F473394
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 661 | 292 | 601 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10001305|Ga0105243_1000130510 |
| Length | 322 |
| Sequence | MIETTLTRAAEGLVENMSDIRSLGYLKVQTQDVDRWRGLVVDGLGMAVGSGPDEDGLYLRIDERRSRLQVLPGEVDKVLAVGWEVRDQFALRAVHDELEKAGVEVRELSQGEADQRDVERVITFADPAGTTVEVFFGPVLDHSPVVTPHGGRFVTGPAGLGHVVLPTPHFQETYDFYTEVLGFLPRGAMRLGGPGAPGPALRVRFLGVNQRHHSLAICPAPPSEAPGMVHLMMEVDTLDAVGQALDRVGKLGFSISSTLGRHTNDKMVSFYVRAPGGWDLEFGTEGMLVDETHYTAEEITADSYWGHDWSGSEPLAAFTPES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 3 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 4 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 5 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 6 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 7 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 8 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 9 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 10 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 11 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 12 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 13 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 14 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 15 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 16 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 17 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 18 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 19 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 20 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 21 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 22 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 23 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 24 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 25 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 26 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 27 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 28 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 29 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 30 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 31 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 32 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 33 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 34 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 35 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 36 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 37 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 38 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 39 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 40 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 41 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 42 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 201 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 204 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 205 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 206 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 207 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 238 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 247 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 253 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 254 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 255 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 271 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 272 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 285 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 286 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 287 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 288 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 290 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 291 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 292 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.07 |
| Metatranscriptomes | 0 |
| Isolates | 8.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.95 |
| Nodule | 0.15 |
| Rhizoplane | 12.25 |
| Rhizosphere | 57.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10005048 | 3300001991 | Bacteria | 2184 |
| 2 | JGI24744J21845_10003180 | 3300002077 | Bacteria | 3369 |
| 3 | JGI24744J21845_10007364 | 3300002077 | Bacteria | 2273 |
| 4 | rootL2_10227700 | 3300003322 | Bacteria | 3218 |
| 5 | Ga0055540_1000057 | 3300003792 | Bacteria | 136356 |
| 6 | Ga0055540_1006615 | 3300003792 | Bacteria | 4555 |
| 7 | Ga0070658_10012657 | 3300005327 | Bacteria | 6766 |
| 8 | Ga0070676_10048013 | 3300005328 | Bacteria | 2495 |
| 9 | Ga0070690_100204349 | 3300005330 | Bacteria | 1376 |
| 10 | Ga0068869_100199301 | 3300005334 | Bacteria | 1578 |
| 11 | Ga0070680_100252117 | 3300005336 | Bacteria | 1492 |
| 12 | Ga0070682_100008009 | 3300005337 | Bacteria | 5949 |
| 13 | Ga0070682_100190760 | 3300005337 | Bacteria | 1439 |
| 14 | Ga0068868_100316946 | 3300005338 | Bacteria | 1328 |
| 15 | Ga0070687_100167078 | 3300005343 | Bacteria | 1306 |
| 16 | Ga0070668_100002095 | 3300005347 | Bacteria | 14582 |
| 17 | Ga0070668_100030630 | 3300005347 | Bacteria | 4092 |
| 18 | Ga0070668_100034174 | 3300005347 | Bacteria | 3874 |
| 19 | Ga0070668_100042563 | 3300005347 | Bacteria | 3481 |
| 20 | Ga0070668_100248568 | 3300005347 | Bacteria | 1476 |
| 21 | Ga0070671_100001518 | 3300005355 | Bacteria | 17405 |
| 22 | Ga0070674_100038952 | 3300005356 | Bacteria | 3207 |
| 23 | Ga0070674_100241872 | 3300005356 | Bacteria | 1413 |
| 24 | Ga0070673_100100056 | 3300005364 | Bacteria | 2386 |
| 25 | Ga0070667_100000723 | 3300005367 | Bacteria | 31728 |
| 26 | Ga0070667_100000875 | 3300005367 | Bacteria | 27853 |
| 27 | Ga0070667_100005037 | 3300005367 | Bacteria | 11056 |
| 28 | Ga0070667_100010043 | 3300005367 | Bacteria | 7845 |
| 29 | Ga0070667_100221479 | 3300005367 | Bacteria | 1684 |
| 30 | Ga0070709_10113630 | 3300005434 | Bacteria | 1824 |
| 31 | Ga0070709_10189390 | 3300005434 | Bacteria | 1450 |
| 32 | Ga0070714_100020878 | 3300005435 | Bacteria | 5354 |
| 33 | Ga0070714_100047988 | 3300005435 | Bacteria | 3630 |
| 34 | Ga0070714_100212829 | 3300005435 | Bacteria | 1772 |
| 35 | Ga0070713_100424198 | 3300005436 | Bacteria | 1245 |
| 36 | Ga0070701_10000189 | 3300005438 | Bacteria | 19148 |
| 37 | Ga0070711_100001473 | 3300005439 | Bacteria | 12936 |
| 38 | Ga0070711_100018206 | 3300005439 | Bacteria | 4481 |
| 39 | Ga0070705_100014479 | 3300005440 | Bacteria | 4058 |
| 40 | Ga0070700_100002302 | 3300005441 | Bacteria | 9718 |
| 41 | Ga0070694_100029027 | 3300005444 | Bacteria | 3607 |
| 42 | Ga0070663_100153008 | 3300005455 | Bacteria | 1770 |
| 43 | Ga0070663_100465125 | 3300005455 | Bacteria | 1045 |
| 44 | Ga0070678_100003573 | 3300005456 | Bacteria | 8674 |
| 45 | Ga0070678_100198970 | 3300005456 | Bacteria | 1652 |
| 46 | Ga0070662_100081125 | 3300005457 | Bacteria | 2416 |
| 47 | Ga0068867_100111685 | 3300005459 | Bacteria | 2100 |
| 48 | Ga0070685_10071723 | 3300005466 | Bacteria | 2054 |
| 49 | Ga0070706_100225049 | 3300005467 | Bacteria | 1751 |
| 50 | Ga0070698_100002017 | 3300005471 | Bacteria | 22571 |
| 51 | Ga0068853_100017858 | 3300005539 | Bacteria | 5861 |
| 52 | Ga0068853_100246197 | 3300005539 | Bacteria | 1639 |
| 53 | Ga0070672_100193027 | 3300005543 | Bacteria | 1701 |
| 54 | Ga0070695_100001590 | 3300005545 | Bacteria | 12700 |
| 55 | Ga0070693_100006988 | 3300005547 | Bacteria | 5496 |
| 56 | Ga0070665_100001909 | 3300005548 | Bacteria | 23561 |
| 57 | Ga0070665_100004795 | 3300005548 | Bacteria | 14074 |
| 58 | Ga0070665_100019990 | 3300005548 | Bacteria | 6725 |
| 59 | Ga0070665_100033980 | 3300005548 | Bacteria | 5129 |
| 60 | Ga0070665_100066504 | 3300005548 | Bacteria | 3616 |
| 61 | Ga0070704_100004448 | 3300005549 | Bacteria | 8095 |
| 62 | Ga0070704_100378080 | 3300005549 | Bacteria | 1202 |
| 63 | Ga0068855_100076996 | 3300005563 | Bacteria | 3870 |
| 64 | Ga0068854_100052285 | 3300005578 | Bacteria | 2929 |
| 65 | Ga0068854_100090911 | 3300005578 | Bacteria | 2271 |
| 66 | Ga0070702_100050262 | 3300005615 | Bacteria | 2381 |
| 67 | Ga0068852_100526449 | 3300005616 | Bacteria | 1180 |
| 68 | Ga0068859_100002020 | 3300005617 | Bacteria | 20708 |
| 69 | Ga0068859_100017543 | 3300005617 | Bacteria | 7196 |
| 70 | Ga0068859_100036533 | 3300005617 | Bacteria | 4932 |
| 71 | Ga0068859_100218540 | 3300005617 | Bacteria | 1993 |
| 72 | Ga0068866_10026118 | 3300005718 | Bacteria | 2754 |
| 73 | Ga0068851_10054290 | 3300005834 | Bacteria | 2041 |
| 74 | Ga0068863_100000305 | 3300005841 | Bacteria | 50559 |
| 75 | Ga0068863_100002102 | 3300005841 | Bacteria | 19738 |
| 76 | Ga0068863_100177326 | 3300005841 | Bacteria | 2045 |
| 77 | Ga0068858_100003983 | 3300005842 | Bacteria | 14577 |
| 78 | Ga0068858_100005093 | 3300005842 | Bacteria | 12877 |
| 79 | Ga0068858_100046322 | 3300005842 | Bacteria | 4031 |
| 80 | Ga0068858_100087082 | 3300005842 | Bacteria | 2905 |
| 81 | Ga0068860_100000023 | 3300005843 | Bacteria | 279076 |
| 82 | Ga0068860_100000287 | 3300005843 | Bacteria | 71871 |
| 83 | Ga0068860_100003750 | 3300005843 | Bacteria | 15629 |
| 84 | Ga0068860_100022412 | 3300005843 | Bacteria | 6109 |
| 85 | Ga0068860_100077672 | 3300005843 | Bacteria | 3158 |
| 86 | Ga0068860_100128026 | 3300005843 | Bacteria | 2434 |
| 87 | Ga0068862_100000296 | 3300005844 | Bacteria | 54630 |
| 88 | Ga0068862_100001398 | 3300005844 | Bacteria | 22381 |
| 89 | Ga0068862_100004148 | 3300005844 | Bacteria | 12276 |
| 90 | Ga0081455_10042478 | 3300005937 | Bacteria | 3987 |
| 91 | Ga0081455_10208533 | 3300005937 | Bacteria | 1457 |
| 92 | Ga0075365_10000556 | 3300006038 | Bacteria | 14422 |
| 93 | Ga0075365_10006913 | 3300006038 | Bacteria | 6299 |
| 94 | Ga0075365_10029812 | 3300006038 | Bacteria | 3490 |
| 95 | Ga0075365_10040431 | 3300006038 | Bacteria | 3041 |
| 96 | Ga0075365_10073949 | 3300006038 | Bacteria | 2298 |
| 97 | Ga0075365_10212250 | 3300006038 | Bacteria | 1357 |
| 98 | Ga0075363_100000194 | 3300006048 | Bacteria | 16409 |
| 99 | Ga0075363_100005743 | 3300006048 | Bacteria | 5563 |
| 100 | Ga0075363_100022185 | 3300006048 | Bacteria | 3207 |
| 101 | Ga0075363_100039539 | 3300006048 | Bacteria | 2483 |
| 102 | Ga0075363_100067898 | 3300006048 | Bacteria | 1932 |
| 103 | Ga0075363_100088578 | 3300006048 | Bacteria | 1701 |
| 104 | Ga0075364_10000231 | 3300006051 | Bacteria | 26472 |
| 105 | Ga0075364_10001588 | 3300006051 | Bacteria | 12422 |
| 106 | Ga0075364_10005515 | 3300006051 | Bacteria | 7363 |
| 107 | Ga0075364_10008632 | 3300006051 | Bacteria | 6095 |
| 108 | Ga0075364_10013977 | 3300006051 | Bacteria | 4948 |
| 109 | Ga0075364_10148405 | 3300006051 | Bacteria | 1580 |
| 110 | Ga0075364_10237194 | 3300006051 | Bacteria | 1238 |
| 111 | Ga0075364_10248916 | 3300006051 | Bacteria | 1208 |
| 112 | Ga0070716_100044694 | 3300006173 | Bacteria | 2482 |
| 113 | Ga0070716_100082498 | 3300006173 | Bacteria | 1923 |
| 114 | Ga0070712_100003572 | 3300006175 | Bacteria | 9577 |
| 115 | Ga0070712_100023599 | 3300006175 | Bacteria | 4066 |
| 116 | Ga0075362_10100195 | 3300006177 | Bacteria | 1354 |
| 117 | Ga0075362_10122666 | 3300006177 | Bacteria | 1231 |
| 118 | Ga0075362_10145958 | 3300006177 | Bacteria | 1133 |
| 119 | Ga0075367_10015197 | 3300006178 | Bacteria | 4179 |
| 120 | Ga0075367_10015350 | 3300006178 | Bacteria | 4161 |
| 121 | Ga0075367_10146986 | 3300006178 | Bacteria | 1462 |
| 122 | Ga0075369_10003427 | 3300006186 | Bacteria | 5775 |
| 123 | Ga0075369_10004740 | 3300006186 | Bacteria | 5048 |
| 124 | Ga0075369_10006710 | 3300006186 | Bacteria | 4364 |
| 125 | Ga0075369_10009003 | 3300006186 | Bacteria | 3863 |
| 126 | Ga0075369_10032085 | 3300006186 | Bacteria | 2221 |
| 127 | Ga0075369_10075285 | 3300006186 | Bacteria | 1490 |
| 128 | Ga0075370_10004289 | 3300006353 | Bacteria | 6908 |
| 129 | Ga0075370_10021536 | 3300006353 | Bacteria | 3532 |
| 130 | Ga0075370_10046207 | 3300006353 | Bacteria | 2464 |
| 131 | Ga0075370_10107315 | 3300006353 | Bacteria | 1619 |
| 132 | Ga0075428_100001554 | 3300006844 | Bacteria | 24580 |
| 133 | Ga0075430_100003634 | 3300006846 | Bacteria | 12939 |
| 134 | Ga0075430_100112451 | 3300006846 | Bacteria | 2270 |
| 135 | Ga0075431_100074570 | 3300006847 | Bacteria | 3501 |
| 136 | Ga0075433_10059269 | 3300006852 | Bacteria | 3349 |
| 137 | Ga0075433_10095027 | 3300006852 | Bacteria | 2638 |
| 138 | Ga0075434_100003638 | 3300006871 | Bacteria | 13765 |
| 139 | Ga0068865_100034496 | 3300006881 | Bacteria | 3395 |
| 140 | Ga0075436_100019263 | 3300006914 | Bacteria | 4676 |
| 141 | Ga0097620_100002020 | 3300006931 | Bacteria | 20708 |
| 142 | Ga0097620_100017544 | 3300006931 | Bacteria | 7196 |
| 143 | Ga0097620_100036528 | 3300006931 | Bacteria | 4932 |
| 144 | Ga0097620_100218537 | 3300006931 | Bacteria | 1993 |
| 145 | Ga0075435_100004834 | 3300007076 | Bacteria | 9325 |
| 146 | Ga0099795_10070507 | 3300007788 | Bacteria | 1318 |
| 147 | Ga0105251_10014636 | 3300009011 | Bacteria | 4325 |
| 148 | Ga0105250_10029988 | 3300009092 | Bacteria | 2188 |
| 149 | Ga0105245_10063941 | 3300009098 | Bacteria | 3325 |
| 150 | Ga0105245_10408001 | 3300009098 | Bacteria | 1359 |
| 151 | Ga0105247_10000134 | 3300009101 | Bacteria | 71986 |
| 152 | Ga0105247_10000797 | 3300009101 | Bacteria | 24162 |
| 153 | Ga0114129_10035925 | 3300009147 | Bacteria | 6998 |
| 154 | Ga0114129_10160468 | 3300009147 | Bacteria | 3072 |
| 155 | Ga0114129_10305578 | 3300009147 | Bacteria | 2119 |
| 156 | Ga0105243_10001305 | 3300009148 | Bacteria | 22267 |
| 157 | Ga0105243_10005168 | 3300009148 | Bacteria | 10222 |
| 158 | Ga0105243_10005417 | 3300009148 | Bacteria | 9960 |
| 159 | Ga0105241_10198389 | 3300009174 | Bacteria | 1674 |
| 160 | Ga0105242_10000505 | 3300009176 | Bacteria | 30808 |
| 161 | Ga0105248_10000181 | 3300009177 | Bacteria | 73501 |
| 162 | Ga0105248_10015076 | 3300009177 | Bacteria | 8510 |
| 163 | Ga0105248_10092287 | 3300009177 | Bacteria | 3410 |
| 164 | Ga0105237_10001013 | 3300009545 | Bacteria | 37790 |
| 165 | Ga0105237_10002160 | 3300009545 | Bacteria | 24750 |
| 166 | Ga0105237_10004282 | 3300009545 | Bacteria | 16557 |
| 167 | Ga0105249_10000189 | 3300009553 | Bacteria | 70627 |
| 168 | Ga0105249_10075650 | 3300009553 | Bacteria | 3119 |
| 169 | Ga0105249_10190602 | 3300009553 | Bacteria | 2001 |
| 170 | Ga0105239_10000626 | 3300010375 | Bacteria | 50329 |
| 171 | Ga0105239_10001157 | 3300010375 | Bacteria | 36242 |
| 172 | Ga0105239_10031749 | 3300010375 | Bacteria | 5803 |
| 173 | Ga0105239_10161431 | 3300010375 | Bacteria | 2504 |
| 174 | Ga0105239_10280109 | 3300010375 | Bacteria | 1877 |
| 175 | Ga0105239_10517782 | 3300010375 | Bacteria | 1357 |
| 176 | Ga0105246_10173234 | 3300011119 | Bacteria | 1655 |
| 177 | Ga0157369_10042531 | 3300013105 | Bacteria | 4956 |
| 178 | Ga0157369_10230381 | 3300013105 | Bacteria | 1937 |
| 179 | Ga0157374_10135432 | 3300013296 | Bacteria | 2387 |
| 180 | Ga0157378_10000302 | 3300013297 | Bacteria | 47818 |
| 181 | Ga0157378_10032709 | 3300013297 | Bacteria | 4596 |
| 182 | Ga0163162_10008140 | 3300013306 | Bacteria | 10231 |
| 183 | Ga0163162_10156085 | 3300013306 | Bacteria | 2402 |
| 184 | Ga0163162_10344276 | 3300013306 | Bacteria | 1623 |
| 185 | Ga0163162_10535256 | 3300013306 | Bacteria | 1300 |
| 186 | Ga0157375_10005938 | 3300013308 | Bacteria | 10640 |
| 187 | Ga0157375_10171318 | 3300013308 | Bacteria | 2318 |
| 188 | Ga0163163_10022198 | 3300014325 | Bacteria | 6005 |
| 189 | Ga0163163_10187866 | 3300014325 | Bacteria | 2114 |
| 190 | Ga0157380_10003367 | 3300014326 | Bacteria | 10968 |
| 191 | Ga0157377_10028880 | 3300014745 | Bacteria | 2989 |
| 192 | Ga0157379_10014856 | 3300014968 | Bacteria | 6829 |
| 193 | Ga0157379_10034528 | 3300014968 | Bacteria | 4509 |
| 194 | Ga0157379_10198896 | 3300014968 | Bacteria | 1812 |
| 195 | Ga0157379_10225587 | 3300014968 | Bacteria | 1698 |
| 196 | Ga0163161_10000294 | 3300017792 | Bacteria | 43680 |
| 197 | Ga0213876_10027318 | 3300021384 | Bacteria | 3013 |
| 198 | Ga0213875_10014815 | 3300021388 | Bacteria | 3800 |
| 199 | Ga0213875_10033637 | 3300021388 | Bacteria | 2422 |
| 200 | Ga0209051_1000075 | 3300025303 | Bacteria | 205011 |
| 201 | Ga0209051_1009045 | 3300025303 | Bacteria | 5186 |
| 202 | Ga0207713_1039914 | 3300025735 | Bacteria | 1975 |
| 203 | Ga0207653_10065094 | 3300025885 | Bacteria | 1237 |
| 204 | Ga0207692_10014424 | 3300025898 | Bacteria | 3453 |
| 205 | Ga0207692_10097877 | 3300025898 | Bacteria | 1604 |
| 206 | Ga0207642_10064422 | 3300025899 | Bacteria | 1718 |
| 207 | Ga0207710_10000163 | 3300025900 | Bacteria | 70646 |
| 208 | Ga0207710_10000292 | 3300025900 | Bacteria | 40483 |
| 209 | Ga0207710_10000614 | 3300025900 | Bacteria | 20855 |
| 210 | Ga0207710_10024150 | 3300025900 | Bacteria | 2616 |
| 211 | Ga0207710_10095645 | 3300025900 | Bacteria | 1396 |
| 212 | Ga0207688_10001011 | 3300025901 | Bacteria | 14334 |
| 213 | Ga0207688_10001349 | 3300025901 | Bacteria | 12759 |
| 214 | Ga0207680_10031553 | 3300025903 | Bacteria | 3002 |
| 215 | Ga0207647_10029068 | 3300025904 | Bacteria | 3582 |
| 216 | Ga0207647_10033537 | 3300025904 | Bacteria | 3287 |
| 217 | Ga0207685_10032971 | 3300025905 | Bacteria | 1868 |
| 218 | Ga0207699_10034658 | 3300025906 | Bacteria | 2865 |
| 219 | Ga0207705_10038361 | 3300025909 | Bacteria | 3430 |
| 220 | Ga0207684_10533153 | 3300025910 | Bacteria | 1005 |
| 221 | Ga0207671_10004785 | 3300025914 | Bacteria | 12762 |
| 222 | Ga0207671_10006971 | 3300025914 | Bacteria | 9920 |
| 223 | Ga0207671_10035291 | 3300025914 | Bacteria | 3712 |
| 224 | Ga0207671_10130026 | 3300025914 | Bacteria | 1932 |
| 225 | Ga0207693_10000441 | 3300025915 | Bacteria | 37916 |
| 226 | Ga0207693_10003317 | 3300025915 | Bacteria | 13772 |
| 227 | Ga0207662_10201264 | 3300025918 | Bacteria | 1289 |
| 228 | Ga0207687_10016144 | 3300025927 | Bacteria | 4902 |
| 229 | Ga0207687_10123747 | 3300025927 | Bacteria | 1938 |
| 230 | Ga0207700_10404966 | 3300025928 | Bacteria | 1196 |
| 231 | Ga0207664_10086937 | 3300025929 | Bacteria | 2555 |
| 232 | Ga0207664_10100714 | 3300025929 | Bacteria | 2386 |
| 233 | Ga0207664_10235637 | 3300025929 | Bacteria | 1592 |
| 234 | Ga0207664_10556386 | 3300025929 | Bacteria | 1029 |
| 235 | Ga0207644_10003664 | 3300025931 | Bacteria | 9959 |
| 236 | Ga0207644_10019916 | 3300025931 | Bacteria | 4556 |
| 237 | Ga0207706_10007290 | 3300025933 | Bacteria | 10225 |
| 238 | Ga0207706_10026745 | 3300025933 | Bacteria | 5165 |
| 239 | Ga0207709_10002791 | 3300025935 | Bacteria | 10754 |
| 240 | Ga0207709_10006535 | 3300025935 | Bacteria | 6549 |
| 241 | Ga0207709_10024191 | 3300025935 | Bacteria | 3466 |
| 242 | Ga0207669_10017808 | 3300025937 | Bacteria | 3654 |
| 243 | Ga0207669_10113731 | 3300025937 | Bacteria | 1820 |
| 244 | Ga0207704_10025436 | 3300025938 | Bacteria | 3229 |
| 245 | Ga0207665_10023426 | 3300025939 | Bacteria | 4068 |
| 246 | Ga0207665_10227696 | 3300025939 | Bacteria | 1369 |
| 247 | Ga0207691_10194606 | 3300025940 | Bacteria | 1767 |
| 248 | Ga0207711_10000043 | 3300025941 | Bacteria | 157580 |
| 249 | Ga0207711_10000228 | 3300025941 | Bacteria | 60300 |
| 250 | Ga0207711_10013490 | 3300025941 | Bacteria | 6785 |
| 251 | Ga0207711_10041802 | 3300025941 | Bacteria | 3904 |
| 252 | Ga0207689_10030924 | 3300025942 | Bacteria | 4460 |
| 253 | Ga0207667_10157903 | 3300025949 | Bacteria | 2333 |
| 254 | Ga0207667_10398394 | 3300025949 | Bacteria | 1402 |
| 255 | Ga0207651_10115181 | 3300025960 | Bacteria | 2027 |
| 256 | Ga0207712_10000006 | 3300025961 | Bacteria | 573204 |
| 257 | Ga0207712_10017821 | 3300025961 | Bacteria | 4618 |
| 258 | Ga0207668_10029135 | 3300025972 | Bacteria | 3615 |
| 259 | Ga0207668_10032903 | 3300025972 | Bacteria | 3432 |
| 260 | Ga0207668_10152934 | 3300025972 | Bacteria | 1788 |
| 261 | Ga0207668_10397015 | 3300025972 | Bacteria | 1165 |
| 262 | Ga0207658_10001732 | 3300025986 | Bacteria | 16451 |
| 263 | Ga0207658_10002342 | 3300025986 | Bacteria | 13916 |
| 264 | Ga0207658_10006674 | 3300025986 | Bacteria | 7863 |
| 265 | Ga0207658_10035671 | 3300025986 | Bacteria | 3563 |
| 266 | Ga0207677_10032601 | 3300026023 | Bacteria | 3351 |
| 267 | Ga0207703_10000021 | 3300026035 | Bacteria | 247414 |
| 268 | Ga0207703_10010908 | 3300026035 | Bacteria | 7081 |
| 269 | Ga0207703_10030013 | 3300026035 | Bacteria | 4294 |
| 270 | Ga0207703_10116642 | 3300026035 | Bacteria | 2286 |
| 271 | Ga0207639_10009957 | 3300026041 | Bacteria | 6569 |
| 272 | Ga0207639_10228546 | 3300026041 | Bacteria | 1611 |
| 273 | Ga0207678_10009087 | 3300026067 | Bacteria | 8749 |
| 274 | Ga0207678_10033853 | 3300026067 | Bacteria | 4450 |
| 275 | Ga0207678_10091483 | 3300026067 | Bacteria | 2600 |
| 276 | Ga0207708_10003545 | 3300026075 | Bacteria | 11496 |
| 277 | Ga0207641_10001160 | 3300026088 | Bacteria | 26484 |
| 278 | Ga0207641_10008714 | 3300026088 | Bacteria | 8379 |
| 279 | Ga0207641_10033592 | 3300026088 | Bacteria | 4261 |
| 280 | Ga0207641_10576217 | 3300026088 | Bacteria | 1100 |
| 281 | Ga0207648_10001766 | 3300026089 | Bacteria | 23675 |
| 282 | Ga0207648_10112535 | 3300026089 | Bacteria | 2390 |
| 283 | Ga0207676_10326587 | 3300026095 | Bacteria | 1410 |
| 284 | Ga0207675_100000532 | 3300026118 | Bacteria | 37041 |
| 285 | Ga0207675_100010969 | 3300026118 | Bacteria | 8488 |
| 286 | Ga0207675_100124883 | 3300026118 | Bacteria | 2437 |
| 287 | Ga0207683_10000474 | 3300026121 | Bacteria | 37371 |
| 288 | Ga0207698_10241242 | 3300026142 | Bacteria | 1647 |
| 289 | Ga0207698_10261325 | 3300026142 | Bacteria | 1590 |
| 290 | Ga0209371_1014882 | 3300027312 | Bacteria | 2114 |
| 291 | Ga0268266_10002871 | 3300028379 | Bacteria | 17908 |
| 292 | Ga0268266_10057334 | 3300028379 | Bacteria | 3352 |
| 293 | Ga0268266_10126947 | 3300028379 | Bacteria | 2277 |
| 294 | Ga0268265_10000192 | 3300028380 | Bacteria | 71772 |
| 295 | Ga0268265_10000276 | 3300028380 | Bacteria | 58368 |
| 296 | Ga0268265_10169373 | 3300028380 | Bacteria | 1865 |
| 297 | Ga0268264_10000008 | 3300028381 | Bacteria | 773387 |
| 298 | Ga0268264_10000339 | 3300028381 | Bacteria | 71891 |
| 299 | Ga0268264_10014172 | 3300028381 | Bacteria | 6556 |
| 300 | Ga0268264_10015870 | 3300028381 | Bacteria | 6168 |
| 301 | Ga0268256_1017453 | 3300030500 | Bacteria | 2020 |
| 302 | Ga0265327_10000004 | 3300031251 | Bacteria | 803973 |
| 303 | Ga0265327_10000363 | 3300031251 | Bacteria | 86525 |
| 304 | Ga0265327_10002825 | 3300031251 | Bacteria | 17527 |
| 305 | Ga0265327_10019936 | 3300031251 | Bacteria | 4105 |
| 306 | Ga0307518_10149744 | 3300031838 | Bacteria | 1616 |
| 307 | Ga0307410_10032324 | 3300031852 | Bacteria | 3366 |
| 308 | Ga0307410_10200032 | 3300031852 | Bacteria | 1525 |
| 309 | Ga0307406_10051168 | 3300031901 | Bacteria | 2622 |
| 310 | Ga0307406_10193111 | 3300031901 | Bacteria | 1492 |
| 311 | Ga0307407_10082044 | 3300031903 | Bacteria | 1953 |
| 312 | Ga0307412_10325979 | 3300031911 | Bacteria | 1224 |
| 313 | Ga0307409_100004944 | 3300031995 | Bacteria | 7587 |
| 314 | Ga0307416_100038803 | 3300032002 | Bacteria | 3678 |
| 315 | Ga0307411_10301757 | 3300032005 | Bacteria | 1285 |
| 316 | Ga0307415_100188783 | 3300032126 | Bacteria | 1624 |
| 317 | Ga0373949_0004947 | 3300035090 | Bacteria | 3008 |
| 318 | Ga0316584_0018128 | 3300036712 | Bacteria | 5075 |
| 319 | Ga0395900_0031002 | 3300037418 | Bacteria | 5492 |
| 320 | Ga0395898_0035950 | 3300037466 | Bacteria | 4923 |
| 321 | Ga0395898_0037184 | 3300037466 | Bacteria | 4831 |
| 322 | Ga0395898_0118833 | 3300037466 | Bacteria | 2532 |
| 323 | Ga0395905_0363908 | 3300037471 | Bacteria | 1339 |
| 324 | Ga0436364_0157880 | 3300037853 | Bacteria | 17628 |
| 325 | Ga0436364_0848265 | 3300037853 | Bacteria | 3441 |
| 326 | Ga0436364_1229776 | 3300037853 | Bacteria | 2667 |
| 327 | Ga0395901_0015044 | 3300038443 | Bacteria | 7867 |
| 328 | Ga0395901_0078462 | 3300038443 | Bacteria | 3448 |
| 329 | Ga0436365_0246124 | 3300039437 | Bacteria | 99631 |
| 330 | Ga0436365_0560586 | 3300039437 | Bacteria | 1569 |
| 331 | Ga0436365_1111259 | 3300039437 | Bacteria | 5270 |
| 332 | Ga0439466_0001043 | 3300041411 | Bacteria | 10696 |
| 333 | Ga0439466_0005026 | 3300041411 | Bacteria | 5074 |
| 334 | Ga0439466_0017265 | 3300041411 | Bacteria | 2602 |
| 335 | Ga0439465_0000229 | 3300041413 | Bacteria | 15154 |
| 336 | Ga0439465_0002796 | 3300041413 | Bacteria | 5718 |
| 337 | Ga0439465_0011612 | 3300041413 | Bacteria | 2764 |
| 338 | Ga0451853_3273662 | 3300041512 | Bacteria | 1080 |
| 339 | Ga0439431_0002101 | 3300041997 | Bacteria | 4401 |
| 340 | Ga0439442_001213 | 3300042002 | Bacteria | 5130 |
| 341 | Ga0439448_0005972 | 3300042005 | Bacteria | 3488 |
| 342 | Ga0439434_0048997 | 3300042435 | Bacteria | 1307 |
| 343 | Ga0466972_0022620 | 3300044658 | Bacteria | 3128 |
| 344 | Ga0466972_0044816 | 3300044658 | Bacteria | 2144 |
| 345 | Ga0466972_0194303 | 3300044658 | Bacteria | 951 |
| 346 | Ga0466965_0001714 | 3300044683 | Bacteria | 9014 |
| 347 | Ga0466965_0005404 | 3300044683 | Bacteria | 5757 |
| 348 | Ga0466965_0018541 | 3300044683 | Bacteria | 3337 |
| 349 | Ga0466965_0039644 | 3300044683 | Bacteria | 2316 |
| 350 | Ga0466966_0018248 | 3300044684 | Bacteria | 4629 |
| 351 | Ga0466966_0187620 | 3300044684 | Bacteria | 1253 |
| 352 | Ga0466961_0012209 | 3300044693 | Bacteria | 5492 |
| 353 | Ga0466961_0146832 | 3300044693 | Bacteria | 1474 |
| 354 | Ga0466963_0047907 | 3300044694 | Bacteria | 2822 |
| 355 | Ga0466963_0099325 | 3300044694 | Bacteria | 1991 |
| 356 | Ga0466963_0209930 | 3300044694 | Bacteria | 1362 |
| 357 | Ga0466971_0021833 | 3300044719 | Bacteria | 2849 |
| 358 | Ga0466971_0131902 | 3300044719 | Bacteria | 1160 |
| 359 | Ga0466968_0005238 | 3300044735 | Bacteria | 4857 |
| 360 | Ga0466968_0079886 | 3300044735 | Bacteria | 1435 |
| 361 | Ga0466957_0005244 | 3300044842 | Bacteria | 7257 |
| 362 | Ga0466957_0076983 | 3300044842 | Bacteria | 2072 |
| 363 | Ga0466960_0001288 | 3300044901 | Bacteria | 9099 |
| 364 | Ga0466960_0015609 | 3300044901 | Bacteria | 3277 |
| 365 | Ga0466959_0015175 | 3300045049 | Bacteria | 5611 |
| 366 | Ga0466959_0022218 | 3300045049 | Bacteria | 4687 |
| 367 | Ga0466959_0068946 | 3300045049 | Bacteria | 2562 |
| 368 | Ga0466958_0001440 | 3300045836 | Bacteria | 11285 |
| 369 | Ga0466958_0005494 | 3300045836 | Bacteria | 6835 |
| 370 | Ga0466967_0079043 | 3300045976 | Bacteria | 2964 |
| 371 | Ga0466967_0139427 | 3300045976 | Bacteria | 2257 |
| 372 | Ga0466967_0213283 | 3300045976 | Bacteria | 1832 |
| 373 | Ga0495603_0000635 | 3300046455 | Bacteria | 19745 |
| 374 | Ga0495629_0036054 | 3300046459 | Bacteria | 3493 |
| 375 | Ga0495638_0005992 | 3300046460 | Bacteria | 8911 |
| 376 | Ga0495638_0022027 | 3300046460 | Bacteria | 4188 |
| 377 | Ga0495665_0010350 | 3300046531 | Bacteria | 5048 |
| 378 | Ga0495665_0116817 | 3300046531 | Bacteria | 1397 |
| 379 | Ga0495668_0000237 | 3300046616 | Bacteria | 78532 |
| 380 | Ga0495588_0108794 | 3300046674 | Bacteria | 1459 |
| 381 | Ga0495613_0019936 | 3300046689 | Bacteria | 4998 |
| 382 | Ga0495581_0066506 | 3300047315 | Bacteria | 2084 |
| 383 | Ga0495672_0007294 | 3300047320 | Bacteria | 8340 |
| 384 | Ga0495676_0001286 | 3300047321 | Bacteria | 21528 |
| 385 | Ga0495614_0000417 | 3300048089 | Bacteria | 17451 |
| 386 | Ga0496100_0000009 | 3300048903 | Bacteria | 225785 |
| 387 | Ga0496100_0001621 | 3300048903 | Bacteria | 11129 |
| 388 | Ga0496100_0004371 | 3300048903 | Bacteria | 7484 |
| 389 | Ga0496100_0005328 | 3300048903 | Bacteria | 6914 |
| 390 | Ga0496100_0008313 | 3300048903 | Bacteria | 5786 |
| 391 | Ga0496100_0015718 | 3300048903 | Bacteria | 4424 |
| 392 | Ga0496100_0122206 | 3300048903 | Bacteria | 1823 |
| 393 | Ga0496100_0152908 | 3300048903 | Bacteria | 1648 |
| 394 | Ga0496100_0162809 | 3300048903 | Bacteria | 1601 |
| 395 | Ga0496101_0000018 | 3300048904 | Bacteria | 236102 |
| 396 | Ga0496101_0000099 | 3300048904 | Bacteria | 90235 |
| 397 | Ga0496101_0000333 | 3300048904 | Bacteria | 32315 |
| 398 | Ga0496101_0006835 | 3300048904 | Bacteria | 7363 |
| 399 | Ga0496101_0008486 | 3300048904 | Bacteria | 6714 |
| 400 | Ga0496101_0013378 | 3300048904 | Bacteria | 5494 |
| 401 | Ga0496101_0048545 | 3300048904 | Bacteria | 3051 |
| 402 | Ga0496102_0000056 | 3300048905 | Bacteria | 172707 |
| 403 | Ga0496102_0000102 | 3300048905 | Bacteria | 122251 |
| 404 | Ga0496102_0000509 | 3300048905 | Bacteria | 42554 |
| 405 | Ga0496102_0003699 | 3300048905 | Bacteria | 12932 |
| 406 | Ga0496102_0033688 | 3300048905 | Bacteria | 4605 |
| 407 | Ga0496102_0055076 | 3300048905 | Bacteria | 3627 |
| 408 | Ga0496102_0116255 | 3300048905 | Bacteria | 2496 |
| 409 | Ga0496102_0150092 | 3300048905 | Bacteria | 2189 |
| 410 | Ga0496102_0236313 | 3300048905 | Bacteria | 1723 |
| 411 | Ga0496103_0000040 | 3300048906 | Bacteria | 172148 |
| 412 | Ga0496103_0000090 | 3300048906 | Bacteria | 101941 |
| 413 | Ga0496103_0000116 | 3300048906 | Bacteria | 86969 |
| 414 | Ga0496103_0000215 | 3300048906 | Bacteria | 57372 |
| 415 | Ga0496103_0000666 | 3300048906 | Bacteria | 25814 |
| 416 | Ga0496103_0081702 | 3300048906 | Bacteria | 2033 |
| 417 | Ga0496104_0005495 | 3300048907 | Bacteria | 11098 |
| 418 | Ga0496105_0016138 | 3300048908 | Bacteria | 5957 |
| 419 | Ga0496105_0079816 | 3300048908 | Bacteria | 2702 |
| 420 | Ga0496105_0172770 | 3300048908 | Bacteria | 1771 |
| 421 | Ga0496105_0289806 | 3300048908 | Bacteria | 1318 |
| 422 | Ga0496105_0298278 | 3300048908 | Bacteria | 1296 |
| 423 | Ga0496105_0436839 | 3300048908 | Bacteria | 1035 |
| 424 | Ga0496106_0000522 | 3300048909 | Bacteria | 27324 |
| 425 | Ga0496106_0001318 | 3300048909 | Bacteria | 18610 |
| 426 | Ga0496106_0007583 | 3300048909 | Bacteria | 8027 |
| 427 | Ga0496106_0009318 | 3300048909 | Bacteria | 7258 |
| 428 | Ga0496106_0015689 | 3300048909 | Bacteria | 5604 |
| 429 | Ga0496106_0042168 | 3300048909 | Bacteria | 3422 |
| 430 | Ga0496106_0071977 | 3300048909 | Bacteria | 2643 |
| 431 | Ga0496107_0002302 | 3300048910 | Bacteria | 12325 |
| 432 | Ga0496107_0005035 | 3300048910 | Bacteria | 9005 |
| 433 | Ga0496107_0007957 | 3300048910 | Bacteria | 7316 |
| 434 | Ga0496107_0016701 | 3300048910 | Bacteria | 5160 |
| 435 | Ga0496107_0020492 | 3300048910 | Bacteria | 4671 |
| 436 | Ga0496107_0027130 | 3300048910 | Bacteria | 4066 |
| 437 | Ga0496107_0037026 | 3300048910 | Bacteria | 3501 |
| 438 | Ga0496107_0047282 | 3300048910 | Bacteria | 3099 |
| 439 | Ga0496107_0079251 | 3300048910 | Bacteria | 2394 |
| 440 | Ga0496108_0001969 | 3300048911 | Bacteria | 16447 |
| 441 | Ga0496108_0011618 | 3300048911 | Bacteria | 7163 |
| 442 | Ga0496108_0020335 | 3300048911 | Bacteria | 5457 |
| 443 | Ga0496108_0051127 | 3300048911 | Bacteria | 3462 |
| 444 | Ga0496108_0186417 | 3300048911 | Bacteria | 1797 |
| 445 | Ga0496109_0000136 | 3300048912 | Bacteria | 73612 |
| 446 | Ga0496109_0005213 | 3300048912 | Bacteria | 10857 |
| 447 | Ga0496109_0013726 | 3300048912 | Bacteria | 7038 |
| 448 | Ga0496110_0000204 | 3300048913 | Bacteria | 37863 |
| 449 | Ga0496110_0000744 | 3300048913 | Bacteria | 22489 |
| 450 | Ga0496110_0066544 | 3300048913 | Bacteria | 3187 |
| 451 | Ga0496111_0003083 | 3300048914 | Bacteria | 10241 |
| 452 | Ga0496111_0013455 | 3300048914 | Bacteria | 5569 |
| 453 | Ga0496111_0244997 | 3300048914 | Bacteria | 1331 |
| 454 | Ga0496111_0534301 | 3300048914 | Bacteria | 862 |
| 455 | Ga0496112_0073074 | 3300048915 | Bacteria | 3390 |
| 456 | Ga0496113_0025972 | 3300048916 | Bacteria | 4183 |
| 457 | Ga0496113_0100360 | 3300048916 | Bacteria | 2243 |
| 458 | Ga0496113_0123295 | 3300048916 | Bacteria | 2028 |
| 459 | Ga0496114_0000116 | 3300048917 | Bacteria | 57632 |
| 460 | Ga0496114_0000781 | 3300048917 | Bacteria | 23730 |
| 461 | Ga0496114_0001503 | 3300048917 | Bacteria | 17692 |
| 462 | Ga0496114_0026468 | 3300048917 | Bacteria | 4749 |
| 463 | Ga0496114_0198934 | 3300048917 | Bacteria | 1755 |
| 464 | Ga0496115_0013794 | 3300048918 | Bacteria | 6119 |
| 465 | Ga0496115_0018414 | 3300048918 | Bacteria | 5362 |
| 466 | Ga0496115_0325556 | 3300048918 | Bacteria | 1256 |
| 467 | Ga0496116_0000056 | 3300048919 | Bacteria | 282554 |
| 468 | Ga0496116_0000364 | 3300048919 | Bacteria | 69617 |
| 469 | Ga0496116_0000720 | 3300048919 | Bacteria | 42406 |
| 470 | Ga0496116_0000773 | 3300048919 | Bacteria | 40648 |
| 471 | Ga0496116_0012120 | 3300048919 | Bacteria | 7061 |
| 472 | Ga0496116_0094617 | 3300048919 | Bacteria | 1805 |
| 473 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 474 | Ga0496117_0000148 | 3300048920 | Bacteria | 149369 |
| 475 | Ga0496117_0002172 | 3300048920 | Bacteria | 25568 |
| 476 | Ga0496117_0005624 | 3300048920 | Bacteria | 13086 |
| 477 | Ga0496117_0078422 | 3300048920 | Bacteria | 2180 |
| 478 | Ga0496117_0103556 | 3300048920 | Bacteria | 1793 |
| 479 | Ga0496117_0173893 | 3300048920 | Bacteria | 1246 |
| 480 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 481 | Ga0496118_0000042 | 3300048921 | Bacteria | 287521 |
| 482 | Ga0496118_0001419 | 3300048921 | Bacteria | 36163 |
| 483 | Ga0496118_0001817 | 3300048921 | Bacteria | 30722 |
| 484 | Ga0496118_0004013 | 3300048921 | Bacteria | 17905 |
| 485 | Ga0496118_0009738 | 3300048921 | Bacteria | 9643 |
| 486 | Ga0496118_0018820 | 3300048921 | Bacteria | 6201 |
| 487 | Ga0496118_0033733 | 3300048921 | Bacteria | 4192 |
| 488 | Ga0496118_0074698 | 3300048921 | Bacteria | 2421 |
| 489 | Ga0496118_0174604 | 3300048921 | Bacteria | 1307 |
| 490 | Ga0496119_0000263 | 3300048922 | Bacteria | 74497 |
| 491 | Ga0496119_0003470 | 3300048922 | Bacteria | 16353 |
| 492 | Ga0496119_0006001 | 3300048922 | Bacteria | 11414 |
| 493 | Ga0496119_0022591 | 3300048922 | Bacteria | 4494 |
| 494 | Ga0496119_0029441 | 3300048922 | Bacteria | 3723 |
| 495 | Ga0496119_0099044 | 3300048922 | Bacteria | 1640 |
| 496 | Ga0496120_0000318 | 3300048923 | Bacteria | 79637 |
| 497 | Ga0496120_0001788 | 3300048923 | Bacteria | 24161 |
| 498 | Ga0496120_0014005 | 3300048923 | Bacteria | 5365 |
| 499 | Ga0496120_0016163 | 3300048923 | Bacteria | 4886 |
| 500 | Ga0496120_0027150 | 3300048923 | Bacteria | 3527 |
| 501 | Ga0496120_0033872 | 3300048923 | Bacteria | 3065 |
| 502 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 503 | Ga0496121_0000023 | 3300048924 | Bacteria | 463448 |
| 504 | Ga0496121_0000121 | 3300048924 | Bacteria | 172480 |
| 505 | Ga0496121_0001422 | 3300048924 | Bacteria | 40504 |
| 506 | Ga0496121_0019283 | 3300048924 | Bacteria | 6826 |
| 507 | Ga0496122_0000038 | 3300048925 | Bacteria | 295624 |
| 508 | Ga0496122_0000284 | 3300048925 | Bacteria | 113244 |
| 509 | Ga0496122_0003651 | 3300048925 | Bacteria | 19996 |
| 510 | Ga0496123_0005397 | 3300048926 | Bacteria | 12882 |
| 511 | Ga0496123_0007347 | 3300048926 | Bacteria | 10431 |
| 512 | Ga0496123_0029725 | 3300048926 | Bacteria | 4013 |
| 513 | Ga0496124_0000014 | 3300048927 | Bacteria | 463448 |
| 514 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 515 | Ga0496124_0155161 | 3300048927 | Bacteria | 1791 |
| 516 | Ga0496125_0000020 | 3300048928 | Bacteria | 463448 |
| 517 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 518 | Ga0496125_0008825 | 3300048928 | Bacteria | 10481 |
| 519 | Ga0496125_0019227 | 3300048928 | Bacteria | 6451 |
| 520 | Ga0496125_0020322 | 3300048928 | Bacteria | 6233 |
| 521 | Ga0496125_0104838 | 3300048928 | Bacteria | 2069 |
| 522 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 523 | Ga0496126_0000023 | 3300048929 | Bacteria | 463448 |
| 524 | Ga0496126_0001128 | 3300048929 | Bacteria | 44671 |
| 525 | Ga0496126_0001819 | 3300048929 | Bacteria | 31173 |
| 526 | Ga0496126_0002192 | 3300048929 | Bacteria | 27135 |
| 527 | Ga0496126_0003310 | 3300048929 | Bacteria | 20519 |
| 528 | Ga0496126_0005274 | 3300048929 | Bacteria | 14845 |
| 529 | Ga0496126_0050884 | 3300048929 | Bacteria | 3774 |
| 530 | Ga0496126_0054571 | 3300048929 | Bacteria | 3618 |
| 531 | Ga0496126_0246681 | 3300048929 | Bacteria | 1490 |
| 532 | Ga0501033_0000422 | 3300049570 | Bacteria | 40484 |
| 533 | Ga0501033_0022206 | 3300049570 | Bacteria | 4788 |
| 534 | Ga0501033_0180899 | 3300049570 | Bacteria | 1511 |
| 535 | Ga0501033_0247978 | 3300049570 | Bacteria | 1263 |
| 536 | Ga0501034_0006769 | 3300049571 | Bacteria | 12259 |
| 537 | Ga0501037_0031554 | 3300049573 | Bacteria | 3911 |
| 538 | Ga0501037_0347697 | 3300049573 | Bacteria | 1023 |
| 539 | Ga0501039_0057378 | 3300049575 | Bacteria | 3015 |
| 540 | Ga0501041_0293971 | 3300049577 | Bacteria | 1023 |
| 541 | Ga0501046_0000104 | 3300049580 | Bacteria | 89700 |
| 542 | Ga0501047_0013512 | 3300049581 | Bacteria | 7740 |
| 543 | Ga0501047_0070062 | 3300049581 | Bacteria | 3376 |
| 544 | Ga0501047_0491089 | 3300049581 | Bacteria | 1055 |
| 545 | Ga0501048_0028520 | 3300049582 | Bacteria | 4052 |
| 546 | Ga0501070_0005540 | 3300049586 | Bacteria | 10764 |
| 547 | Ga0501071_0193493 | 3300049587 | Bacteria | 1526 |
| 548 | Ga0501074_0547978 | 3300049590 | Bacteria | 819 |
| 549 | Ga0501035_0025498 | 3300049822 | Bacteria | 5419 |
| 550 | Ga0501035_0173350 | 3300049822 | Bacteria | 1863 |
| 551 | Ga0501044_0009965 | 3300049823 | Bacteria | 10323 |
| 552 | Ga0501044_0093610 | 3300049823 | Bacteria | 3030 |
| 553 | nmdc:mga03683_100286_c1 | 3300050489 | Bacteria | 1272 |
| 554 | nmdc:mga03n38_1104_c1 | 3300050490 | Bacteria | 7458 |
| 555 | nmdc:mga03n38_207795_c1 | 3300050490 | Bacteria | 1016 |
| 556 | nmdc:mga03n38_3072_c1 | 3300050490 | Bacteria | 5292 |
| 557 | nmdc:mga03n38_47366_c1 | 3300050490 | Bacteria | 1902 |
| 558 | nmdc:mga03n38_6608_c1 | 3300050490 | Bacteria | 4043 |
| 559 | nmdc:mga03n38_66230_c1 | 3300050490 | Bacteria | 1658 |
| 560 | nmdc:mga03n38_7493_c1 | 3300050490 | Bacteria | 3865 |
| 561 | nmdc:mga00v17_25954_c1 | 3300050491 | Bacteria | 3409 |
| 562 | nmdc:mga00v17_27394_c1 | 3300050491 | Bacteria | 3327 |
| 563 | nmdc:mga00v17_55471_c1 | 3300050491 | Bacteria | 2420 |
| 564 | nmdc:mga0yw44_192929_c1 | 3300050492 | Bacteria | 1344 |
| 565 | nmdc:mga0yw44_32704_c1 | 3300050492 | Bacteria | 3033 |
| 566 | nmdc:mga0yw44_3391_c1 | 3300050492 | Bacteria | 7072 |
| 567 | nmdc:mga0yw44_34121_c1 | 3300050492 | Bacteria | 2979 |
| 568 | nmdc:mga0yw44_947_c1 | 3300050492 | Bacteria | 11013 |
| 569 | nmdc:mga06z11_15531_c1 | 3300050494 | Bacteria | 2320 |
| 570 | nmdc:mga06z11_273931_c1 | 3300050494 | Bacteria | 998 |
| 571 | nmdc:mga06z11_3823_c1 | 3300050494 | Bacteria | 5864 |
| 572 | nmdc:mga07m45_124233_c1 | 3300050496 | Bacteria | 1492 |
| 573 | nmdc:mga07m45_12857_c1 | 3300050496 | Bacteria | 4428 |
| 574 | nmdc:mga07m45_1930_c1 | 3300050496 | Bacteria | 6915 |
| 575 | nmdc:mga07m45_6606_c1 | 3300050496 | Bacteria | 5878 |
| 576 | nmdc:mga05p37_26824_c1 | 3300050507 | Bacteria | 7008 |
| 577 | nmdc:mga0qj67_111112_c1 | 3300050509 | Bacteria | 2213 |
| 578 | nmdc:mga0qj67_1960_c1 | 3300050509 | Bacteria | 14659 |
| 579 | nmdc:mga06r32_900817_c1 | 3300050510 | Bacteria | 841 |
| 580 | nmdc:mga06r32_9678_c1 | 3300050510 | Bacteria | 8707 |
| 581 | nmdc:mga0n895_2218_c1 | 3300050512 | Bacteria | 15021 |
| 582 | nmdc:mga0rr50_5511_c1 | 3300050513 | Bacteria | 7560 |
| 583 | nmdc:mga08x19_56423_c1 | 3300050514 | Bacteria | 2535 |
| 584 | nmdc:mga0a205_32366_c2 | 3300050515 | Bacteria | 2683 |
| 585 | nmdc:mga0a205_80048_c1 | 3300050515 | Bacteria | 3157 |
| 586 | nmdc:mga0sz30_10235_c1 | 3300050516 | Bacteria | 3590 |
| 587 | nmdc:mga0sz30_113834_c1 | 3300050516 | Bacteria | 1187 |
| 588 | nmdc:mga0sz30_227_c1 | 3300050516 | Bacteria | 21431 |
| 589 | nmdc:mga0sz30_39313_c1 | 3300050516 | Bacteria | 1984 |
| 590 | nmdc:mga0sz30_8067_c1 | 3300050516 | Bacteria | 3967 |
| 591 | nmdc:mga0sz30_81355_c1 | 3300050516 | Bacteria | 1402 |
| 592 | nmdc:mga0sz30_8704_c1 | 3300050516 | Bacteria | 3839 |
| 593 | Ga0500643_009959 | 3300053087 | Bacteria | 3583 |
| 594 | Ga0500652_007981 | 3300053131 | Bacteria | 3502 |
| 595 | Ga0500559_0113175 | 3300053136 | Bacteria | 1258 |
| 596 | Ga0500568_0082772 | 3300053139 | Bacteria | 1217 |
| 597 | Ga0500627_0008006 | 3300053158 | Bacteria | 3725 |
| 598 | Ga0500627_0014230 | 3300053158 | Bacteria | 3042 |
| 599 | Ga0500645_000035 | 3300053730 | Bacteria | 113679 |
| 600 | Ga0500645_049038 | 3300053730 | Bacteria | 1235 |
| 601 | Ga0466962_0012329 | 3300061719 | Bacteria | 4110 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0363908 | Ga0395905_0363908_38_775 | 242 |
| 2 | 3300049581 | Ga0501047_0491089 | Ga0501047_0491089_44_802 | 246 |
| 3 | 3300042435 | Ga0439434_0048997 | Ga0439434_0048997_544_1296 | 250 |
| 4 | 3300009147 | Ga0114129_10305578 | Ga0114129_103055783 | 251 |
| 5 | 3300050510 | nmdc:mga06r32_900817_c1 | nmdc:mga06r32_900817_c1_58_822 | 251 |
| 6 | 3300050512 | nmdc:mga0n895_2218_c1 | nmdc:mga0n895_2218_c1_1742_2506 | 251 |
| 7 | 3300048908 | Ga0496105_0289806 | Ga0496105_0289806_401_1180 | 254 |
| 8 | 3300005338 | Ga0068868_100316946 | Ga0068868_1003169461 | 258 |
| 9 | 3300048908 | Ga0496105_0436839 | Ga0496105_0436839_70_846 | 258 |
| 10 | 3300048914 | Ga0496111_0534301 | Ga0496111_0534301_12_788 | 258 |
| 11 | 3300048920 | Ga0496117_0173893 | Ga0496117_0173893_364_1140 | 258 |
| 12 | 3300049590 | Ga0501074_0547978 | Ga0501074_0547978_29_805 | 258 |
| 13 | 3300050513 | nmdc:mga0rr50_5511_c1 | nmdc:mga0rr50_5511_c1_1730_2554 | 271 |
| 14 | 3300050514 | nmdc:mga08x19_56423_c1 | nmdc:mga08x19_56423_c1_123_947 | 271 |
| 15 | 3300050515 | nmdc:mga0a205_32366_c2 | nmdc:mga0a205_32366_c2_1516_2340 | 271 |
| 16 | 3300049575 | Ga0501039_0057378 | Ga0501039_0057378_2040_2927 | 274 |
| 17 | 3300049577 | Ga0501041_0293971 | Ga0501041_0293971_51_938 | 274 |
| 18 | 3300050515 | nmdc:mga0a205_80048_c1 | nmdc:mga0a205_80048_c1_1160_1993 | 274 |
| 19 | 3300044658 | Ga0466972_0194303 | Ga0466972_0194303_93_920 | 275 |
| 20 | 3300044693 | Ga0466961_0146832 | Ga0466961_0146832_627_1454 | 275 |
| 21 | 3300053730 | Ga0500645_049038 | Ga0500645_049038_11_838 | 275 |
| 22 | 3300005843 | Ga0068860_100000023 | Ga0068860_100000023259 | 278 |
| 23 | 3300006852 | Ga0075433_10059269 | Ga0075433_100592693 | 278 |
| 24 | 3300006852 | Ga0075433_10095027 | Ga0075433_100950272 | 278 |
| 25 | 3300006871 | Ga0075434_100003638 | Ga0075434_10000363813 | 278 |
| 26 | 3300006914 | Ga0075436_100019263 | Ga0075436_1000192634 | 278 |
| 27 | 3300007076 | Ga0075435_100004834 | Ga0075435_1000048347 | 278 |
| 28 | 3300009147 | Ga0114129_10160468 | Ga0114129_101604682 | 278 |
| 29 | 3300025949 | Ga0207667_10398394 | Ga0207667_103983942 | 278 |
| 30 | 3300028381 | Ga0268264_10000008 | Ga0268264_100000082 | 278 |
| 31 | 3300048921 | Ga0496118_0174604 | Ga0496118_0174604_18_857 | 279 |
| 32 | 3300006038 | Ga0075365_10006913 | Ga0075365_100069136 | 280 |
| 33 | 3300006177 | Ga0075362_10100195 | Ga0075362_101001952 | 280 |
| 34 | 3300006178 | Ga0075367_10015350 | Ga0075367_100153503 | 280 |
| 35 | 3300009011 | Ga0105251_10014636 | Ga0105251_100146362 | 280 |
| 36 | 3300009553 | Ga0105249_10075650 | Ga0105249_100756503 | 280 |
| 37 | 3300014968 | Ga0157379_10225587 | Ga0157379_102255872 | 280 |
| 38 | 3300048905 | Ga0496102_0033688 | Ga0496102_0033688_2157_2999 | 280 |
| 39 | 3300048909 | Ga0496106_0042168 | Ga0496106_0042168_1195_2037 | 280 |
| 40 | 3300048910 | Ga0496107_0047282 | Ga0496107_0047282_1621_2463 | 280 |
| 41 | 3300048919 | Ga0496116_0000773 | Ga0496116_0000773_28658_29500 | 280 |
| 42 | 3300048921 | Ga0496118_0009738 | Ga0496118_0009738_702_1544 | 280 |
| 43 | 3300048922 | Ga0496119_0022591 | Ga0496119_0022591_3234_4076 | 280 |
| 44 | 3300048922 | Ga0496119_0029441 | Ga0496119_0029441_12_854 | 280 |
| 45 | 3300048923 | Ga0496120_0001788 | Ga0496120_0001788_17502_18344 | 280 |
| 46 | 3300050489 | nmdc:mga03683_100286_c1 | nmdc:mga03683_100286_c1_106_1014 | 280 |
| 47 | 3300050494 | nmdc:mga06z11_3823_c1 | nmdc:mga06z11_3823_c1_3863_4771 | 280 |
| 48 | 3300006048 | Ga0075363_100005743 | Ga0075363_1000057432 | 281 |
| 49 | 3300006186 | Ga0075369_10009003 | Ga0075369_100090033 | 281 |
| 50 | 3300006353 | Ga0075370_10004289 | Ga0075370_100042895 | 281 |
| 51 | 3300050490 | nmdc:mga03n38_7493_c1 | nmdc:mga03n38_7493_c1_2351_3259 | 281 |
| 52 | 3300050491 | nmdc:mga00v17_27394_c1 | nmdc:mga00v17_27394_c1_1170_2078 | 281 |
| 53 | 3300050496 | nmdc:mga07m45_6606_c1 | nmdc:mga07m45_6606_c1_4088_4996 | 281 |
| 54 | 3300050516 | nmdc:mga0sz30_8067_c1 | nmdc:mga0sz30_8067_c1_1500_2408 | 281 |
| 55 | iso_pu_bacteria | 2818991462 | 2819689298 | 281 |
| 56 | 3300049570 | Ga0501033_0000422 | Ga0501033_0000422_13451_14326 | 283 |
| 57 | 3300049580 | Ga0501046_0000104 | Ga0501046_0000104_76446_77321 | 283 |
| 58 | 3300037418 | Ga0395900_0031002 | Ga0395900_0031002_4306_5175 | 284 |
| 59 | 3300037466 | Ga0395898_0118833 | Ga0395898_0118833_965_1834 | 284 |
| 60 | 3300038443 | Ga0395901_0015044 | Ga0395901_0015044_907_1776 | 284 |
| 61 | 3300048908 | Ga0496105_0172770 | Ga0496105_0172770_601_1470 | 284 |
| 62 | 3300005435 | Ga0070714_100047988 | Ga0070714_1000479882 | 287 |
| 63 | 3300025929 | Ga0207664_10086937 | Ga0207664_100869372 | 287 |
| 64 | iso_pu_bacteria | 2547132424 | 2548698135 | 288 |
| 65 | iso_pu_bacteria | 2919713450 | 2919715672 | 288 |
| 66 | iso_pu_bacteria | 2873314349 | 2873314574 | 291 |
| 67 | iso_pu_bacteria | 2811994874 | 2812333742 | 292 |
| 68 | iso_pu_bacteria | 8056207758 | 8056213061 | 292 |
| 69 | 3300046455 | Ga0495603_0000635 | Ga0495603_0000635_17300_18244 | 293 |
| 70 | 3300046459 | Ga0495629_0036054 | Ga0495629_0036054_957_1901 | 293 |
| 71 | 3300046689 | Ga0495613_0019936 | Ga0495613_0019936_1514_2458 | 293 |
| 72 | 3300047321 | Ga0495676_0001286 | Ga0495676_0001286_1503_2447 | 293 |
| 73 | 3300048089 | Ga0495614_0000417 | Ga0495614_0000417_1541_2485 | 293 |
| 74 | iso_pu_bacteria | 2738541305 | 2738870761 | 293 |
| 75 | iso_pu_bacteria | 2738543005 | 2739206923 | 293 |
| 76 | iso_pu_bacteria | 2811994874 | 2812331084 | 293 |
| 77 | iso_pu_bacteria | 2738543005 | 2739206048 | 294 |
| 78 | iso_pu_bacteria | 2928142448 | 2928143823 | 294 |
| 79 | 3300005841 | Ga0068863_100002102 | Ga0068863_1000021022 | 295 |
| 80 | 3300009545 | Ga0105237_10001013 | Ga0105237_100010134 | 295 |
| 81 | 3300009545 | Ga0105237_10004282 | Ga0105237_1000428212 | 295 |
| 82 | 3300010375 | Ga0105239_10000626 | Ga0105239_1000062627 | 295 |
| 83 | 3300010375 | Ga0105239_10001157 | Ga0105239_100011574 | 295 |
| 84 | 3300013306 | Ga0163162_10535256 | Ga0163162_105352561 | 295 |
| 85 | 3300025914 | Ga0207671_10004785 | Ga0207671_100047857 | 295 |
| 86 | 3300025914 | Ga0207671_10006971 | Ga0207671_100069717 | 295 |
| 87 | 3300025941 | Ga0207711_10000043 | Ga0207711_10000043133 | 295 |
| 88 | 3300026088 | Ga0207641_10008714 | Ga0207641_100087148 | 295 |
| 89 | 3300027312 | Ga0209371_1014882 | Ga0209371_10148822 | 295 |
| 90 | 3300030500 | Ga0268256_1017453 | Ga0268256_10174532 | 295 |
| 91 | 3300048918 | Ga0496115_0325556 | Ga0496115_0325556_52_939 | 295 |
| 92 | 3300048929 | Ga0496126_0003310 | Ga0496126_0003310_12475_13362 | 295 |
| 93 | iso_pu_bacteria | 2565956761 | 2566995163 | 295 |
| 94 | iso_pu_bacteria | 2643221561 | 2643823696 | 295 |
| 95 | iso_pu_bacteria | 2643221561 | 2643824432 | 295 |
| 96 | iso_pu_bacteria | 2643221696 | 2644535376 | 295 |
| 97 | iso_pu_bacteria | 2643221696 | 2644535771 | 295 |
| 98 | iso_pu_bacteria | 2751185725 | 2753036063 | 295 |
| 99 | iso_pu_bacteria | 2751185792 | 2753323935 | 295 |
| 100 | iso_pu_bacteria | 2889300758 | 2889304707 | 295 |
| 101 | iso_pu_bacteria | 2891395885 | 2891398340 | 295 |
| 102 | iso_pu_bacteria | 2904535858 | 2904537313 | 295 |
| 103 | iso_pu_bacteria | 2917736166 | 2917744593 | 295 |
| 104 | iso_pu_bacteria | 2922554459 | 2922559072 | 295 |
| 105 | iso_pu_bacteria | 8055172936 | 8055177817 | 295 |
| 106 | 3300005617 | Ga0068859_100036533 | Ga0068859_1000365334 | 296 |
| 107 | 3300005844 | Ga0068862_100001398 | Ga0068862_10000139818 | 296 |
| 108 | 3300006931 | Ga0097620_100036528 | Ga0097620_1000365284 | 296 |
| 109 | 3300014325 | Ga0163163_10187866 | Ga0163163_101878663 | 296 |
| 110 | 3300025735 | Ga0207713_1039914 | Ga0207713_10399142 | 296 |
| 111 | 3300025900 | Ga0207710_10000292 | Ga0207710_1000029229 | 296 |
| 112 | 3300025900 | Ga0207710_10000614 | Ga0207710_100006143 | 296 |
| 113 | 3300025941 | Ga0207711_10013490 | Ga0207711_100134903 | 296 |
| 114 | 3300026035 | Ga0207703_10000021 | Ga0207703_10000021151 | 296 |
| 115 | 3300028380 | Ga0268265_10000276 | Ga0268265_1000027618 | 296 |
| 116 | 3300037466 | Ga0395898_0035950 | Ga0395898_0035950_1670_2581 | 296 |
| 117 | 3300038443 | Ga0395901_0078462 | Ga0395901_0078462_466_1377 | 296 |
| 118 | 3300050516 | nmdc:mga0sz30_8704_c1 | nmdc:mga0sz30_8704_c1_581_1471 | 296 |
| 119 | iso_pu_bacteria | 2547132424 | 2548696731 | 296 |
| 120 | iso_pu_bacteria | 2643221692 | 2644512003 | 296 |
| 121 | iso_pu_bacteria | 2738543011 | 2739236118 | 296 |
| 122 | iso_pu_bacteria | 2744054611 | 2744953504 | 296 |
| 123 | iso_pu_bacteria | 2842888712 | 2842890535 | 296 |
| 124 | iso_pu_bacteria | 2889300758 | 2889304486 | 296 |
| 125 | iso_pu_bacteria | 2939743619 | 2939745116 | 296 |
| 126 | 3300005347 | Ga0070668_100042563 | Ga0070668_1000425634 | 297 |
| 127 | 3300025972 | Ga0207668_10152934 | Ga0207668_101529341 | 297 |
| 128 | 3300048911 | Ga0496108_0186417 | Ga0496108_0186417_305_1201 | 297 |
| 129 | 3300003322 | rootL2_10227700 | rootL2_102277002 | 298 |
| 130 | 3300005548 | Ga0070665_100001909 | Ga0070665_1000019095 | 298 |
| 131 | 3300005841 | Ga0068863_100177326 | Ga0068863_1001773262 | 298 |
| 132 | 3300005843 | Ga0068860_100022412 | Ga0068860_1000224124 | 298 |
| 133 | 3300014968 | Ga0157379_10034528 | Ga0157379_100345282 | 298 |
| 134 | 3300025931 | Ga0207644_10003664 | Ga0207644_100036645 | 298 |
| 135 | 3300026088 | Ga0207641_10033592 | Ga0207641_100335925 | 298 |
| 136 | 3300028380 | Ga0268265_10169373 | Ga0268265_101693732 | 298 |
| 137 | 3300028381 | Ga0268264_10015870 | Ga0268264_100158704 | 298 |
| 138 | 3300031251 | Ga0265327_10000363 | Ga0265327_1000036362 | 298 |
| 139 | 3300031251 | Ga0265327_10019936 | Ga0265327_100199365 | 298 |
| 140 | 3300046531 | Ga0495665_0010350 | Ga0495665_0010350_966_1877 | 298 |
| 141 | 3300048903 | Ga0496100_0015718 | Ga0496100_0015718_120_1019 | 298 |
| 142 | 3300048904 | Ga0496101_0006835 | Ga0496101_0006835_3290_4189 | 298 |
| 143 | 3300048905 | Ga0496102_0000102 | Ga0496102_0000102_118350_119249 | 298 |
| 144 | 3300048906 | Ga0496103_0000090 | Ga0496103_0000090_97759_98658 | 298 |
| 145 | 3300048908 | Ga0496105_0298278 | Ga0496105_0298278_85_984 | 298 |
| 146 | 3300048910 | Ga0496107_0037026 | Ga0496107_0037026_155_1054 | 298 |
| 147 | 3300048919 | Ga0496116_0000364 | Ga0496116_0000364_65752_66651 | 298 |
| 148 | 3300048920 | Ga0496117_0000148 | Ga0496117_0000148_62120_63019 | 298 |
| 149 | 3300048921 | Ga0496118_0000042 | Ga0496118_0000042_256569_257468 | 298 |
| 150 | 3300048922 | Ga0496119_0006001 | Ga0496119_0006001_539_1438 | 298 |
| 151 | 3300048923 | Ga0496120_0027150 | Ga0496120_0027150_420_1319 | 298 |
| 152 | 3300048924 | Ga0496121_0019283 | Ga0496121_0019283_4505_5404 | 298 |
| 153 | 3300048927 | Ga0496124_0155161 | Ga0496124_0155161_370_1269 | 298 |
| 154 | 3300048929 | Ga0496126_0001819 | Ga0496126_0001819_30040_30939 | 298 |
| 155 | 3300049573 | Ga0501037_0347697 | Ga0501037_0347697_20_928 | 298 |
| 156 | 3300049581 | Ga0501047_0070062 | Ga0501047_0070062_1833_2741 | 298 |
| 157 | iso_pu_bacteria | 2565956761 | 2566991683 | 298 |
| 158 | iso_pu_bacteria | 2643221715 | 2644636773 | 298 |
| 159 | iso_pu_bacteria | 2738541264 | 2738667435 | 298 |
| 160 | iso_pu_bacteria | 2738541274 | 2738704608 | 298 |
| 161 | iso_pu_bacteria | 2738541274 | 2738704616 | 298 |
| 162 | iso_pu_bacteria | 2738541308 | 2738887945 | 298 |
| 163 | iso_pu_bacteria | 2738541356 | 2739146505 | 298 |
| 164 | iso_pu_bacteria | 2738543028 | 2739330900 | 298 |
| 165 | iso_pu_bacteria | 2738543028 | 2739330909 | 298 |
| 166 | iso_pu_bacteria | 2842134933 | 2842135432 | 298 |
| 167 | iso_pu_bacteria | 2902792274 | 2902796374 | 298 |
| 168 | iso_pu_bacteria | 2902799365 | 2902802088 | 298 |
| 169 | iso_pu_bacteria | 2902799365 | 2902802098 | 298 |
| 170 | iso_pu_bacteria | 2902810491 | 2902816252 | 298 |
| 171 | iso_pu_bacteria | 2902837492 | 2902843277 | 298 |
| 172 | iso_pu_bacteria | 2904535858 | 2904541190 | 298 |
| 173 | iso_pu_bacteria | 2904765812 | 2904770346 | 298 |
| 174 | iso_pu_bacteria | 2919420072 | 2919422355 | 298 |
| 175 | iso_pu_bacteria | 2919432681 | 2919435392 | 298 |
| 176 | iso_pu_bacteria | 2922554459 | 2922560835 | 298 |
| 177 | iso_pu_bacteria | 2939582691 | 2939589275 | 298 |
| 178 | 3300005327 | Ga0070658_10012657 | Ga0070658_100126575 | 299 |
| 179 | 3300005455 | Ga0070663_100153008 | Ga0070663_1001530082 | 299 |
| 180 | 3300005467 | Ga0070706_100225049 | Ga0070706_1002250491 | 299 |
| 181 | 3300005471 | Ga0070698_100002017 | Ga0070698_10000201719 | 299 |
| 182 | 3300006048 | Ga0075363_100067898 | Ga0075363_1000678982 | 299 |
| 183 | 3300006051 | Ga0075364_10237194 | Ga0075364_102371941 | 299 |
| 184 | 3300009148 | Ga0105243_10001305 | Ga0105243_1000130510 | 299 |
| 185 | 3300025909 | Ga0207705_10038361 | Ga0207705_100383613 | 299 |
| 186 | 3300025910 | Ga0207684_10533153 | Ga0207684_105331531 | 299 |
| 187 | 3300025929 | Ga0207664_10556386 | Ga0207664_105563861 | 299 |
| 188 | 3300025935 | Ga0207709_10006535 | Ga0207709_100065356 | 299 |
| 189 | 3300026067 | Ga0207678_10091483 | Ga0207678_100914832 | 299 |
| 190 | 3300031838 | Ga0307518_10149744 | Ga0307518_101497442 | 299 |
| 191 | 3300037466 | Ga0395898_0037184 | Ga0395898_0037184_132_1064 | 299 |
| 192 | 3300041512 | Ga0451853_3273662 | Ga0451853_3273662_107_1018 | 299 |
| 193 | 3300048916 | Ga0496113_0100360 | Ga0496113_0100360_1065_1985 | 299 |
| 194 | 3300048928 | Ga0496125_0008825 | Ga0496125_0008825_6841_7761 | 299 |
| 195 | 3300049570 | Ga0501033_0180899 | Ga0501033_0180899_204_1127 | 299 |
| 196 | 3300049823 | Ga0501044_0093610 | Ga0501044_0093610_1701_2624 | 299 |
| 197 | 3300050496 | nmdc:mga07m45_124233_c1 | nmdc:mga07m45_124233_c1_245_1165 | 299 |
| 198 | iso_pu_bacteria | 2738543011 | 2739239616 | 299 |
| 199 | iso_pu_bacteria | 2939743619 | 2939744907 | 299 |
| 200 | 3300006038 | Ga0075365_10212250 | Ga0075365_102122502 | 300 |
| 201 | 3300006048 | Ga0075363_100088578 | Ga0075363_1000885782 | 300 |
| 202 | 3300006178 | Ga0075367_10146986 | Ga0075367_101469861 | 300 |
| 203 | 3300006353 | Ga0075370_10021536 | Ga0075370_100215362 | 300 |
| 204 | 3300009148 | Ga0105243_10005168 | Ga0105243_100051684 | 300 |
| 205 | 3300021388 | Ga0213875_10033637 | Ga0213875_100336372 | 300 |
| 206 | 3300025935 | Ga0207709_10002791 | Ga0207709_100027919 | 300 |
| 207 | 3300031251 | Ga0265327_10000004 | Ga0265327_10000004205 | 300 |
| 208 | 3300037853 | Ga0436364_1229776 | Ga0436364_1229776_1215_2120 | 300 |
| 209 | 3300044683 | Ga0466965_0018541 | Ga0466965_0018541_969_1871 | 300 |
| 210 | 3300044901 | Ga0466960_0001288 | Ga0466960_0001288_7219_8121 | 300 |
| 211 | 3300046531 | Ga0495665_0116817 | Ga0495665_0116817_42_947 | 300 |
| 212 | 3300046616 | Ga0495668_0000237 | Ga0495668_0000237_21152_22063 | 300 |
| 213 | 3300046674 | Ga0495588_0108794 | Ga0495588_0108794_177_1082 | 300 |
| 214 | 3300047315 | Ga0495581_0066506 | Ga0495581_0066506_1115_2020 | 300 |
| 215 | 3300048903 | Ga0496100_0001621 | Ga0496100_0001621_3142_4044 | 300 |
| 216 | 3300048904 | Ga0496101_0000099 | Ga0496101_0000099_3144_4046 | 300 |
| 217 | 3300048905 | Ga0496102_0055076 | Ga0496102_0055076_2696_3598 | 300 |
| 218 | 3300048906 | Ga0496103_0000116 | Ga0496103_0000116_43272_44174 | 300 |
| 219 | 3300048909 | Ga0496106_0001318 | Ga0496106_0001318_3124_4026 | 300 |
| 220 | 3300048910 | Ga0496107_0005035 | Ga0496107_0005035_4996_5898 | 300 |
| 221 | 3300048911 | Ga0496108_0001969 | Ga0496108_0001969_14340_15242 | 300 |
| 222 | 3300048911 | Ga0496108_0051127 | Ga0496108_0051127_1183_2094 | 300 |
| 223 | 3300048912 | Ga0496109_0005213 | Ga0496109_0005213_3155_4057 | 300 |
| 224 | 3300048913 | Ga0496110_0000744 | Ga0496110_0000744_3157_4059 | 300 |
| 225 | 3300048914 | Ga0496111_0003083 | Ga0496111_0003083_3463_4365 | 300 |
| 226 | 3300048917 | Ga0496114_0000116 | Ga0496114_0000116_3133_4035 | 300 |
| 227 | 3300048919 | Ga0496116_0012120 | Ga0496116_0012120_3336_4238 | 300 |
| 228 | 3300048920 | Ga0496117_0005624 | Ga0496117_0005624_11946_12848 | 300 |
| 229 | 3300048921 | Ga0496118_0033733 | Ga0496118_0033733_3052_3954 | 300 |
| 230 | 3300048923 | Ga0496120_0014005 | Ga0496120_0014005_1331_2233 | 300 |
| 231 | 3300048924 | Ga0496121_0000016 | Ga0496121_0000016_374334_375236 | 300 |
| 232 | 3300048925 | Ga0496122_0000284 | Ga0496122_0000284_88253_89155 | 300 |
| 233 | 3300048926 | Ga0496123_0029725 | Ga0496123_0029725_1928_2830 | 300 |
| 234 | 3300048927 | Ga0496124_0000015 | Ga0496124_0000015_3154_4056 | 300 |
| 235 | 3300048928 | Ga0496125_0000021 | Ga0496125_0000021_456645_457547 | 300 |
| 236 | 3300048928 | Ga0496125_0019227 | Ga0496125_0019227_1200_2111 | 300 |
| 237 | 3300048929 | Ga0496126_0000015 | Ga0496126_0000015_456645_457547 | 300 |
| 238 | 3300048929 | Ga0496126_0246681 | Ga0496126_0246681_53_964 | 300 |
| 239 | 3300050490 | nmdc:mga03n38_47366_c1 | nmdc:mga03n38_47366_c1_171_1082 | 300 |
| 240 | 3300050494 | nmdc:mga06z11_273931_c1 | nmdc:mga06z11_273931_c1_44_955 | 300 |
| 241 | iso_pu_bacteria | 2738541264 | 2738663953 | 300 |
| 242 | iso_pu_bacteria | 2738541356 | 2739143088 | 300 |
| 243 | iso_pu_bacteria | 2738543005 | 2739207275 | 300 |
| 244 | iso_pu_bacteria | 2928142448 | 2928143441 | 300 |
| 245 | 3300005367 | Ga0070667_100000723 | Ga0070667_10000072324 | 301 |
| 246 | 3300005548 | Ga0070665_100033980 | Ga0070665_1000339804 | 301 |
| 247 | 3300005617 | Ga0068859_100002020 | Ga0068859_10000202015 | 301 |
| 248 | 3300005841 | Ga0068863_100000305 | Ga0068863_1000003056 | 301 |
| 249 | 3300005842 | Ga0068858_100005093 | Ga0068858_1000050932 | 301 |
| 250 | 3300005843 | Ga0068860_100000287 | Ga0068860_1000002876 | 301 |
| 251 | 3300005844 | Ga0068862_100000296 | Ga0068862_10000029650 | 301 |
| 252 | 3300006931 | Ga0097620_100002020 | Ga0097620_1000020204 | 301 |
| 253 | 3300009101 | Ga0105247_10000134 | Ga0105247_100001347 | 301 |
| 254 | 3300009177 | Ga0105248_10000181 | Ga0105248_100001817 | 301 |
| 255 | 3300009553 | Ga0105249_10000189 | Ga0105249_100001896 | 301 |
| 256 | 3300014325 | Ga0163163_10022198 | Ga0163163_100221982 | 301 |
| 257 | 3300025900 | Ga0207710_10000163 | Ga0207710_1000016369 | 301 |
| 258 | 3300025941 | Ga0207711_10000228 | Ga0207711_100002284 | 301 |
| 259 | 3300025961 | Ga0207712_10000006 | Ga0207712_10000006498 | 301 |
| 260 | 3300025986 | Ga0207658_10002342 | Ga0207658_1000234210 | 301 |
| 261 | 3300026035 | Ga0207703_10010908 | Ga0207703_100109082 | 301 |
| 262 | 3300026088 | Ga0207641_10001160 | Ga0207641_100011602 | 301 |
| 263 | 3300028379 | Ga0268266_10126947 | Ga0268266_101269472 | 301 |
| 264 | 3300028380 | Ga0268265_10000192 | Ga0268265_100001926 | 301 |
| 265 | 3300028381 | Ga0268264_10000339 | Ga0268264_100003396 | 301 |
| 266 | 3300044683 | Ga0466965_0039644 | Ga0466965_0039644_992_1921 | 301 |
| 267 | 3300048903 | Ga0496100_0122206 | Ga0496100_0122206_777_1682 | 301 |
| 268 | 3300048904 | Ga0496101_0048545 | Ga0496101_0048545_1925_2830 | 301 |
| 269 | 3300048905 | Ga0496102_0000509 | Ga0496102_0000509_36196_37101 | 301 |
| 270 | 3300048906 | Ga0496103_0000215 | Ga0496103_0000215_41392_42297 | 301 |
| 271 | 3300048910 | Ga0496107_0016701 | Ga0496107_0016701_3621_4526 | 301 |
| 272 | 3300048917 | Ga0496114_0198934 | Ga0496114_0198934_354_1259 | 301 |
| 273 | 3300048919 | Ga0496116_0094617 | Ga0496116_0094617_305_1210 | 301 |
| 274 | 3300048920 | Ga0496117_0002172 | Ga0496117_0002172_5400_6305 | 301 |
| 275 | 3300048921 | Ga0496118_0004013 | Ga0496118_0004013_12414_13319 | 301 |
| 276 | 3300048922 | Ga0496119_0003470 | Ga0496119_0003470_9944_10849 | 301 |
| 277 | 3300048923 | Ga0496120_0016163 | Ga0496120_0016163_3236_4141 | 301 |
| 278 | 3300048924 | Ga0496121_0001422 | Ga0496121_0001422_33927_34832 | 301 |
| 279 | 3300048928 | Ga0496125_0020322 | Ga0496125_0020322_831_1736 | 301 |
| 280 | 3300048929 | Ga0496126_0005274 | Ga0496126_0005274_5355_6260 | 301 |
| 281 | 3300049587 | Ga0501071_0193493 | Ga0501071_0193493_507_1427 | 301 |
| 282 | iso_pu_bacteria | 2928142448 | 2928146722 | 301 |
| 283 | 3300001991 | JGI24743J22301_10005048 | JGI24743J22301_100050482 | 302 |
| 284 | 3300002077 | JGI24744J21845_10003180 | JGI24744J21845_100031802 | 302 |
| 285 | 3300002077 | JGI24744J21845_10007364 | JGI24744J21845_100073642 | 302 |
| 286 | 3300003792 | Ga0055540_1000057 | Ga0055540_1000057124 | 302 |
| 287 | 3300003792 | Ga0055540_1006615 | Ga0055540_10066154 | 302 |
| 288 | 3300005328 | Ga0070676_10048013 | Ga0070676_100480132 | 302 |
| 289 | 3300005330 | Ga0070690_100204349 | Ga0070690_1002043491 | 302 |
| 290 | 3300005334 | Ga0068869_100199301 | Ga0068869_1001993012 | 302 |
| 291 | 3300005336 | Ga0070680_100252117 | Ga0070680_1002521172 | 302 |
| 292 | 3300005337 | Ga0070682_100008009 | Ga0070682_1000080094 | 302 |
| 293 | 3300005337 | Ga0070682_100190760 | Ga0070682_1001907602 | 302 |
| 294 | 3300005343 | Ga0070687_100167078 | Ga0070687_1001670781 | 302 |
| 295 | 3300005347 | Ga0070668_100002095 | Ga0070668_1000020952 | 302 |
| 296 | 3300005347 | Ga0070668_100030630 | Ga0070668_1000306303 | 302 |
| 297 | 3300005347 | Ga0070668_100034174 | Ga0070668_1000341743 | 302 |
| 298 | 3300005347 | Ga0070668_100248568 | Ga0070668_1002485682 | 302 |
| 299 | 3300005355 | Ga0070671_100001518 | Ga0070671_1000015182 | 302 |
| 300 | 3300005356 | Ga0070674_100038952 | Ga0070674_1000389522 | 302 |
| 301 | 3300005356 | Ga0070674_100241872 | Ga0070674_1002418721 | 302 |
| 302 | 3300005364 | Ga0070673_100100056 | Ga0070673_1001000562 | 302 |
| 303 | 3300005367 | Ga0070667_100000875 | Ga0070667_1000008755 | 302 |
| 304 | 3300005367 | Ga0070667_100005037 | Ga0070667_1000050372 | 302 |
| 305 | 3300005367 | Ga0070667_100010043 | Ga0070667_1000100436 | 302 |
| 306 | 3300005367 | Ga0070667_100221479 | Ga0070667_1002214792 | 302 |
| 307 | 3300005434 | Ga0070709_10113630 | Ga0070709_101136302 | 302 |
| 308 | 3300005434 | Ga0070709_10189390 | Ga0070709_101893902 | 302 |
| 309 | 3300005435 | Ga0070714_100020878 | Ga0070714_1000208782 | 302 |
| 310 | 3300005435 | Ga0070714_100212829 | Ga0070714_1002128292 | 302 |
| 311 | 3300005436 | Ga0070713_100424198 | Ga0070713_1004241982 | 302 |
| 312 | 3300005438 | Ga0070701_10000189 | Ga0070701_1000018918 | 302 |
| 313 | 3300005439 | Ga0070711_100001473 | Ga0070711_1000014735 | 302 |
| 314 | 3300005439 | Ga0070711_100018206 | Ga0070711_1000182062 | 302 |
| 315 | 3300005440 | Ga0070705_100014479 | Ga0070705_1000144791 | 302 |
| 316 | 3300005441 | Ga0070700_100002302 | Ga0070700_10000230211 | 302 |
| 317 | 3300005444 | Ga0070694_100029027 | Ga0070694_1000290272 | 302 |
| 318 | 3300005455 | Ga0070663_100465125 | Ga0070663_1004651251 | 302 |
| 319 | 3300005456 | Ga0070678_100003573 | Ga0070678_10000357310 | 302 |
| 320 | 3300005456 | Ga0070678_100198970 | Ga0070678_1001989701 | 302 |
| 321 | 3300005457 | Ga0070662_100081125 | Ga0070662_1000811252 | 302 |
| 322 | 3300005459 | Ga0068867_100111685 | Ga0068867_1001116852 | 302 |
| 323 | 3300005466 | Ga0070685_10071723 | Ga0070685_100717232 | 302 |
| 324 | 3300005539 | Ga0068853_100017858 | Ga0068853_1000178583 | 302 |
| 325 | 3300005539 | Ga0068853_100246197 | Ga0068853_1002461972 | 302 |
| 326 | 3300005543 | Ga0070672_100193027 | Ga0070672_1001930272 | 302 |
| 327 | 3300005545 | Ga0070695_100001590 | Ga0070695_1000015909 | 302 |
| 328 | 3300005547 | Ga0070693_100006988 | Ga0070693_1000069883 | 302 |
| 329 | 3300005548 | Ga0070665_100004795 | Ga0070665_1000047959 | 302 |
| 330 | 3300005548 | Ga0070665_100019990 | Ga0070665_1000199902 | 302 |
| 331 | 3300005548 | Ga0070665_100066504 | Ga0070665_1000665043 | 302 |
| 332 | 3300005549 | Ga0070704_100004448 | Ga0070704_1000044487 | 302 |
| 333 | 3300005549 | Ga0070704_100378080 | Ga0070704_1003780801 | 302 |
| 334 | 3300005563 | Ga0068855_100076996 | Ga0068855_1000769963 | 302 |
| 335 | 3300005578 | Ga0068854_100052285 | Ga0068854_1000522852 | 302 |
| 336 | 3300005578 | Ga0068854_100090911 | Ga0068854_1000909112 | 302 |
| 337 | 3300005615 | Ga0070702_100050262 | Ga0070702_1000502622 | 302 |
| 338 | 3300005616 | Ga0068852_100526449 | Ga0068852_1005264492 | 302 |
| 339 | 3300005617 | Ga0068859_100017543 | Ga0068859_1000175432 | 302 |
| 340 | 3300005617 | Ga0068859_100218540 | Ga0068859_1002185402 | 302 |
| 341 | 3300005718 | Ga0068866_10026118 | Ga0068866_100261184 | 302 |
| 342 | 3300005834 | Ga0068851_10054290 | Ga0068851_100542902 | 302 |
| 343 | 3300005842 | Ga0068858_100003983 | Ga0068858_1000039832 | 302 |
| 344 | 3300005842 | Ga0068858_100046322 | Ga0068858_1000463225 | 302 |
| 345 | 3300005842 | Ga0068858_100087082 | Ga0068858_1000870822 | 302 |
| 346 | 3300005843 | Ga0068860_100003750 | Ga0068860_1000037505 | 302 |
| 347 | 3300005843 | Ga0068860_100077672 | Ga0068860_1000776722 | 302 |
| 348 | 3300005843 | Ga0068860_100128026 | Ga0068860_1001280263 | 302 |
| 349 | 3300005844 | Ga0068862_100004148 | Ga0068862_1000041482 | 302 |
| 350 | 3300005937 | Ga0081455_10042478 | Ga0081455_100424785 | 302 |
| 351 | 3300005937 | Ga0081455_10208533 | Ga0081455_102085332 | 302 |
| 352 | 3300006038 | Ga0075365_10000556 | Ga0075365_100005568 | 302 |
| 353 | 3300006038 | Ga0075365_10029812 | Ga0075365_100298123 | 302 |
| 354 | 3300006038 | Ga0075365_10040431 | Ga0075365_100404314 | 302 |
| 355 | 3300006038 | Ga0075365_10073949 | Ga0075365_100739492 | 302 |
| 356 | 3300006048 | Ga0075363_100000194 | Ga0075363_1000001944 | 302 |
| 357 | 3300006048 | Ga0075363_100022185 | Ga0075363_1000221852 | 302 |
| 358 | 3300006048 | Ga0075363_100039539 | Ga0075363_1000395392 | 302 |
| 359 | 3300006051 | Ga0075364_10000231 | Ga0075364_100002316 | 302 |
| 360 | 3300006051 | Ga0075364_10001588 | Ga0075364_100015885 | 302 |
| 361 | 3300006051 | Ga0075364_10005515 | Ga0075364_100055152 | 302 |
| 362 | 3300006051 | Ga0075364_10008632 | Ga0075364_100086326 | 302 |
| 363 | 3300006051 | Ga0075364_10013977 | Ga0075364_100139773 | 302 |
| 364 | 3300006051 | Ga0075364_10148405 | Ga0075364_101484052 | 302 |
| 365 | 3300006051 | Ga0075364_10248916 | Ga0075364_102489162 | 302 |
| 366 | 3300006173 | Ga0070716_100044694 | Ga0070716_1000446942 | 302 |
| 367 | 3300006173 | Ga0070716_100082498 | Ga0070716_1000824982 | 302 |
| 368 | 3300006175 | Ga0070712_100003572 | Ga0070712_1000035725 | 302 |
| 369 | 3300006175 | Ga0070712_100023599 | Ga0070712_1000235992 | 302 |
| 370 | 3300006177 | Ga0075362_10122666 | Ga0075362_101226662 | 302 |
| 371 | 3300006177 | Ga0075362_10145958 | Ga0075362_101459582 | 302 |
| 372 | 3300006178 | Ga0075367_10015197 | Ga0075367_100151974 | 302 |
| 373 | 3300006186 | Ga0075369_10003427 | Ga0075369_100034272 | 302 |
| 374 | 3300006186 | Ga0075369_10004740 | Ga0075369_100047402 | 302 |
| 375 | 3300006186 | Ga0075369_10006710 | Ga0075369_100067102 | 302 |
| 376 | 3300006186 | Ga0075369_10032085 | Ga0075369_100320852 | 302 |
| 377 | 3300006186 | Ga0075369_10075285 | Ga0075369_100752852 | 302 |
| 378 | 3300006353 | Ga0075370_10046207 | Ga0075370_100462072 | 302 |
| 379 | 3300006353 | Ga0075370_10107315 | Ga0075370_101073152 | 302 |
| 380 | 3300006844 | Ga0075428_100001554 | Ga0075428_10000155410 | 302 |
| 381 | 3300006846 | Ga0075430_100003634 | Ga0075430_1000036342 | 302 |
| 382 | 3300006846 | Ga0075430_100112451 | Ga0075430_1001124512 | 302 |
| 383 | 3300006847 | Ga0075431_100074570 | Ga0075431_1000745703 | 302 |
| 384 | 3300006881 | Ga0068865_100034496 | Ga0068865_1000344963 | 302 |
| 385 | 3300006931 | Ga0097620_100017544 | Ga0097620_1000175442 | 302 |
| 386 | 3300006931 | Ga0097620_100218537 | Ga0097620_1002185372 | 302 |
| 387 | 3300007788 | Ga0099795_10070507 | Ga0099795_100705071 | 302 |
| 388 | 3300009092 | Ga0105250_10029988 | Ga0105250_100299882 | 302 |
| 389 | 3300009098 | Ga0105245_10063941 | Ga0105245_100639412 | 302 |
| 390 | 3300009098 | Ga0105245_10408001 | Ga0105245_104080012 | 302 |
| 391 | 3300009101 | Ga0105247_10000797 | Ga0105247_1000079724 | 302 |
| 392 | 3300009147 | Ga0114129_10035925 | Ga0114129_100359253 | 302 |
| 393 | 3300009148 | Ga0105243_10005417 | Ga0105243_100054176 | 302 |
| 394 | 3300009174 | Ga0105241_10198389 | Ga0105241_101983892 | 302 |
| 395 | 3300009176 | Ga0105242_10000505 | Ga0105242_100005056 | 302 |
| 396 | 3300009177 | Ga0105248_10015076 | Ga0105248_100150765 | 302 |
| 397 | 3300009177 | Ga0105248_10092287 | Ga0105248_100922874 | 302 |
| 398 | 3300009545 | Ga0105237_10002160 | Ga0105237_1000216014 | 302 |
| 399 | 3300009553 | Ga0105249_10190602 | Ga0105249_101906022 | 302 |
| 400 | 3300010375 | Ga0105239_10031749 | Ga0105239_100317495 | 302 |
| 401 | 3300010375 | Ga0105239_10161431 | Ga0105239_101614312 | 302 |
| 402 | 3300010375 | Ga0105239_10280109 | Ga0105239_102801092 | 302 |
| 403 | 3300010375 | Ga0105239_10517782 | Ga0105239_105177822 | 302 |
| 404 | 3300011119 | Ga0105246_10173234 | Ga0105246_101732342 | 302 |
| 405 | 3300013105 | Ga0157369_10042531 | Ga0157369_100425312 | 302 |
| 406 | 3300013105 | Ga0157369_10230381 | Ga0157369_102303812 | 302 |
| 407 | 3300013296 | Ga0157374_10135432 | Ga0157374_101354322 | 302 |
| 408 | 3300013297 | Ga0157378_10000302 | Ga0157378_1000030257 | 302 |
| 409 | 3300013297 | Ga0157378_10032709 | Ga0157378_100327093 | 302 |
| 410 | 3300013306 | Ga0163162_10008140 | Ga0163162_1000814011 | 302 |
| 411 | 3300013306 | Ga0163162_10156085 | Ga0163162_101560852 | 302 |
| 412 | 3300013306 | Ga0163162_10344276 | Ga0163162_103442762 | 302 |
| 413 | 3300013308 | Ga0157375_10005938 | Ga0157375_1000593811 | 302 |
| 414 | 3300013308 | Ga0157375_10171318 | Ga0157375_101713183 | 302 |
| 415 | 3300014326 | Ga0157380_10003367 | Ga0157380_100033676 | 302 |
| 416 | 3300014745 | Ga0157377_10028880 | Ga0157377_100288803 | 302 |
| 417 | 3300014968 | Ga0157379_10014856 | Ga0157379_100148564 | 302 |
| 418 | 3300014968 | Ga0157379_10198896 | Ga0157379_101988962 | 302 |
| 419 | 3300017792 | Ga0163161_10000294 | Ga0163161_1000029410 | 302 |
| 420 | 3300021384 | Ga0213876_10027318 | Ga0213876_100273184 | 302 |
| 421 | 3300021388 | Ga0213875_10014815 | Ga0213875_100148152 | 302 |
| 422 | 3300025303 | Ga0209051_1000075 | Ga0209051_100007517 | 302 |
| 423 | 3300025303 | Ga0209051_1009045 | Ga0209051_10090452 | 302 |
| 424 | 3300025885 | Ga0207653_10065094 | Ga0207653_100650942 | 302 |
| 425 | 3300025898 | Ga0207692_10014424 | Ga0207692_100144241 | 302 |
| 426 | 3300025898 | Ga0207692_10097877 | Ga0207692_100978772 | 302 |
| 427 | 3300025899 | Ga0207642_10064422 | Ga0207642_100644222 | 302 |
| 428 | 3300025900 | Ga0207710_10024150 | Ga0207710_100241502 | 302 |
| 429 | 3300025900 | Ga0207710_10095645 | Ga0207710_100956451 | 302 |
| 430 | 3300025901 | Ga0207688_10001011 | Ga0207688_100010115 | 302 |
| 431 | 3300025901 | Ga0207688_10001349 | Ga0207688_1000134913 | 302 |
| 432 | 3300025903 | Ga0207680_10031553 | Ga0207680_100315532 | 302 |
| 433 | 3300025904 | Ga0207647_10029068 | Ga0207647_100290683 | 302 |
| 434 | 3300025904 | Ga0207647_10033537 | Ga0207647_100335373 | 302 |
| 435 | 3300025905 | Ga0207685_10032971 | Ga0207685_100329711 | 302 |
| 436 | 3300025906 | Ga0207699_10034658 | Ga0207699_100346582 | 302 |
| 437 | 3300025914 | Ga0207671_10035291 | Ga0207671_100352912 | 302 |
| 438 | 3300025914 | Ga0207671_10130026 | Ga0207671_101300262 | 302 |
| 439 | 3300025915 | Ga0207693_10000441 | Ga0207693_1000044122 | 302 |
| 440 | 3300025915 | Ga0207693_10003317 | Ga0207693_1000331711 | 302 |
| 441 | 3300025918 | Ga0207662_10201264 | Ga0207662_102012642 | 302 |
| 442 | 3300025927 | Ga0207687_10016144 | Ga0207687_100161443 | 302 |
| 443 | 3300025927 | Ga0207687_10123747 | Ga0207687_101237472 | 302 |
| 444 | 3300025928 | Ga0207700_10404966 | Ga0207700_104049662 | 302 |
| 445 | 3300025929 | Ga0207664_10100714 | Ga0207664_101007142 | 302 |
| 446 | 3300025929 | Ga0207664_10235637 | Ga0207664_102356372 | 302 |
| 447 | 3300025931 | Ga0207644_10019916 | Ga0207644_100199163 | 302 |
| 448 | 3300025933 | Ga0207706_10007290 | Ga0207706_100072909 | 302 |
| 449 | 3300025933 | Ga0207706_10026745 | Ga0207706_100267452 | 302 |
| 450 | 3300025935 | Ga0207709_10024191 | Ga0207709_100241912 | 302 |
| 451 | 3300025937 | Ga0207669_10017808 | Ga0207669_100178082 | 302 |
| 452 | 3300025937 | Ga0207669_10113731 | Ga0207669_101137312 | 302 |
| 453 | 3300025938 | Ga0207704_10025436 | Ga0207704_100254363 | 302 |
| 454 | 3300025939 | Ga0207665_10023426 | Ga0207665_100234262 | 302 |
| 455 | 3300025939 | Ga0207665_10227696 | Ga0207665_102276961 | 302 |
| 456 | 3300025940 | Ga0207691_10194606 | Ga0207691_101946062 | 302 |
| 457 | 3300025941 | Ga0207711_10041802 | Ga0207711_100418023 | 302 |
| 458 | 3300025942 | Ga0207689_10030924 | Ga0207689_100309245 | 302 |
| 459 | 3300025949 | Ga0207667_10157903 | Ga0207667_101579032 | 302 |
| 460 | 3300025960 | Ga0207651_10115181 | Ga0207651_101151812 | 302 |
| 461 | 3300025961 | Ga0207712_10017821 | Ga0207712_100178213 | 302 |
| 462 | 3300025972 | Ga0207668_10029135 | Ga0207668_100291353 | 302 |
| 463 | 3300025972 | Ga0207668_10032903 | Ga0207668_100329032 | 302 |
| 464 | 3300025972 | Ga0207668_10397015 | Ga0207668_103970152 | 302 |
| 465 | 3300025986 | Ga0207658_10001732 | Ga0207658_100017328 | 302 |
| 466 | 3300025986 | Ga0207658_10006674 | Ga0207658_100066744 | 302 |
| 467 | 3300025986 | Ga0207658_10035671 | Ga0207658_100356712 | 302 |
| 468 | 3300026023 | Ga0207677_10032601 | Ga0207677_100326012 | 302 |
| 469 | 3300026035 | Ga0207703_10030013 | Ga0207703_100300134 | 302 |
| 470 | 3300026035 | Ga0207703_10116642 | Ga0207703_101166421 | 302 |
| 471 | 3300026041 | Ga0207639_10009957 | Ga0207639_100099573 | 302 |
| 472 | 3300026041 | Ga0207639_10228546 | Ga0207639_102285462 | 302 |
| 473 | 3300026067 | Ga0207678_10009087 | Ga0207678_100090873 | 302 |
| 474 | 3300026067 | Ga0207678_10033853 | Ga0207678_100338534 | 302 |
| 475 | 3300026075 | Ga0207708_10003545 | Ga0207708_1000354513 | 302 |
| 476 | 3300026088 | Ga0207641_10576217 | Ga0207641_105762171 | 302 |
| 477 | 3300026089 | Ga0207648_10001766 | Ga0207648_100017665 | 302 |
| 478 | 3300026089 | Ga0207648_10112535 | Ga0207648_101125352 | 302 |
| 479 | 3300026095 | Ga0207676_10326587 | Ga0207676_103265871 | 302 |
| 480 | 3300026118 | Ga0207675_100000532 | Ga0207675_10000053220 | 302 |
| 481 | 3300026118 | Ga0207675_100010969 | Ga0207675_1000109699 | 302 |
| 482 | 3300026118 | Ga0207675_100124883 | Ga0207675_1001248832 | 302 |
| 483 | 3300026121 | Ga0207683_10000474 | Ga0207683_1000047426 | 302 |
| 484 | 3300026142 | Ga0207698_10241242 | Ga0207698_102412422 | 302 |
| 485 | 3300026142 | Ga0207698_10261325 | Ga0207698_102613252 | 302 |
| 486 | 3300028379 | Ga0268266_10002871 | Ga0268266_1000287111 | 302 |
| 487 | 3300028379 | Ga0268266_10057334 | Ga0268266_100573343 | 302 |
| 488 | 3300028381 | Ga0268264_10014172 | Ga0268264_100141725 | 302 |
| 489 | 3300031251 | Ga0265327_10002825 | Ga0265327_100028254 | 302 |
| 490 | 3300031852 | Ga0307410_10032324 | Ga0307410_100323242 | 302 |
| 491 | 3300031852 | Ga0307410_10200032 | Ga0307410_102000322 | 302 |
| 492 | 3300031901 | Ga0307406_10051168 | Ga0307406_100511682 | 302 |
| 493 | 3300031901 | Ga0307406_10193111 | Ga0307406_101931112 | 302 |
| 494 | 3300031903 | Ga0307407_10082044 | Ga0307407_100820442 | 302 |
| 495 | 3300031911 | Ga0307412_10325979 | Ga0307412_103259792 | 302 |
| 496 | 3300031995 | Ga0307409_100004944 | Ga0307409_1000049448 | 302 |
| 497 | 3300032002 | Ga0307416_100038803 | Ga0307416_1000388034 | 302 |
| 498 | 3300032005 | Ga0307411_10301757 | Ga0307411_103017572 | 302 |
| 499 | 3300032126 | Ga0307415_100188783 | Ga0307415_1001887832 | 302 |
| 500 | 3300035090 | Ga0373949_0004947 | Ga0373949_0004947_85_1014 | 302 |
| 501 | 3300036712 | Ga0316584_0018128 | Ga0316584_0018128_1450_2358 | 302 |
| 502 | 3300037853 | Ga0436364_0157880 | Ga0436364_0157880_5144_6052 | 302 |
| 503 | 3300037853 | Ga0436364_0848265 | Ga0436364_0848265_49_969 | 302 |
| 504 | 3300039437 | Ga0436365_0246124 | Ga0436365_0246124_50286_51194 | 302 |
| 505 | 3300039437 | Ga0436365_0560586 | Ga0436365_0560586_285_1205 | 302 |
| 506 | 3300039437 | Ga0436365_1111259 | Ga0436365_1111259_1571_2485 | 302 |
| 507 | 3300041411 | Ga0439466_0001043 | Ga0439466_0001043_6306_7214 | 302 |
| 508 | 3300041411 | Ga0439466_0005026 | Ga0439466_0005026_1785_2693 | 302 |
| 509 | 3300041411 | Ga0439466_0017265 | Ga0439466_0017265_1250_2158 | 302 |
| 510 | 3300041413 | Ga0439465_0000229 | Ga0439465_0000229_11661_12569 | 302 |
| 511 | 3300041413 | Ga0439465_0002796 | Ga0439465_0002796_3401_4309 | 302 |
| 512 | 3300041413 | Ga0439465_0011612 | Ga0439465_0011612_51_959 | 302 |
| 513 | 3300041997 | Ga0439431_0002101 | Ga0439431_0002101_2930_3838 | 302 |
| 514 | 3300042002 | Ga0439442_001213 | Ga0439442_001213_2826_3734 | 302 |
| 515 | 3300042005 | Ga0439448_0005972 | Ga0439448_0005972_1924_2832 | 302 |
| 516 | 3300044658 | Ga0466972_0022620 | Ga0466972_0022620_2166_3074 | 302 |
| 517 | 3300044658 | Ga0466972_0044816 | Ga0466972_0044816_1194_2102 | 302 |
| 518 | 3300044683 | Ga0466965_0001714 | Ga0466965_0001714_469_1377 | 302 |
| 519 | 3300044683 | Ga0466965_0005404 | Ga0466965_0005404_4373_5281 | 302 |
| 520 | 3300044684 | Ga0466966_0018248 | Ga0466966_0018248_2765_3673 | 302 |
| 521 | 3300044684 | Ga0466966_0187620 | Ga0466966_0187620_285_1193 | 302 |
| 522 | 3300044693 | Ga0466961_0012209 | Ga0466961_0012209_1723_2631 | 302 |
| 523 | 3300044694 | Ga0466963_0047907 | Ga0466963_0047907_308_1219 | 302 |
| 524 | 3300044694 | Ga0466963_0099325 | Ga0466963_0099325_331_1239 | 302 |
| 525 | 3300044694 | Ga0466963_0209930 | Ga0466963_0209930_334_1254 | 302 |
| 526 | 3300044719 | Ga0466971_0021833 | Ga0466971_0021833_388_1296 | 302 |
| 527 | 3300044719 | Ga0466971_0131902 | Ga0466971_0131902_53_964 | 302 |
| 528 | 3300044735 | Ga0466968_0005238 | Ga0466968_0005238_177_1091 | 302 |
| 529 | 3300044735 | Ga0466968_0079886 | Ga0466968_0079886_504_1412 | 302 |
| 530 | 3300044842 | Ga0466957_0005244 | Ga0466957_0005244_1415_2323 | 302 |
| 531 | 3300044842 | Ga0466957_0076983 | Ga0466957_0076983_686_1597 | 302 |
| 532 | 3300044901 | Ga0466960_0015609 | Ga0466960_0015609_136_1047 | 302 |
| 533 | 3300045049 | Ga0466959_0015175 | Ga0466959_0015175_4166_5074 | 302 |
| 534 | 3300045049 | Ga0466959_0022218 | Ga0466959_0022218_3513_4427 | 302 |
| 535 | 3300045049 | Ga0466959_0068946 | Ga0466959_0068946_215_1123 | 302 |
| 536 | 3300045836 | Ga0466958_0001440 | Ga0466958_0001440_8235_9143 | 302 |
| 537 | 3300045836 | Ga0466958_0005494 | Ga0466958_0005494_32_940 | 302 |
| 538 | 3300045976 | Ga0466967_0079043 | Ga0466967_0079043_83_991 | 302 |
| 539 | 3300045976 | Ga0466967_0139427 | Ga0466967_0139427_404_1315 | 302 |
| 540 | 3300045976 | Ga0466967_0213283 | Ga0466967_0213283_148_1056 | 302 |
| 541 | 3300046460 | Ga0495638_0005992 | Ga0495638_0005992_2843_3751 | 302 |
| 542 | 3300046460 | Ga0495638_0022027 | Ga0495638_0022027_3098_4006 | 302 |
| 543 | 3300047320 | Ga0495672_0007294 | Ga0495672_0007294_899_1807 | 302 |
| 544 | 3300048903 | Ga0496100_0000009 | Ga0496100_0000009_126893_127801 | 302 |
| 545 | 3300048903 | Ga0496100_0004371 | Ga0496100_0004371_3554_4462 | 302 |
| 546 | 3300048903 | Ga0496100_0005328 | Ga0496100_0005328_4799_5707 | 302 |
| 547 | 3300048903 | Ga0496100_0008313 | Ga0496100_0008313_180_1088 | 302 |
| 548 | 3300048903 | Ga0496100_0152908 | Ga0496100_0152908_153_1061 | 302 |
| 549 | 3300048903 | Ga0496100_0162809 | Ga0496100_0162809_293_1201 | 302 |
| 550 | 3300048904 | Ga0496101_0000018 | Ga0496101_0000018_188634_189542 | 302 |
| 551 | 3300048904 | Ga0496101_0000333 | Ga0496101_0000333_8319_9227 | 302 |
| 552 | 3300048904 | Ga0496101_0008486 | Ga0496101_0008486_1399_2307 | 302 |
| 553 | 3300048904 | Ga0496101_0013378 | Ga0496101_0013378_2655_3563 | 302 |
| 554 | 3300048905 | Ga0496102_0000056 | Ga0496102_0000056_150176_151084 | 302 |
| 555 | 3300048905 | Ga0496102_0003699 | Ga0496102_0003699_51_959 | 302 |
| 556 | 3300048905 | Ga0496102_0116255 | Ga0496102_0116255_1278_2186 | 302 |
| 557 | 3300048905 | Ga0496102_0150092 | Ga0496102_0150092_205_1113 | 302 |
| 558 | 3300048905 | Ga0496102_0236313 | Ga0496102_0236313_354_1262 | 302 |
| 559 | 3300048906 | Ga0496103_0000040 | Ga0496103_0000040_21607_22515 | 302 |
| 560 | 3300048906 | Ga0496103_0000666 | Ga0496103_0000666_24570_25478 | 302 |
| 561 | 3300048906 | Ga0496103_0081702 | Ga0496103_0081702_580_1509 | 302 |
| 562 | 3300048907 | Ga0496104_0005495 | Ga0496104_0005495_4358_5266 | 302 |
| 563 | 3300048908 | Ga0496105_0016138 | Ga0496105_0016138_74_982 | 302 |
| 564 | 3300048908 | Ga0496105_0079816 | Ga0496105_0079816_487_1395 | 302 |
| 565 | 3300048909 | Ga0496106_0000522 | Ga0496106_0000522_24348_25256 | 302 |
| 566 | 3300048909 | Ga0496106_0007583 | Ga0496106_0007583_332_1240 | 302 |
| 567 | 3300048909 | Ga0496106_0009318 | Ga0496106_0009318_959_1867 | 302 |
| 568 | 3300048909 | Ga0496106_0015689 | Ga0496106_0015689_3506_4414 | 302 |
| 569 | 3300048909 | Ga0496106_0071977 | Ga0496106_0071977_212_1141 | 302 |
| 570 | 3300048910 | Ga0496107_0002302 | Ga0496107_0002302_9199_10107 | 302 |
| 571 | 3300048910 | Ga0496107_0007957 | Ga0496107_0007957_4452_5360 | 302 |
| 572 | 3300048910 | Ga0496107_0020492 | Ga0496107_0020492_2458_3366 | 302 |
| 573 | 3300048910 | Ga0496107_0027130 | Ga0496107_0027130_2018_2926 | 302 |
| 574 | 3300048910 | Ga0496107_0079251 | Ga0496107_0079251_1038_1967 | 302 |
| 575 | 3300048911 | Ga0496108_0011618 | Ga0496108_0011618_5465_6394 | 302 |
| 576 | 3300048911 | Ga0496108_0020335 | Ga0496108_0020335_211_1119 | 302 |
| 577 | 3300048912 | Ga0496109_0000136 | Ga0496109_0000136_65613_66521 | 302 |
| 578 | 3300048912 | Ga0496109_0013726 | Ga0496109_0013726_3348_4277 | 302 |
| 579 | 3300048913 | Ga0496110_0000204 | Ga0496110_0000204_713_1621 | 302 |
| 580 | 3300048913 | Ga0496110_0066544 | Ga0496110_0066544_1157_2086 | 302 |
| 581 | 3300048914 | Ga0496111_0013455 | Ga0496111_0013455_3427_4335 | 302 |
| 582 | 3300048914 | Ga0496111_0244997 | Ga0496111_0244997_142_1050 | 302 |
| 583 | 3300048915 | Ga0496112_0073074 | Ga0496112_0073074_2202_3110 | 302 |
| 584 | 3300048916 | Ga0496113_0025972 | Ga0496113_0025972_629_1537 | 302 |
| 585 | 3300048916 | Ga0496113_0123295 | Ga0496113_0123295_773_1702 | 302 |
| 586 | 3300048917 | Ga0496114_0000781 | Ga0496114_0000781_9121_10029 | 302 |
| 587 | 3300048917 | Ga0496114_0001503 | Ga0496114_0001503_12578_13486 | 302 |
| 588 | 3300048917 | Ga0496114_0026468 | Ga0496114_0026468_3748_4656 | 302 |
| 589 | 3300048918 | Ga0496115_0013794 | Ga0496115_0013794_4001_4909 | 302 |
| 590 | 3300048918 | Ga0496115_0018414 | Ga0496115_0018414_595_1503 | 302 |
| 591 | 3300048919 | Ga0496116_0000056 | Ga0496116_0000056_21624_22532 | 302 |
| 592 | 3300048919 | Ga0496116_0000720 | Ga0496116_0000720_26883_27791 | 302 |
| 593 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_1858566_1859474 | 302 |
| 594 | 3300048920 | Ga0496117_0078422 | Ga0496117_0078422_1222_2130 | 302 |
| 595 | 3300048920 | Ga0496117_0103556 | Ga0496117_0103556_835_1743 | 302 |
| 596 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_1858569_1859477 | 302 |
| 597 | 3300048921 | Ga0496118_0001419 | Ga0496118_0001419_23705_24613 | 302 |
| 598 | 3300048921 | Ga0496118_0001817 | Ga0496118_0001817_26331_27239 | 302 |
| 599 | 3300048921 | Ga0496118_0018820 | Ga0496118_0018820_361_1281 | 302 |
| 600 | 3300048921 | Ga0496118_0074698 | Ga0496118_0074698_834_1742 | 302 |
| 601 | 3300048922 | Ga0496119_0000263 | Ga0496119_0000263_3367_4275 | 302 |
| 602 | 3300048922 | Ga0496119_0099044 | Ga0496119_0099044_23_931 | 302 |
| 603 | 3300048923 | Ga0496120_0000318 | Ga0496120_0000318_75491_76399 | 302 |
| 604 | 3300048923 | Ga0496120_0033872 | Ga0496120_0033872_1612_2520 | 302 |
| 605 | 3300048924 | Ga0496121_0000023 | Ga0496121_0000023_263963_264871 | 302 |
| 606 | 3300048924 | Ga0496121_0000121 | Ga0496121_0000121_21625_22533 | 302 |
| 607 | 3300048925 | Ga0496122_0000038 | Ga0496122_0000038_263963_264871 | 302 |
| 608 | 3300048925 | Ga0496122_0003651 | Ga0496122_0003651_2538_3446 | 302 |
| 609 | 3300048926 | Ga0496123_0005397 | Ga0496123_0005397_11234_12142 | 302 |
| 610 | 3300048926 | Ga0496123_0007347 | Ga0496123_0007347_5553_6461 | 302 |
| 611 | 3300048927 | Ga0496124_0000014 | Ga0496124_0000014_263963_264871 | 302 |
| 612 | 3300048928 | Ga0496125_0000020 | Ga0496125_0000020_198578_199486 | 302 |
| 613 | 3300048928 | Ga0496125_0104838 | Ga0496125_0104838_1020_1931 | 302 |
| 614 | 3300048929 | Ga0496126_0000023 | Ga0496126_0000023_263963_264871 | 302 |
| 615 | 3300048929 | Ga0496126_0001128 | Ga0496126_0001128_21008_21916 | 302 |
| 616 | 3300048929 | Ga0496126_0002192 | Ga0496126_0002192_19450_20358 | 302 |
| 617 | 3300048929 | Ga0496126_0050884 | Ga0496126_0050884_325_1233 | 302 |
| 618 | 3300048929 | Ga0496126_0054571 | Ga0496126_0054571_1549_2460 | 302 |
| 619 | 3300049570 | Ga0501033_0022206 | Ga0501033_0022206_3111_4019 | 302 |
| 620 | 3300049570 | Ga0501033_0247978 | Ga0501033_0247978_295_1203 | 302 |
| 621 | 3300049571 | Ga0501034_0006769 | Ga0501034_0006769_7427_8335 | 302 |
| 622 | 3300049573 | Ga0501037_0031554 | Ga0501037_0031554_1705_2613 | 302 |
| 623 | 3300049581 | Ga0501047_0013512 | Ga0501047_0013512_3276_4184 | 302 |
| 624 | 3300049582 | Ga0501048_0028520 | Ga0501048_0028520_1674_2582 | 302 |
| 625 | 3300049586 | Ga0501070_0005540 | Ga0501070_0005540_5732_6640 | 302 |
| 626 | 3300049822 | Ga0501035_0025498 | Ga0501035_0025498_2116_3024 | 302 |
| 627 | 3300049822 | Ga0501035_0173350 | Ga0501035_0173350_411_1319 | 302 |
| 628 | 3300049823 | Ga0501044_0009965 | Ga0501044_0009965_6892_7800 | 302 |
| 629 | 3300050490 | nmdc:mga03n38_1104_c1 | nmdc:mga03n38_1104_c1_3754_4662 | 302 |
| 630 | 3300050490 | nmdc:mga03n38_207795_c1 | nmdc:mga03n38_207795_c1_83_991 | 302 |
| 631 | 3300050490 | nmdc:mga03n38_3072_c1 | nmdc:mga03n38_3072_c1_3355_4263 | 302 |
| 632 | 3300050490 | nmdc:mga03n38_6608_c1 | nmdc:mga03n38_6608_c1_2334_3242 | 302 |
| 633 | 3300050490 | nmdc:mga03n38_66230_c1 | nmdc:mga03n38_66230_c1_201_1109 | 302 |
| 634 | 3300050491 | nmdc:mga00v17_25954_c1 | nmdc:mga00v17_25954_c1_2004_2912 | 302 |
| 635 | 3300050491 | nmdc:mga00v17_55471_c1 | nmdc:mga00v17_55471_c1_343_1251 | 302 |
| 636 | 3300050492 | nmdc:mga0yw44_192929_c1 | nmdc:mga0yw44_192929_c1_136_1044 | 302 |
| 637 | 3300050492 | nmdc:mga0yw44_32704_c1 | nmdc:mga0yw44_32704_c1_2060_2968 | 302 |
| 638 | 3300050492 | nmdc:mga0yw44_3391_c1 | nmdc:mga0yw44_3391_c1_4868_5776 | 302 |
| 639 | 3300050492 | nmdc:mga0yw44_34121_c1 | nmdc:mga0yw44_34121_c1_1341_2249 | 302 |
| 640 | 3300050492 | nmdc:mga0yw44_947_c1 | nmdc:mga0yw44_947_c1_9713_10621 | 302 |
| 641 | 3300050494 | nmdc:mga06z11_15531_c1 | nmdc:mga06z11_15531_c1_1081_1989 | 302 |
| 642 | 3300050496 | nmdc:mga07m45_12857_c1 | nmdc:mga07m45_12857_c1_1073_1981 | 302 |
| 643 | 3300050496 | nmdc:mga07m45_1930_c1 | nmdc:mga07m45_1930_c1_2082_2990 | 302 |
| 644 | 3300050507 | nmdc:mga05p37_26824_c1 | nmdc:mga05p37_26824_c1_4251_5159 | 302 |
| 645 | 3300050509 | nmdc:mga0qj67_111112_c1 | nmdc:mga0qj67_111112_c1_1291_2199 | 302 |
| 646 | 3300050509 | nmdc:mga0qj67_1960_c1 | nmdc:mga0qj67_1960_c1_9185_10093 | 302 |
| 647 | 3300050510 | nmdc:mga06r32_9678_c1 | nmdc:mga06r32_9678_c1_2118_3026 | 302 |
| 648 | 3300050516 | nmdc:mga0sz30_10235_c1 | nmdc:mga0sz30_10235_c1_456_1364 | 302 |
| 649 | 3300050516 | nmdc:mga0sz30_113834_c1 | nmdc:mga0sz30_113834_c1_259_1167 | 302 |
| 650 | 3300050516 | nmdc:mga0sz30_227_c1 | nmdc:mga0sz30_227_c1_1462_2370 | 302 |
| 651 | 3300050516 | nmdc:mga0sz30_39313_c1 | nmdc:mga0sz30_39313_c1_21_929 | 302 |
| 652 | 3300050516 | nmdc:mga0sz30_81355_c1 | nmdc:mga0sz30_81355_c1_275_1183 | 302 |
| 653 | 3300053087 | Ga0500643_009959 | Ga0500643_009959_1342_2250 | 302 |
| 654 | 3300053131 | Ga0500652_007981 | Ga0500652_007981_1446_2354 | 302 |
| 655 | 3300053136 | Ga0500559_0113175 | Ga0500559_0113175_160_1068 | 302 |
| 656 | 3300053139 | Ga0500568_0082772 | Ga0500568_0082772_236_1144 | 302 |
| 657 | 3300053158 | Ga0500627_0008006 | Ga0500627_0008006_2089_2997 | 302 |
| 658 | 3300053158 | Ga0500627_0014230 | Ga0500627_0014230_1242_2150 | 302 |
| 659 | 3300053730 | Ga0500645_000035 | Ga0500645_000035_81721_82653 | 302 |
| 660 | 3300053730 | Ga0500645_000035 | Ga0500645_000035_88802_89713 | 302 |
| 661 | 3300061719 | Ga0466962_0012329 | Ga0466962_0012329_999_1907 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zi8-assembly1.cif.gz_A | crystal structure of the hsac extradiol dioxygenase from m. tuberculosis in complex with 3,4-dihydroxy-9,10-seconandrost-1,3,5(10)-triene-9,17-dione (dhsa) | 0.9615 | 1 | 292 |
| 6l3w-assembly1.cif.gz_A | crystal structure of bphc, a halotolerant catechol dioxygenase | 0.9393 | 4 | 299 |
| 1kmy-assembly1.cif.gz_A | crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with 2,3-dihydroxybiphenyl under anaerobic condition | 0.9381 | 4 | 293 |
| 1dhy-assembly1.cif.gz_A | kks102 bphc enzyme | 0.9374 | 4 | 292 |
| 2wl9-assembly1.cif.gz_D | crystal structure of catechol 2,3-dioxygenase | 0.9364 | 2 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNW7_1_130_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.972 | 1 | 129 | 3.10.180.10 |
| af_P9WNW7_1_130_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9574 | 1 | 129 | 3.10.180.10 |
| 2zyqB02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9428 | 135 | 291 | 3.10.180.10 |
| 1hanA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9322 | 136 | 292 | 3.10.180.10 |
| 1eilA01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.931 | 7 | 130 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V7JIJ6-F1-model_v4 | deleted | 0.9983 | 1 | 301 |
|
| AF-A0A2S9FBA0-F1-model_v4 | 2,3-dihydroxybiphenyl 1,2-dioxygenase | 0.9958 | 63 | 301 |
GO:0051213
|
| AF-A0A7X5ZE51-F1-model_v4 | 2,3-dihydroxybiphenyl 1,2-dioxygenase | 0.9951 | 1 | 301 |
GO:0005506
GO:0042178 GO:0051213 |
| AF-V7JIJ6-F1-model_v4 | deleted | 0.995 | 1 | 301 |
|
| AF-A0A1V3XAP6-F1-model_v4 | Glyoxalase/Bleomycin resistance /Dioxygenase superfamily protein | 0.9923 | 211 | 292 |
GO:0008198
GO:0009056 GO:0051213 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar