0070674_100241872 Ga0070674_1002418721 302
302 3300005364 Ga0070673_100100056 Ga0070673_1001000562 302
303 3300005367 Ga0070667_100000875 Ga0070667_1000008755 302
304 3300005367 Ga0070667_100005037 Ga0070667_1000050372 302
305 3300005367 Ga0070667_100010043 Ga0070667_1000100436 302
306 3300005367 Ga0070667_100221479 Ga0070667_1002214792 302
307 3300005434 Ga0070709_10113630 Ga0070709_101136302 302
308 3300005434 Ga0070709_10189390 Ga0070709_101893902 302
309 3300005435 Ga0070714_100020878 Ga0070714_1000208782 302
310 3300005435 Ga0070714_100212829 Ga0070714_1002128292 302
311 3300005436 Ga0070713_100424198 Ga0070713_1004241982 302
312 3300005438 Ga0070701_10000189 Ga0070701_1000018918 302
313 3300005439 Ga0070711_100001473 Ga0070711_1000014735 302
314 3300005439 Ga0070711_100018206 Ga0070711_1000182062 302
315 3300005440 Ga0070705_100014479 Ga0070705_1000144791 302
316 3300005441 Ga0070700_100002302 Ga0070700_10000230211 302
317 3300005444 Ga0070694_100029027 Ga0070694_1000290272 302
318 3300005455 Ga0070663_100465125 Ga0070663_1004651251 302
319 3300005456 Ga0070678_100003573 Ga0070678_10000357310 302
320 3300005456 Ga0070678_100198970 Ga0070678_1001989701 302
321 3300005457 Ga0070662_100081125 Ga0070662_1000811252 302
322 3300005459 Ga0068867_100111685 Ga0068867_1001116852 302
323 3300005466 Ga0070685_10071723 Ga0070685_100717232 302
324 3300005539 Ga0068853_100017858 Ga0068853_1000178583 302
325 3300005539 Ga0068853_100246197 Ga0068853_1002461972 302
326 3300005543 Ga0070672_100193027 Ga0070672_1001930272 302
327 3300005545 Ga0070695_100001590 Ga0070695_1000015909 302
328 3300005547 Ga0070693_100006988 Ga0070693_1000069883 302
329 3300005548 Ga0070665_100004795 Ga0070665_1000047959 302
330 3300005548 Ga0070665_100019990 Ga0070665_1000199902 302
331 3300005548 Ga0070665_100066504 Ga0070665_1000665043 302
332 3300005549 Ga0070704_100004448 Ga0070704_1000044487 302
333 3300005549 Ga0070704_100378080 Ga0070704_1003780801 302
334 3300005563 Ga0068855_100076996 Ga0068855_1000769963 302
335 3300005578 Ga0068854_100052285 Ga0068854_1000522852 302
336 3300005578 Ga0068854_100090911 Ga0068854_1000909112 302
337 3300005615 Ga0070702_100050262 Ga0070702_1000502622 302
338 3300005616 Ga0068852_100526449 Ga0068852_1005264492 302
339 3300005617 Ga0068859_100017543 Ga0068859_1000175432 302
340 3300005617 Ga0068859_100218540 Ga0068859_1002185402 302
341 3300005718 Ga0068866_10026118 Ga0068866_100261184 302
342 3300005834 Ga0068851_10054290 Ga0068851_100542902 302
343 3300005842 Ga0068858_100003983 Ga0068858_1000039832 302
344 3300005842 Ga0068858_100046322 Ga0068858_1000463225 302
345 3300005842 Ga0068858_100087082 Ga0068858_1000870822 302
346 3300005843 Ga0068860_100003750 Ga0068860_1000037505 302
347 3300005843 Ga0068860_100077672 Ga0068860_1000776722 302
348 3300005843 Ga0068860_100128026 Ga0068860_1001280263 302
349 3300005844 Ga0068862_100004148 Ga0068862_1000041482 302
350 3300005937 Ga0081455_10042478 Ga0081455_100424785 302
351 3300005937 Ga0081455_10208533 Ga0081455_102085332 302
352 3300006038 Ga0075365_10000556 Ga0075365_100005568 302
353 3300006038 Ga0075365_10029812 Ga0075365_100298123 302
354 3300006038 Ga0075365_10040431 Ga0075365_100404314 302
355 3300006038 Ga0075365_10073949 Ga0075365_100739492 302
356 3300006048 Ga0075363_100000194 Ga0075363_1000001944 302
357 3300006048 Ga0075363_100022185 Ga0075363_1000221852 302
358 3300006048 Ga0075363_100039539 Ga0075363_1000395392 302
359 3300006051 Ga0075364_10000231 Ga0075364_100002316 302
360 3300006051 Ga0075364_10001588 Ga0075364_100015885 302
361 3300006051 Ga0075364_10005515 Ga0075364_100055152 302
362 3300006051 Ga0075364_10008632 Ga0075364_100086326 302
363 3300006051 Ga0075364_10013977 Ga0075364_100139773 302
364 3300006051 Ga0075364_10148405 Ga0075364_101484052 302
365 3300006051 Ga0075364_10248916 Ga0075364_102489162 302
366 3300006173 Ga0070716_100044694 Ga0070716_1000446942 302
367 3300006173 Ga0070716_100082498 Ga0070716_1000824982 302
368 3300006175 Ga0070712_100003572 Ga0070712_1000035725 302
369 3300006175 Ga0070712_100023599 Ga0070712_1000235992 302
370 3300006177 Ga0075362_10122666 Ga0075362_101226662 302
371 3300006177 Ga0075362_10145958 Ga0075362_101459582 302
372 3300006178 Ga0075367_10015197 Ga0075367_100151974 302
373 3300006186 Ga0075369_10003427 Ga0075369_100034272 302
374 3300006186 Ga0075369_10004740 Ga0075369_100047402 302
375 3300006186 Ga0075369_10006710 Ga0075369_100067102 302
376 3300006186 Ga0075369_10032085 Ga0075369_100320852 302
377 3300006186 Ga0075369_10075285 Ga0075369_100752852 302
378 3300006353 Ga0075370_10046207 Ga0075370_100462072 302
379 3300006353 Ga0075370_10107315 Ga0075370_101073152 302
380 3300006844 Ga0075428_100001554 Ga0075428_10000155410 302
381 3300006846 Ga0075430_100003634 Ga0075430_1000036342 302
382 3300006846 Ga0075430_100112451 Ga0075430_1001124512 302
383 3300006847 Ga0075431_100074570 Ga0075431_1000745703 302
384 3300006881 Ga0068865_100034496 Ga0068865_1000344963 302
385 3300006931 Ga0097620_100017544 Ga0097620_1000175442 302
386 3300006931 Ga0097620_100218537 Ga0097620_1002185372 302
387 3300007788 Ga0099795_10070507 Ga0099795_100705071 302
388 3300009092 Ga0105250_10029988 Ga0105250_100299882 302
389 3300009098 Ga0105245_10063941 Ga0105245_100639412 302
390 3300009098 Ga0105245_10408001 Ga0105245_104080012 302
391 3300009101 Ga0105247_10000797 Ga0105247_1000079724 302
392 3300009147 Ga0114129_10035925 Ga0114129_100359253 302
393 3300009148 Ga0105243_10005417 Ga0105243_100054176 302
394 3300009174 Ga0105241_10198389 Ga0105241_101983892 302
395 3300009176 Ga0105242_10000505 Ga0105242_100005056 302
396 3300009177 Ga0105248_10015076 Ga0105248_100150765 302
397 3300009177 Ga0105248_10092287 Ga0105248_100922874 302
398 3300009545 Ga0105237_10002160 Ga0105237_1000216014 302
399 3300009553 Ga0105249_10190602 Ga0105249_101906022 302
400 3300010375 Ga0105239_10031749 Ga0105239_100317495 302
401 3300010375 Ga0105239_10161431 Ga0105239_101614312 302
402 3300010375 Ga0105239_10280109 Ga0105239_102801092 302
403 3300010375 Ga0105239_10517782 Ga0105239_105177822 302
404 3300011119 Ga0105246_10173234 Ga0105246_101732342 302
405 3300013105 Ga0157369_10042531 Ga0157369_100425312 302
406 3300013105 Ga0157369_10230381 Ga0157369_102303812 302
407 3300013296 Ga0157374_10135432 Ga0157374_101354322 302
408 3300013297 Ga0157378_10000302 Ga0157378_1000030257 302
409 3300013297 Ga0157378_10032709 Ga0157378_100327093 302
410 3300013306 Ga0163162_10008140 Ga0163162_1000814011 302
411 3300013306 Ga0163162_10156085 Ga0163162_101560852 302
412 3300013306 Ga0163162_10344276 Ga0163162_103442762 302
413 3300013308 Ga0157375_10005938 Ga0157375_1000593811 302
414 3300013308 Ga0157375_10171318 Ga0157375_101713183 302
415 3300014326 Ga0157380_10003367 Ga0157380_100033676 302
416 3300014745 Ga0157377_10028880 Ga0157377_100288803 302
417 3300014968 Ga0157379_10014856 Ga0157379_100148564 302
418 3300014968 Ga0157379_10198896 Ga0157379_101988962 302
419 3300017792 Ga0163161_10000294 Ga0163161_1000029410 302
420 3300021384 Ga0213876_10027318 Ga0213876_100273184 302
421 3300021388 Ga0213875_10014815 Ga0213875_100148152 302
422 3300025303 Ga0209051_1000075 Ga0209051_100007517 302
423 3300025303 Ga0209051_1009045 Ga0209051_10090452 302
424 3300025885 Ga0207653_10065094 Ga0207653_100650942 302
425 3300025898 Ga0207692_10014424 Ga0207692_100144241 302
426 3300025898 Ga0207692_10097877 Ga0207692_100978772 302
427 3300025899 Ga0207642_10064422 Ga0207642_100644222 302
428 3300025900 Ga0207710_10024150 Ga0207710_100241502 302
429 3300025900 Ga0207710_10095645 Ga0207710_100956451 302
430 3300025901 Ga0207688_10001011 Ga0207688_100010115 302
431 3300025901 Ga0207688_10001349 Ga0207688_1000134913 302
432 3300025903 Ga0207680_10031553 Ga0207680_100315532 302
433 3300025904 Ga0207647_10029068 Ga0207647_100290683 302
434 3300025904 Ga0207647_10033537 Ga0207647_100335373 302
435 3300025905 Ga0207685_10032971 Ga0207685_100329711 302
436 3300025906 Ga0207699_10034658 Ga0207699_100346582 302
437 3300025914 Ga0207671_10035291 Ga0207671_100352912 302
438 3300025914 Ga0207671_10130026 Ga0207671_101300262 302
439 3300025915 Ga0207693_10000441 Ga0207693_1000044122 302
440 3300025915 Ga0207693_10003317 Ga0207693_1000331711 302
441 3300025918 Ga0207662_10201264 Ga0207662_102012642 302
442 3300025927 Ga0207687_10016144 Ga0207687_100161443 302
443 3300025927 Ga0207687_10123747 Ga0207687_101237472 302
444 3300025928 Ga0207700_10404966 Ga0207700_104049662 302
445 3300025929 Ga0207664_10100714 Ga0207664_101007142 302
446 3300025929 Ga0207664_10235637 Ga0207664_102356372 302
447 3300025931 Ga0207644_10019916 Ga0207644_100199163 302
448 3300025933 Ga0207706_10007290 Ga0207706_100072909 302
449 3300025933 Ga0207706_10026745 Ga0207706_100267452 302
450 3300025935 Ga0207709_10024191 Ga0207709_100241912 302
451 3300025937 Ga0207669_10017808 Ga0207669_100178082 302
452 3300025937 Ga0207669_10113731 Ga0207669_101137312 302
453 3300025938 Ga0207704_10025436 Ga0207704_100254363 302
454 3300025939 Ga0207665_10023426 Ga0207665_100234262 302
455 3300025939 Ga0207665_10227696 Ga0207665_102276961 302
456 3300025940 Ga0207691_10194606 Ga0207691_101946062 302
457 3300025941 Ga0207711_10041802 Ga0207711_100418023 302
458 3300025942 Ga0207689_10030924 Ga0207689_100309245 302
459 3300025949 Ga0207667_10157903 Ga0207667_101579032 302
460 3300025960 Ga0207651_10115181 Ga0207651_101151812 302
461 3300025961 Ga0207712_10017821 Ga0207712_100178213 302
462 3300025972 Ga0207668_10029135 Ga0207668_100291353 302
463 3300025972 Ga0207668_10032903 Ga0207668_100329032 302
464 3300025972 Ga0207668_10397015 Ga0207668_103970152 302
465 3300025986 Ga0207658_10001732 Ga0207658_100017328 302
466 3300025986 Ga0207658_10006674 Ga0207658_100066744 302
467 3300025986 Ga0207658_10035671 Ga0207658_100356712 302
468 3300026023 Ga0207677_10032601 Ga0207677_100326012 302
469 3300026035 Ga0207703_10030013 Ga0207703_100300134 302
470 3300026035 Ga0207703_10116642 Ga0207703_101166421 302
471 3300026041 Ga0207639_10009957 Ga0207639_100099573 302
472 3300026041 Ga0207639_10228546 Ga0207639_102285462 302
473 3300026067 Ga0207678_10009087 Ga0207678_100090873 302
474 3300026067 Ga0207678_10033853 Ga0207678_100338534 302
475 3300026075 Ga0207708_10003545 Ga0207708_1000354513 302
476 3300026088 Ga0207641_10576217 Ga0207641_105762171 302
477 3300026089 Ga0207648_10001766 Ga0207648_100017665 302
478 3300026089 Ga0207648_10112535 Ga0207648_101125352 302
479 3300026095 Ga0207676_10326587 Ga0207676_103265871 302
480 3300026118 Ga0207675_100000532 Ga0207675_10000053220 302
481 3300026118 Ga0207675_100010969 Ga0207675_1000109699 302
482 3300026118 Ga0207675_100124883 Ga0207675_1001248832 302
483 3300026121 Ga0207683_10000474 Ga0207683_1000047426 302
484 3300026142 Ga0207698_10241242 Ga0207698_102412422 302
485 3300026142 Ga0207698_10261325 Ga0207698_102613252 302
486 3300028379 Ga0268266_10002871 Ga0268266_1000287111 302
487 3300028379 Ga0268266_10057334 Ga0268266_100573343 302
488 3300028381 Ga0268264_10014172 Ga0268264_100141725 302
489 3300031251 Ga0265327_10002825 Ga0265327_100028254 302
490 3300031852 Ga0307410_10032324 Ga0307410_100323242 302
491 3300031852 Ga0307410_10200032 Ga0307410_102000322 302
492 3300031901 Ga0307406_10051168 Ga0307406_100511682 302
493 3300031901 Ga0307406_10193111 Ga0307406_101931112 302
494 3300031903 Ga0307407_10082044 Ga0307407_100820442 302
495 3300031911 Ga0307412_10325979 Ga0307412_103259792 302
496 3300031995 Ga0307409_100004944 Ga0307409_1000049448 302
497 3300032002 Ga0307416_100038803 Ga0307416_1000388034 302
498 3300032005 Ga0307411_10301757 Ga0307411_103017572 302
499 3300032126 Ga0307415_100188783 Ga0307415_1001887832 302
500 3300035090 Ga0373949_0004947 Ga0373949_0004947_85_1014 302
501 3300036712 Ga0316584_0018128 Ga0316584_0018128_1450_2358 302
502 3300037853 Ga0436364_0157880 Ga0436364_0157880_5144_6052 302
503 3300037853 Ga0436364_0848265 Ga0436364_0848265_49_969 302
504 3300039437 Ga0436365_0246124 Ga0436365_0246124_50286_51194 302
505 3300039437 Ga0436365_0560586 Ga0436365_0560586_285_1205 302
506 3300039437 Ga0436365_1111259 Ga0436365_1111259_1571_2485 302
507 3300041411 Ga0439466_0001043 Ga0439466_0001043_6306_7214 302
508 3300041411 Ga0439466_0005026 Ga0439466_0005026_1785_2693 302
509 3300041411 Ga0439466_0017265 Ga0439466_0017265_1250_2158 302
510 3300041413 Ga0439465_0000229 Ga0439465_0000229_11661_12569 302
511 3300041413 Ga0439465_0002796 Ga0439465_0002796_3401_4309 302
512 3300041413 Ga0439465_0011612 Ga0439465_0011612_51_959 302
513 3300041997 Ga0439431_0002101 Ga0439431_0002101_2930_3838 302
514 3300042002 Ga0439442_001213 Ga0439442_001213_2826_3734 302
515 3300042005 Ga0439448_0005972 Ga0439448_0005972_1924_2832 302
516 3300044658 Ga0466972_0022620 Ga0466972_0022620_2166_3074 302
517 3300044658 Ga0466972_0044816 Ga0466972_0044816_1194_2102 302
518 3300044683 Ga0466965_0001714 Ga0466965_0001714_469_1377 302
519 3300044683 Ga0466965_0005404 Ga0466965_0005404_4373_5281 302
520 3300044684 Ga0466966_0018248 Ga0466966_0018248_2765_3673 302
521 3300044684 Ga0466966_0187620 Ga0466966_0187620_285_1193 302
522 3300044693 Ga0466961_0012209 Ga0466961_0012209_1723_2631 302
523 3300044694 Ga0466963_0047907 Ga0466963_0047907_308_1219 302
524 3300044694 Ga0466963_0099325 Ga0466963_0099325_331_1239 302
525 3300044694 Ga0466963_0209930 Ga0466963_0209930_334_1254 302
526 3300044719 Ga0466971_0021833 Ga0466971_0021833_388_1296 302
527 3300044719 Ga0466971_0131902 Ga0466971_0131902_53_964 302
528 3300044735 Ga0466968_0005238 Ga0466968_0005238_177_1091 302
529 3300044735 Ga0466968_0079886 Ga0466968_0079886_504_1412 302
530 3300044842 Ga0466957_0005244 Ga0466957_0005244_1415_2323 302
531 3300044842 Ga0466957_0076983 Ga0466957_0076983_686_1597 302
532 3300044901 Ga0466960_0015609 Ga0466960_0015609_136_1047 302
533 3300045049 Ga0466959_0015175 Ga0466959_0015175_4166_5074 302
534 3300045049 Ga0466959_0022218 Ga0466959_0022218_3513_4427 302
535 3300045049 Ga0466959_0068946 Ga0466959_0068946_215_1123 302
536 3300045836 Ga0466958_0001440 Ga0466958_0001440_8235_9143 302
537 3300045836 Ga0466958_0005494 Ga0466958_0005494_32_940 302
538 3300045976 Ga0466967_0079043 Ga0466967_0079043_83_991 302
539 3300045976 Ga0466967_0139427 Ga0466967_0139427_404_1315 302
540 3300045976 Ga0466967_0213283 Ga0466967_0213283_148_1056 302
541 3300046460 Ga0495638_0005992 Ga0495638_0005992_2843_3751 302
542 3300046460 Ga0495638_0022027 Ga0495638_0022027_3098_4006 302
543 3300047320 Ga0495672_0007294 Ga0495672_0007294_899_1807 302
544 3300048903 Ga0496100_0000009 Ga0496100_0000009_126893_127801 302
545 3300048903 Ga0496100_0004371 Ga0496100_0004371_3554_4462 302
546 3300048903 Ga0496100_0005328 Ga0496100_0005328_4799_5707 302
547 3300048903 Ga0496100_0008313 Ga0496100_0008313_180_1088 302
548 3300048903 Ga0496100_0152908 Ga0496100_0152908_153_1061 302
549 3300048903 Ga0496100_0162809 Ga0496100_0162809_293_1201 302
550 3300048904 Ga0496101_0000018 Ga0496101_0000018_188634_189542 302
551 3300048904 Ga0496101_0000333 Ga0496101_0000333_8319_9227 302
552 3300048904 Ga0496101_0008486 Ga0496101_0008486_1399_2307 302
553 3300048904 Ga0496101_0013378 Ga0496101_0013378_2655_3563 302
554 3300048905 Ga0496102_0000056 Ga0496102_0000056_150176_151084 302
555 3300048905 Ga0496102_0003699 Ga0496102_0003699_51_959 302
556 3300048905 Ga0496102_0116255 Ga0496102_0116255_1278_2186 302
557 3300048905 Ga0496102_0150092 Ga0496102_0150092_205_1113 302
558 3300048905 Ga0496102_0236313 Ga0496102_0236313_354_1262 302
559 3300048906 Ga0496103_0000040 Ga0496103_0000040_21607_22515 302
560 3300048906 Ga0496103_0000666 Ga0496103_0000666_24570_25478 302
561 3300048906 Ga0496103_0081702 Ga0496103_0081702_580_1509 302
562 3300048907 Ga0496104_0005495 Ga0496104_0005495_4358_5266 302
563 3300048908 Ga0496105_0016138 Ga0496105_0016138_74_982 302
564 3300048908 Ga0496105_0079816 Ga0496105_0079816_487_1395 302
565 3300048909 Ga0496106_0000522 Ga0496106_0000522_24348_25256 302
566 3300048909 Ga0496106_0007583 Ga0496106_0007583_332_1240 302
567 3300048909 Ga0496106_0009318 Ga0496106_0009318_959_1867 302
568 3300048909 Ga0496106_0015689 Ga0496106_0015689_3506_4414 302
569 3300048909 Ga0496106_0071977 Ga0496106_0071977_212_1141 302
570 3300048910 Ga0496107_0002302 Ga0496107_0002302_9199_10107 302
571 3300048910 Ga0496107_0007957 Ga0496107_0007957_4452_5360 302
572 3300048910 Ga0496107_0020492 Ga0496107_0020492_2458_3366 302
573 3300048910 Ga0496107_0027130 Ga0496107_0027130_2018_2926 302
574 3300048910 Ga0496107_0079251 Ga0496107_0079251_1038_1967 302
575 3300048911 Ga0496108_0011618 Ga0496108_0011618_5465_6394 302
576 3300048911 Ga0496108_0020335 Ga0496108_0020335_211_1119 302
577 3300048912 Ga0496109_0000136 Ga0496109_0000136_65613_66521 302
578 3300048912 Ga0496109_0013726 Ga0496109_0013726_3348_4277 302
579 3300048913 Ga0496110_0000204 Ga0496110_0000204_713_1621 302
580 3300048913 Ga0496110_0066544 Ga0496110_0066544_1157_2086 302
581 3300048914 Ga0496111_0013455 Ga0496111_0013455_3427_4335 302
582 3300048914 Ga0496111_0244997 Ga0496111_0244997_142_1050 302
583 3300048915 Ga0496112_0073074 Ga0496112_0073074_2202_3110 302
584 3300048916 Ga0496113_0025972 Ga0496113_0025972_629_1537 302
585 3300048916 Ga0496113_0123295 Ga0496113_0123295_773_1702 302
586 3300048917 Ga0496114_0000781 Ga0496114_0000781_9121_10029 302
587 3300048917 Ga0496114_0001503 Ga0496114_0001503_12578_13486 302
588 3300048917 Ga0496114_0026468 Ga0496114_0026468_3748_4656 302
589 3300048918 Ga0496115_0013794 Ga0496115_0013794_4001_4909 302
590 3300048918 Ga0496115_0018414 Ga0496115_0018414_595_1503 302
591 3300048919 Ga0496116_0000056 Ga0496116_0000056_21624_22532 302
592 3300048919 Ga0496116_0000720 Ga0496116_0000720_26883_27791 302
593 3300048920 Ga0496117_0000003 Ga0496117_0000003_1858566_1859474 302
594 3300048920 Ga0496117_0078422 Ga0496117_0078422_1222_2130 302
595 3300048920 Ga0496117_0103556 Ga0496117_0103556_835_1743 302
596 3300048921 Ga0496118_0000001 Ga0496118_0000001_1858569_1859477 302
597 3300048921 Ga0496118_0001419 Ga0496118_0001419_23705_24613 302
598 3300048921 Ga0496118_0001817 Ga0496118_0001817_26331_27239 302
599 3300048921 Ga0496118_0018820 Ga0496118_0018820_361_1281 302
600 3300048921 Ga0496118_0074698 Ga0496118_0074698_834_1742 302
601 3300048922 Ga0496119_0000263 Ga0496119_0000263_3367_4275 302
602 3300048922 Ga0496119_0099044 Ga0496119_0099044_23_931 302
603 3300048923 Ga0496120_0000318 Ga0496120_0000318_75491_76399 302
604 3300048923 Ga0496120_0033872 Ga0496120_0033872_1612_2520 302
605 3300048924 Ga0496121_0000023 Ga0496121_0000023_263963_264871 302
606 3300048924 Ga0496121_0000121 Ga0496121_0000121_21625_22533 302
607 3300048925 Ga0496122_0000038 Ga0496122_0000038_263963_264871 302
608 3300048925 Ga0496122_0003651 Ga0496122_0003651_2538_3446 302
609 3300048926 Ga0496123_0005397 Ga0496123_0005397_11234_12142 302
610 3300048926 Ga0496123_0007347 Ga0496123_0007347_5553_6461 302
611 3300048927 Ga0496124_0000014 Ga0496124_0000014_263963_264871 302
612 3300048928 Ga0496125_0000020 Ga0496125_0000020_198578_199486 302
613 3300048928 Ga0496125_0104838 Ga0496125_0104838_1020_1931 302
614 3300048929 Ga0496126_0000023 Ga0496126_0000023_263963_264871 302
615 3300048929 Ga0496126_0001128 Ga0496126_0001128_21008_21916 302
616 3300048929 Ga0496126_0002192 Ga0496126_0002192_19450_20358 302
617 3300048929 Ga0496126_0050884 Ga0496126_0050884_325_1233 302
618 3300048929 Ga0496126_0054571 Ga0496126_0054571_1549_2460 302
619 3300049570 Ga0501033_0022206 Ga0501033_0022206_3111_4019 302
620 3300049570 Ga0501033_0247978 Ga0501033_0247978_295_1203 302
621 3300049571 Ga0501034_0006769 Ga0501034_0006769_7427_8335 302
622 3300049573 Ga0501037_0031554 Ga0501037_0031554_1705_2613 302
623 3300049581 Ga0501047_0013512 Ga0501047_0013512_3276_4184 302
624 3300049582 Ga0501048_0028520 Ga0501048_0028520_1674_2582 302
625 3300049586 Ga0501070_0005540 Ga0501070_0005540_5732_6640 302
626 3300049822 Ga0501035_0025498 Ga0501035_0025498_2116_3024 302
627 3300049822 Ga0501035_0173350 Ga0501035_0173350_411_1319 302
628 3300049823 Ga0501044_0009965 Ga0501044_0009965_6892_7800 302
629 3300050490 nmdc:mga03n38_1104_c1 nmdc:mga03n38_1104_c1_3754_4662 302
630 3300050490 nmdc:mga03n38_207795_c1 nmdc:mga03n38_207795_c1_83_991 302
631 3300050490 nmdc:mga03n38_3072_c1 nmdc:mga03n38_3072_c1_3355_4263 302
632 3300050490 nmdc:mga03n38_6608_c1 nmdc:mga03n38_6608_c1_2334_3242 302
633 3300050490 nmdc:mga03n38_66230_c1 nmdc:mga03n38_66230_c1_201_1109 302
634 3300050491 nmdc:mga00v17_25954_c1 nmdc:mga00v17_25954_c1_2004_2912 302
635 3300050491 nmdc:mga00v17_55471_c1 nmdc:mga00v17_55471_c1_343_1251 302
636 3300050492 nmdc:mga0yw44_192929_c1 nmdc:mga0yw44_192929_c1_136_1044 302
637 3300050492 nmdc:mga0yw44_32704_c1 nmdc:mga0yw44_32704_c1_2060_2968 302
638 3300050492 nmdc:mga0yw44_3391_c1 nmdc:mga0yw44_3391_c1_4868_5776 302
639 3300050492 nmdc:mga0yw44_34121_c1 nmdc:mga0yw44_34121_c1_1341_2249 302
640 3300050492 nmdc:mga0yw44_947_c1 nmdc:mga0yw44_947_c1_9713_10621 302
641 3300050494 nmdc:mga06z11_15531_c1 nmdc:mga06z11_15531_c1_1081_1989 302
642 3300050496 nmdc:mga07m45_12857_c1 nmdc:mga07m45_12857_c1_1073_1981 302
643 3300050496 nmdc:mga07m45_1930_c1 nmdc:mga07m45_1930_c1_2082_2990 302
644 3300050507 nmdc:mga05p37_26824_c1 nmdc:mga05p37_26824_c1_4251_5159 302
645 3300050509 nmdc:mga0qj67_111112_c1 nmdc:mga0qj67_111112_c1_1291_2199 302
646 3300050509 nmdc:mga0qj67_1960_c1 nmdc:mga0qj67_1960_c1_9185_10093 302
647 3300050510 nmdc:mga06r32_9678_c1 nmdc:mga06r32_9678_c1_2118_3026 302
648 3300050516 nmdc:mga0sz30_10235_c1 nmdc:mga0sz30_10235_c1_456_1364 302
649 3300050516 nmdc:mga0sz30_113834_c1 nmdc:mga0sz30_113834_c1_259_1167 302
650 3300050516 nmdc:mga0sz30_227_c1 nmdc:mga0sz30_227_c1_1462_2370 302
651 3300050516 nmdc:mga0sz30_39313_c1 nmdc:mga0sz30_39313_c1_21_929 302
652 3300050516 nmdc:mga0sz30_81355_c1 nmdc:mga0sz30_81355_c1_275_1183 302
653 3300053087 Ga0500643_009959 Ga0500643_009959_1342_2250 302
654 3300053131 Ga0500652_007981 Ga0500652_007981_1446_2354 302
655 3300053136 Ga0500559_0113175 Ga0500559_0113175_160_1068 302
656 3300053139 Ga0500568_0082772 Ga0500568_0082772_236_1144 302
657 3300053158 Ga0500627_0008006 Ga0500627_0008006_2089_2997 302
658 3300053158 Ga0500627_0014230 Ga0500627_0014230_1242_2150 302
659 3300053730 Ga0500645_000035 Ga0500645_000035_81721_82653 302
660 3300053730 Ga0500645_000035 Ga0500645_000035_88802_89713 302
661 3300061719 Ga0466962_0012329 Ga0466962_0012329_999_1907 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22632

BphC_D1

Dihydroxybiphenyl dioxygenase BphC D1

23

73

0.99

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

159

282

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zi8-assembly1.cif.gz_A crystal structure of the hsac extradiol dioxygenase from m. tuberculosis in complex with 3,4-dihydroxy-9,10-seconandrost-1,3,5(10)-triene-9,17-dione (dhsa) 0.9615 1 292
6l3w-assembly1.cif.gz_A crystal structure of bphc, a halotolerant catechol dioxygenase 0.9393 4 299
1kmy-assembly1.cif.gz_A crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with 2,3-dihydroxybiphenyl under anaerobic condition 0.9381 4 293
1dhy-assembly1.cif.gz_A kks102 bphc enzyme 0.9374 4 292
2wl9-assembly1.cif.gz_D crystal structure of catechol 2,3-dioxygenase 0.9364 2 294
ID Description Score Start End Superfamily
af_P9WNW7_1_130_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.972 1 129 3.10.180.10
af_P9WNW7_1_130_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9574 1 129 3.10.180.10
2zyqB02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9428 135 291 3.10.180.10
1hanA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9322 136 292 3.10.180.10
1eilA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.931 7 130 3.10.180.10
ID Description Score Start End GO Terms
AF-V7JIJ6-F1-model_v4 deleted 0.9983 1 301
AF-A0A2S9FBA0-F1-model_v4 2,3-dihydroxybiphenyl 1,2-dioxygenase 0.9958 63 301 GO:0051213
AF-A0A7X5ZE51-F1-model_v4 2,3-dihydroxybiphenyl 1,2-dioxygenase 0.9951 1 301 GO:0005506
GO:0042178
GO:0051213
AF-V7JIJ6-F1-model_v4 deleted 0.995 1 301
AF-A0A1V3XAP6-F1-model_v4 Glyoxalase/Bleomycin resistance /Dioxygenase superfamily protein 0.9923 211 292 GO:0008198
GO:0009056
GO:0051213

Feature Viewer

pLDDT pTM Quality
94.92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map