F473386

General Info

Members Datasets Scaffolds Average Seq Length
661 248 1322 157

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100446542|Ga0068862_1004465422
Length 175
Sequence LCVDSVASSSGEGGRDMTAKSDFTEEEWIQVRRAPFVAGMAITLADPGGPIEVAKESVATIKSATNPPSREQLIAEIALDIQSMTQQKQNPLGDFKLTKGTEAGAQVLDELRAAKGIVSSKATPEEDAAFSQWLVTTAQAAADAAKEGGFMGFRATRVSEGEKDMLDRVRSAVGA

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
156 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
157 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
219 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
220 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
246 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
247 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
248 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0.45
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0
Rhizoplane 13.62
Rhizosphere 84.57
Stem 0
Stem Tuber 0
Unclassified 14.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100446542 3300005844 Bacteria 1218
2 JGI24738J21930_10009075 3300002075 Unclassified 2249
3 JGI24744J21845_10003109 3300002077 Bacteria 3402
4 JGI25405J52794_10014869 3300003911 Bacteria 1524
5 JGI25405J52794_10021911 3300003911 Bacteria 1293
6 Ga0070658_10388520 3300005327 Unclassified 1198
7 Ga0070658_10866315 3300005327 Bacteria 785
8 Ga0070683_100032655 3300005329 Bacteria 4741
9 Ga0070683_100088472 3300005329 Unclassified 2906
10 Ga0070683_100124027 3300005329 Bacteria 2441
11 Ga0070683_100543214 3300005329 Bacteria 1111
12 Ga0070683_100568845 3300005329 Bacteria 1084
13 Ga0070683_100804043 3300005329 Bacteria 901
14 Ga0070670_101737827 3300005331 Bacteria 574
15 Ga0070677_10022382 3300005333 Unclassified 2327
16 Ga0068869_100232195 3300005334 Unclassified 1466
17 Ga0070682_100007506 3300005337 Bacteria 6146
18 Ga0070682_100028384 3300005337 Bacteria 3366
19 Ga0070682_100078993 3300005337 Bacteria 2124
20 Ga0070682_100085046 3300005337 Bacteria 2057
21 Ga0070682_100752349 3300005337 Unclassified 787
22 Ga0068868_100021601 3300005338 Bacteria 4849
23 Ga0068868_100147812 3300005338 Bacteria 1933
24 Ga0068868_100904571 3300005338 Bacteria 802
25 Ga0070660_100462502 3300005339 Bacteria 1053
26 Ga0070660_101223633 3300005339 Unclassified 637
27 Ga0070692_10001752 3300005345 Bacteria 8099
28 Ga0070692_10480449 3300005345 Unclassified 801
29 Ga0070668_100447218 3300005347 Unclassified 1110
30 Ga0070668_100586785 3300005347 Bacteria 974
31 Ga0070675_100077155 3300005354 Unclassified 2773
32 Ga0070675_100962893 3300005354 Bacteria 783
33 Ga0070671_101758353 3300005355 Bacteria 551
34 Ga0070674_100062215 3300005356 Unclassified 2608
35 Ga0070674_100486336 3300005356 Bacteria 1025
36 Ga0070674_100713309 3300005356 Bacteria 858
37 Ga0070674_100877223 3300005356 Unclassified 780
38 Ga0070673_100018803 3300005364 Bacteria 4948
39 Ga0070688_100320471 3300005365 Unclassified 1126
40 Ga0070659_100089798 3300005366 Bacteria 2462
41 Ga0070659_100163727 3300005366 Bacteria 1819
42 Ga0070701_10004458 3300005438 Bacteria 5676
43 Ga0070700_100004932 3300005441 Bacteria 7019
44 Ga0070700_100226354 3300005441 Bacteria 1328
45 Ga0070694_101123615 3300005444 Unclassified 656
46 Ga0070663_100335555 3300005455 Bacteria 1220
47 Ga0070663_101283437 3300005455 Bacteria 646
48 Ga0070678_100486929 3300005456 Bacteria 1086
49 Ga0070678_101122242 3300005456 Bacteria 727
50 Ga0070662_100007456 3300005457 Bacteria 7091
51 Ga0070662_100965311 3300005457 Unclassified 729
52 Ga0068867_100029071 3300005459 Bacteria 3982
53 Ga0068867_100222304 3300005459 Bacteria 1522
54 Ga0068867_100688595 3300005459 Unclassified 901
55 Ga0070685_10092680 3300005466 Unclassified 1831
56 Ga0070685_10481500 3300005466 Bacteria 875
57 Ga0070685_10846530 3300005466 Bacteria 677
58 Ga0070679_100535360 3300005530 Bacteria 1115
59 Ga0070679_100769432 3300005530 Bacteria 906
60 Ga0070684_100014497 3300005535 Bacteria 6389
61 Ga0070684_100165775 3300005535 Bacteria 2005
62 Ga0070684_100484378 3300005535 Unclassified 1145
63 Ga0070684_100503096 3300005535 Bacteria 1122
64 Ga0070684_100531024 3300005535 Bacteria 1091
65 Ga0070684_100845029 3300005535 Bacteria 857
66 Ga0070684_101113493 3300005535 Unclassified 742
67 Ga0070672_100008593 3300005543 Bacteria 6993
68 Ga0070672_100194418 3300005543 Bacteria 1695
69 Ga0070672_100810910 3300005543 Unclassified 824
70 Ga0070686_100402906 3300005544 Bacteria 1041
71 Ga0070693_100113454 3300005547 Bacteria 1671
72 Ga0070693_100460100 3300005547 Unclassified 895
73 Ga0070693_100736706 3300005547 Bacteria 725
74 Ga0070665_100646347 3300005548 Bacteria 1071
75 Ga0070664_100512838 3300005564 Bacteria 1106
76 Ga0068857_100230595 3300005577 Unclassified 1693
77 Ga0068854_100899554 3300005578 Bacteria 778
78 Ga0068856_100911635 3300005614 Bacteria 898
79 Ga0068856_101624997 3300005614 Unclassified 659
80 Ga0070702_100091411 3300005615 Unclassified 1847
81 Ga0070702_100167798 3300005615 Bacteria 1425
82 Ga0070702_100289415 3300005615 Bacteria 1128
83 Ga0070702_100449846 3300005615 Bacteria 934
84 Ga0070702_100710580 3300005615 Bacteria 767
85 Ga0068852_100071523 3300005616 Bacteria 3046
86 Ga0068852_101330156 3300005616 Bacteria 740
87 Ga0068859_101088240 3300005617 Unclassified 879
88 Ga0068864_100065231 3300005618 Bacteria 3159
89 Ga0068864_100302744 3300005618 Unclassified 1497
90 Ga0068864_101730266 3300005618 Bacteria 630
91 Ga0068864_102100415 3300005618 Unclassified 571
92 Ga0068866_10009295 3300005718 Bacteria 4168
93 Ga0068866_10069682 3300005718 Bacteria 1853
94 Ga0068866_11011226 3300005718 Bacteria 591
95 Ga0068861_100005524 3300005719 Bacteria 8564
96 Ga0068861_100185448 3300005719 Bacteria 1735
97 Ga0068861_100334885 3300005719 Bacteria 1323
98 Ga0068861_100450820 3300005719 Bacteria 1153
99 Ga0068861_100813336 3300005719 Bacteria 878
100 Ga0068851_10171077 3300005834 Bacteria 1199
101 Ga0068851_10295988 3300005834 Unclassified 929
102 Ga0068870_10002761 3300005840 Bacteria 7375
103 Ga0068863_100245296 3300005841 Bacteria 1729
104 Ga0068858_100302060 3300005842 Bacteria 1527
105 Ga0068858_100612142 3300005842 Bacteria 1057
106 Ga0068860_100147105 3300005843 Bacteria 2267
107 Ga0068860_100577049 3300005843 Bacteria 1128
108 Ga0068862_100133096 3300005844 Unclassified 2201
109 Ga0081455_10000201 3300005937 Bacteria 76008
110 Ga0081455_10004225 3300005937 Bacteria 16189
111 Ga0081455_10007760 3300005937 Bacteria 11251
112 Ga0081455_10012750 3300005937 Bacteria 8360
113 Ga0081455_10021400 3300005937 Bacteria 6066
114 Ga0081455_10157409 3300005937 Bacteria 1745
115 Ga0081455_10220451 3300005937 Bacteria 1406
116 Ga0081538_10025167 3300005981 Bacteria 4209
117 Ga0075365_10095754 3300006038 Bacteria 2028
118 Ga0075368_10020360 3300006042 Bacteria 2512
119 Ga0075363_100153293 3300006048 Bacteria 1301
120 Ga0075364_10219643 3300006051 Bacteria 1289
121 Ga0075432_10002266 3300006058 Bacteria 6398
122 Ga0075432_10003696 3300006058 Bacteria 5209
123 Ga0075432_10090202 3300006058 Bacteria 1121
124 Ga0075367_10482016 3300006178 Bacteria 786
125 Ga0068871_100154760 3300006358 Unclassified 1957
126 Ga0068871_101079672 3300006358 Bacteria 750
127 Ga0075428_100000783 3300006844 Bacteria 33111
128 Ga0075428_100003037 3300006844 Bacteria 18321
129 Ga0075428_100007448 3300006844 Bacteria 12126
130 Ga0075428_100130456 3300006844 Bacteria 2734
131 Ga0075428_100366447 3300006844 Bacteria 1545
132 Ga0075428_100532291 3300006844 Bacteria 1256
133 Ga0075428_100550453 3300006844 Bacteria 1233
134 Ga0075428_100592202 3300006844 Bacteria 1184
135 Ga0075430_100002901 3300006846 Bacteria 14347
136 Ga0075430_100014583 3300006846 Bacteria 6695
137 Ga0075430_100623095 3300006846 Bacteria 890
138 Ga0075431_100002472 3300006847 Bacteria 17811
139 Ga0075431_100003106 3300006847 Bacteria 16077
140 Ga0075431_100214439 3300006847 Bacteria 1965
141 Ga0075431_100319829 3300006847 Bacteria 1565
142 Ga0075431_100435212 3300006847 Bacteria 1309
143 Ga0075431_100488917 3300006847 Unclassified 1223
144 Ga0075433_10040050 3300006852 Bacteria 4054
145 Ga0075433_10053160 3300006852 Bacteria 3530
146 Ga0075433_10200844 3300006852 Bacteria 1772
147 Ga0075434_100004227 3300006871 Bacteria 12872
148 Ga0075434_100064387 3300006871 Bacteria 3650
149 Ga0075434_100949694 3300006871 Unclassified 874
150 Ga0075429_100003168 3300006880 Bacteria 13983
151 Ga0075429_100061737 3300006880 Bacteria 3265
152 Ga0075429_100073962 3300006880 Bacteria 2968
153 Ga0075429_100185908 3300006880 Bacteria 1821
154 Ga0068865_100059114 3300006881 Bacteria 2680
155 Ga0068865_100791447 3300006881 Bacteria 817
156 Ga0068865_101197302 3300006881 Bacteria 672
157 Ga0075436_100009075 3300006914 Bacteria 6804
158 Ga0097620_101088336 3300006931 Unclassified 879
159 Ga0075435_100002623 3300007076 Bacteria 11975
160 Ga0105244_10243795 3300009036 Unclassified 839
161 Ga0111539_10015272 3300009094 Bacteria 9565
162 Ga0111539_10105835 3300009094 Bacteria 3300
163 Ga0111539_10513556 3300009094 Unclassified 1396
164 Ga0111539_10532982 3300009094 Bacteria 1368
165 Ga0111539_11183258 3300009094 Unclassified 888
166 Ga0111539_11932875 3300009094 Bacteria 684
167 Ga0105245_10022530 3300009098 Bacteria 5530
168 Ga0105245_10047452 3300009098 Bacteria 3840
169 Ga0105245_10074038 3300009098 Bacteria 3098
170 Ga0105245_10304601 3300009098 Unclassified 1564
171 Ga0105245_10483281 3300009098 Bacteria 1252
172 Ga0105245_10534054 3300009098 Bacteria 1193
173 Ga0105245_10615808 3300009098 Bacteria 1113
174 Ga0114129_10002404 3300009147 Bacteria 25996
175 Ga0114129_10005929 3300009147 Bacteria 17292
176 Ga0114129_10051461 3300009147 Bacteria 5782
177 Ga0114129_10142634 3300009147 Bacteria 3282
178 Ga0114129_10569142 3300009147 Bacteria 1471
179 Ga0105243_10021261 3300009148 Bacteria 4925
180 Ga0105243_10038740 3300009148 Bacteria 3713
181 Ga0105243_10071647 3300009148 Unclassified 2803
182 Ga0105243_10092876 3300009148 Bacteria 2489
183 Ga0105243_10101368 3300009148 Bacteria 2390
184 Ga0105243_10154954 3300009148 Bacteria 1969
185 Ga0105243_10407225 3300009148 Unclassified 1265
186 Ga0105243_10653325 3300009148 Unclassified 1019
187 Ga0105243_10701171 3300009148 Bacteria 987
188 Ga0105243_10914954 3300009148 Bacteria 873
189 Ga0105243_11035833 3300009148 Bacteria 825
190 Ga0105243_11868146 3300009148 Unclassified 633
191 Ga0105242_10139630 3300009176 Bacteria 2101
192 Ga0105242_12158597 3300009176 Bacteria 601
193 Ga0105248_10013985 3300009177 Bacteria 8830
194 Ga0105248_10321833 3300009177 Bacteria 1742
195 Ga0105248_10484420 3300009177 Bacteria 1394
196 Ga0105248_11361259 3300009177 Bacteria 803
197 Ga0105248_12198649 3300009177 Bacteria 628
198 Ga0105238_10040351 3300009551 Bacteria 4730
199 Ga0105238_10105310 3300009551 Bacteria 2802
200 Ga0105238_10367695 3300009551 Bacteria 1428
201 Ga0105238_11167126 3300009551 Bacteria 794
202 Ga0105238_11196568 3300009551 Unclassified 784
203 Ga0105238_11323654 3300009551 Bacteria 747
204 Ga0105238_12208210 3300009551 Bacteria 585
205 Ga0105249_10032754 3300009553 Bacteria 4703
206 Ga0105249_10048009 3300009553 Bacteria 3892
207 Ga0105249_10154390 3300009553 Bacteria 2213
208 Ga0105249_10305041 3300009553 Bacteria 1598
209 Ga0105249_10364599 3300009553 Bacteria 1467
210 Ga0105249_10915490 3300009553 Bacteria 944
211 Ga0105249_10943149 3300009553 Unclassified 931
212 Ga0105249_11466175 3300009553 Bacteria 755
213 Ga0105249_12375390 3300009553 Bacteria 603
214 Ga0105239_10023970 3300010375 Bacteria 6721
215 Ga0105239_11108078 3300010375 Bacteria 911
216 Ga0105239_12749841 3300010375 Bacteria 574
217 Ga0105246_10050704 3300011119 Bacteria 2847
218 Ga0105246_10267481 3300011119 Bacteria 1365
219 Ga0105246_10351689 3300011119 Bacteria 1208
220 Ga0105246_10469588 3300011119 Unclassified 1062
221 Ga0157369_10602973 3300013105 Bacteria 1133
222 Ga0157369_10674499 3300013105 Bacteria 1065
223 Ga0157374_10278508 3300013296 Bacteria 1651
224 Ga0157374_11855238 3300013296 Bacteria 628
225 Ga0157378_11470042 3300013297 Bacteria 725
226 Ga0163162_10159969 3300013306 Bacteria 2374
227 Ga0163162_10167448 3300013306 Bacteria 2321
228 Ga0163162_10333303 3300013306 Bacteria 1650
229 Ga0163162_10636848 3300013306 Bacteria 1191
230 Ga0163162_11508029 3300013306 Bacteria 766
231 Ga0157372_10030690 3300013307 Bacteria 5881
232 Ga0157372_10252926 3300013307 Bacteria 2045
233 Ga0157372_10583803 3300013307 Bacteria 1303
234 Ga0157372_10708167 3300013307 Bacteria 1171
235 Ga0157372_10979233 3300013307 Bacteria 980
236 Ga0157372_11397033 3300013307 Bacteria 807
237 Ga0157375_10001919 3300013308 Bacteria 17881
238 Ga0157375_10076144 3300013308 Bacteria 3381
239 Ga0157375_10234385 3300013308 Bacteria 1995
240 Ga0157375_10709585 3300013308 Bacteria 1159
241 Ga0157375_10742478 3300013308 Bacteria 1133
242 Ga0157375_10778921 3300013308 Bacteria 1106
243 Ga0157375_10990811 3300013308 Bacteria 981
244 Ga0157375_12129036 3300013308 Bacteria 668
245 Ga0163163_10042590 3300014325 Bacteria 4447
246 Ga0163163_10070862 3300014325 Bacteria 3472
247 Ga0163163_10085916 3300014325 Bacteria 3154
248 Ga0163163_10133475 3300014325 Bacteria 2523
249 Ga0163163_10329689 3300014325 Bacteria 1581
250 Ga0163163_10375804 3300014325 Bacteria 1478
251 Ga0163163_10760344 3300014325 Bacteria 1032
252 Ga0163163_11077731 3300014325 Bacteria 866
253 Ga0163163_11092316 3300014325 Bacteria 861
254 Ga0163163_11168264 3300014325 Bacteria 832
255 Ga0157380_10037552 3300014326 Bacteria 3754
256 Ga0157380_10060002 3300014326 Bacteria 3038
257 Ga0157380_10072332 3300014326 Bacteria 2793
258 Ga0157380_10359097 3300014326 Bacteria 1366
259 Ga0157380_10391610 3300014326 Bacteria 1315
260 Ga0157380_10796021 3300014326 Bacteria 962
261 Ga0157377_10009526 3300014745 Bacteria 4770
262 Ga0157377_10045366 3300014745 Bacteria 2455
263 Ga0157377_10284266 3300014745 Bacteria 1085
264 Ga0157377_10579992 3300014745 Bacteria 797
265 Ga0157377_10601499 3300014745 Bacteria 784
266 Ga0157379_10768136 3300014968 Bacteria 908
267 Ga0157376_10437244 3300014969 Bacteria 1273
268 Ga0157376_10599139 3300014969 Bacteria 1096
269 Ga0163161_10308363 3300017792 Bacteria 1248
270 Ga0163161_10363724 3300017792 Bacteria 1153
271 Ga0163161_11106539 3300017792 Unclassified 681
272 Ga0206356_11647684 3300020070 Unclassified 529
273 Ga0206353_10160592 3300020082 Unclassified 662
274 Ga0224712_10404523 3300022467 Unclassified 651
275 Ga0207697_10053328 3300025315 Unclassified 1674
276 Ga0207682_10178452 3300025893 Bacteria 969
277 Ga0207642_10040031 3300025899 Bacteria 2042
278 Ga0207642_10116379 3300025899 Bacteria 1371
279 Ga0207688_10024960 3300025901 Bacteria 3280
280 Ga0207688_10169573 3300025901 Bacteria 1297
281 Ga0207688_10203801 3300025901 Bacteria 1187
282 Ga0207647_10139709 3300025904 Unclassified 1420
283 Ga0207647_10141978 3300025904 Bacteria 1407
284 Ga0207643_10001431 3300025908 Bacteria 13685
285 Ga0207643_10594764 3300025908 Bacteria 712
286 Ga0207705_10134494 3300025909 Unclassified 1842
287 Ga0207705_11395502 3300025909 Bacteria 533
288 Ga0207662_10044338 3300025918 Bacteria 2626
289 Ga0207662_10539168 3300025918 Bacteria 807
290 Ga0207652_10526440 3300025921 Bacteria 1063
291 Ga0207652_10674746 3300025921 Unclassified 923
292 Ga0207694_10092361 3300025924 Bacteria 2389
293 Ga0207694_10143874 3300025924 Unclassified 1918
294 Ga0207694_10626213 3300025924 Bacteria 906
295 Ga0207694_10810146 3300025924 Bacteria 791
296 Ga0207694_11021728 3300025924 Bacteria 700
297 Ga0207659_10598471 3300025926 Bacteria 940
298 Ga0207659_10896367 3300025926 Bacteria 762
299 Ga0207687_10029485 3300025927 Bacteria 3692
300 Ga0207687_10332317 3300025927 Bacteria 1233
301 Ga0207687_10454675 3300025927 Bacteria 1062
302 Ga0207687_10515753 3300025927 Bacteria 999
303 Ga0207644_10456997 3300025931 Bacteria 1050
304 Ga0207690_10028893 3300025932 Bacteria 3518
305 Ga0207706_10006460 3300025933 Bacteria 10886
306 Ga0207706_10079520 3300025933 Bacteria 2883
307 Ga0207686_10087213 3300025934 Bacteria 2052
308 Ga0207686_10221494 3300025934 Bacteria 1366
309 Ga0207686_10258735 3300025934 Bacteria 1275
310 Ga0207686_11455492 3300025934 Unclassified 564
311 Ga0207709_10044866 3300025935 Bacteria 2674
312 Ga0207709_10118346 3300025935 Bacteria 1784
313 Ga0207709_10140461 3300025935 Bacteria 1659
314 Ga0207709_10192932 3300025935 Bacteria 1448
315 Ga0207709_10533894 3300025935 Bacteria 920
316 Ga0207709_10710146 3300025935 Bacteria 805
317 Ga0207709_11284487 3300025935 Bacteria 604
318 Ga0207669_10029656 3300025937 Bacteria 3029
319 Ga0207669_10074140 3300025937 Bacteria 2151
320 Ga0207669_10379278 3300025937 Unclassified 1101
321 Ga0207669_10433488 3300025937 Bacteria 1037
322 Ga0207669_10751953 3300025937 Bacteria 805
323 Ga0207704_10490139 3300025938 Unclassified 988
324 Ga0207704_10729084 3300025938 Bacteria 823
325 Ga0207691_10002825 3300025940 Bacteria 16922
326 Ga0207691_10157440 3300025940 Bacteria 1994
327 Ga0207691_10331591 3300025940 Bacteria 1304
328 Ga0207711_10161138 3300025941 Unclassified 2030
329 Ga0207711_10616289 3300025941 Bacteria 1013
330 Ga0207711_11042973 3300025941 Bacteria 758
331 Ga0207689_10118052 3300025942 Bacteria 2181
332 Ga0207689_10260503 3300025942 Bacteria 1435
333 Ga0207661_10058306 3300025944 Bacteria 3107
334 Ga0207661_10077797 3300025944 Unclassified 2729
335 Ga0207661_10227275 3300025944 Bacteria 1651
336 Ga0207661_10520833 3300025944 Bacteria 1088
337 Ga0207661_10691716 3300025944 Bacteria 938
338 Ga0207661_10783623 3300025944 Unclassified 878
339 Ga0207661_11289729 3300025944 Bacteria 671
340 Ga0207667_10745886 3300025949 Bacteria 979
341 Ga0207651_10344691 3300025960 Bacteria 1253
342 Ga0207651_11061723 3300025960 Bacteria 725
343 Ga0207712_10057152 3300025961 Bacteria 2751
344 Ga0207712_10073401 3300025961 Bacteria 2467
345 Ga0207712_10161749 3300025961 Bacteria 1741
346 Ga0207712_11508075 3300025961 Bacteria 602
347 Ga0207712_11598680 3300025961 Bacteria 584
348 Ga0207668_10096013 3300025972 Bacteria 2190
349 Ga0207668_10219984 3300025972 Bacteria 1524
350 Ga0207640_10438009 3300025981 Bacteria 1074
351 Ga0207658_10166407 3300025986 Bacteria 1812
352 Ga0207677_10382624 3300026023 Unclassified 1188
353 Ga0207677_10694392 3300026023 Unclassified 902
354 Ga0207677_11609360 3300026023 Bacteria 601
355 Ga0207678_10826643 3300026067 Unclassified 818
356 Ga0207708_10001532 3300026075 Bacteria 17212
357 Ga0207708_10156514 3300026075 Bacteria 1797
358 Ga0207708_10286961 3300026075 Unclassified 1335
359 Ga0207708_10452205 3300026075 Bacteria 1070
360 Ga0207702_10385435 3300026078 Bacteria 1349
361 Ga0207648_10058747 3300026089 Bacteria 3354
362 Ga0207648_10115037 3300026089 Bacteria 2363
363 Ga0207648_10384512 3300026089 Bacteria 1269
364 Ga0207676_11080276 3300026095 Bacteria 793
365 Ga0207676_11743830 3300026095 Bacteria 621
366 Ga0207675_100004494 3300026118 Bacteria 13475
367 Ga0207675_100008587 3300026118 Bacteria 9607
368 Ga0207675_100070909 3300026118 Bacteria 3257
369 Ga0207675_100101448 3300026118 Bacteria 2711
370 Ga0207675_100123618 3300026118 Bacteria 2450
371 Ga0207675_100366967 3300026118 Bacteria 1413
372 Ga0207683_10027540 3300026121 Bacteria 4911
373 Ga0207683_10464667 3300026121 Bacteria 1167
374 Ga0207683_10686456 3300026121 Unclassified 949
375 Ga0207683_10879475 3300026121 Bacteria 832
376 Ga0207698_11147442 3300026142 Bacteria 790
377 Ga0207698_11151811 3300026142 Bacteria 789
378 Ga0207698_11218372 3300026142 Unclassified 767
379 Ga0207428_10000752 3300027907 Bacteria 37021
380 Ga0207428_10003453 3300027907 Bacteria 15343
381 Ga0207428_10003523 3300027907 Bacteria 15148
382 Ga0268265_10091750 3300028380 Bacteria 2430
383 Ga0268265_10398775 3300028380 Bacteria 1271
384 Ga0268264_11371901 3300028381 Bacteria 717
385 Ga0307408_100334220 3300031548 Bacteria 1280
386 Ga0307408_100520239 3300031548 Bacteria 1045
387 Ga0307405_10004385 3300031731 Bacteria 6663
388 Ga0307413_10180921 3300031824 Bacteria 1503
389 Ga0307413_11105635 3300031824 Bacteria 685
390 Ga0307410_10005569 3300031852 Bacteria 6686
391 Ga0307410_10006765 3300031852 Bacteria 6217
392 Ga0307410_10177113 3300031852 Bacteria 1611
393 Ga0307410_10400390 3300031852 Bacteria 1109
394 Ga0307410_11940024 3300031852 Bacteria 525
395 Ga0307406_10089149 3300031901 Bacteria 2071
396 Ga0307406_10113661 3300031901 Bacteria 1869
397 Ga0307406_10314992 3300031901 Bacteria 1208
398 Ga0307407_10001429 3300031903 Bacteria 8638
399 Ga0307407_10016884 3300031903 Bacteria 3646
400 Ga0307407_10036606 3300031903 Bacteria 2705
401 Ga0307407_10530773 3300031903 Bacteria 867
402 Ga0307412_10570441 3300031911 Bacteria 953
403 Ga0307409_100097709 3300031995 Bacteria 2426
404 Ga0307409_100182883 3300031995 Bacteria 1857
405 Ga0307409_100191456 3300031995 Bacteria 1821
406 Ga0307409_100291092 3300031995 Bacteria 1514
407 Ga0307409_100439414 3300031995 Bacteria 1256
408 Ga0307409_101991091 3300031995 Bacteria 610
409 Ga0307416_100032089 3300032002 Bacteria 3964
410 Ga0307416_100419283 3300032002 Bacteria 1382
411 Ga0307416_100673729 3300032002 Bacteria 1121
412 Ga0307416_102322598 3300032002 Bacteria 636
413 Ga0307414_10035195 3300032004 Bacteria 3330
414 Ga0307414_10046507 3300032004 Bacteria 2979
415 Ga0307411_10020714 3300032005 Bacteria 3832
416 Ga0307411_10077503 3300032005 Bacteria 2275
417 Ga0307411_10229213 3300032005 Bacteria 1447
418 Ga0307411_10839773 3300032005 Bacteria 812
419 Ga0307415_100022111 3300032126 Bacteria 3920
420 Ga0307415_100107310 3300032126 Bacteria 2063
421 Ga0373958_0062444 3300034819 Unclassified 810
422 Ga0373952_0067736 3300035092 Bacteria 887
423 Ga0373960_0342773 3300035121 Bacteria 565
424 Ga0373931_0430982 3300035691 Bacteria 840
425 Ga0373931_0453687 3300035691 Bacteria 820
426 Ga0395900_0276456 3300037418 Unclassified 1673
427 Ga0395900_0409704 3300037418 Bacteria 1318
428 Ga0395900_0666806 3300037418 Bacteria 976
429 Ga0395898_0061536 3300037466 Bacteria 3647
430 Ga0395898_0189251 3300037466 Bacteria 1967
431 Ga0395898_0388017 3300037466 Bacteria 1332
432 Ga0395901_0010566 3300038443 Bacteria 9353
433 Ga0395901_0078673 3300038443 Bacteria 3443
434 Ga0395901_1343779 3300038443 Unclassified 675
435 Ga0242419_007915 3300038698 Unclassified 789
436 Ga0451789_0945468 3300041443 Bacteria 592
437 Ga0451798_0796952 3300041458 Bacteria 759
438 Ga0451800_0629605 3300041459 Bacteria 878
439 Ga0451802_1449987 3300041460 Bacteria 966
440 Ga0451847_0529191 3300041503 Unclassified 518
441 Ga0451853_0897774 3300041512 Bacteria 932
442 Ga0439450_126792 3300042008 Bacteria 660
443 Ga0439450_147878 3300042008 Bacteria 615
444 Ga0439464_0030568 3300042439 Bacteria 1509
445 Ga0439440_0016170 3300042993 Bacteria 1629
446 Ga0439440_0109813 3300042993 Unclassified 758
447 Ga0466965_0155671 3300044683 Bacteria 1196
448 Ga0466965_0230550 3300044683 Bacteria 989
449 Ga0466961_0109070 3300044693 Bacteria 1742
450 Ga0466963_0036839 3300044694 Bacteria 3191
451 Ga0466964_0190293 3300044706 Bacteria 979
452 Ga0466970_0012932 3300044765 Bacteria 4275
453 Ga0466957_0095702 3300044842 Bacteria 1865
454 Ga0466957_0311373 3300044842 Bacteria 1060
455 Ga0466960_0008687 3300044901 Bacteria 4168
456 Ga0466960_0054202 3300044901 Bacteria 1946
457 Ga0466958_0838471 3300045836 Unclassified 600
458 Ga0466967_0244797 3300045976 Bacteria 1711
459 Ga0466967_0484341 3300045976 Bacteria 1212
460 Ga0466967_0798947 3300045976 Bacteria 937
461 Ga0495629_0515990 3300046459 Bacteria 805
462 Ga0495653_0401669 3300046463 Bacteria 871
463 Ga0495582_0226912 3300046473 Bacteria 1069
464 Ga0495608_0406910 3300046511 Bacteria 832
465 Ga0495620_0234336 3300046515 Unclassified 701
466 Ga0495587_0586445 3300046536 Bacteria 614
467 Ga0495597_0369101 3300046542 Bacteria 549
468 Ga0495656_0716787 3300046615 Bacteria 539
469 Ga0495658_0375172 3300046683 Bacteria 905
470 Ga0495658_0554516 3300046683 Unclassified 736
471 Ga0495649_0388263 3300046694 Bacteria 702
472 Ga0495674_1000234 3300047319 Bacteria 641
473 Ga0496100_0019560 3300048903 Bacteria 4043
474 Ga0496100_0069929 3300048903 Bacteria 2339
475 Ga0496100_0369447 3300048903 Bacteria 1087
476 Ga0496100_0811566 3300048903 Bacteria 733
477 Ga0496101_0014130 3300048904 Bacteria 5361
478 Ga0496101_0017487 3300048904 Bacteria 4864
479 Ga0496101_0023006 3300048904 Bacteria 4299
480 Ga0496102_0011373 3300048905 Bacteria 7670
481 Ga0496102_0028598 3300048905 Bacteria 4980
482 Ga0496102_0440331 3300048905 Bacteria 1223
483 Ga0496102_0530204 3300048905 Bacteria 1100
484 Ga0496102_0657797 3300048905 Bacteria 971
485 Ga0496102_0687892 3300048905 Bacteria 946
486 Ga0496102_0771198 3300048905 Bacteria 884
487 Ga0496103_0026833 3300048906 Bacteria 3486
488 Ga0496103_0063087 3300048906 Bacteria 2307
489 Ga0496103_0397765 3300048906 Unclassified 885
490 Ga0496104_0005520 3300048907 Bacteria 11078
491 Ga0496104_0087569 3300048907 Unclassified 2974
492 Ga0496104_0167221 3300048907 Bacteria 2109
493 Ga0496104_1397444 3300048907 Unclassified 603
494 Ga0496105_0018879 3300048908 Bacteria 5554
495 Ga0496105_0024829 3300048908 Bacteria 4871
496 Ga0496105_0702763 3300048908 Bacteria 776
497 Ga0496105_0799619 3300048908 Bacteria 717
498 Ga0496106_0020571 3300048909 Bacteria 4899
499 Ga0496106_0080256 3300048909 Bacteria 2505
500 Ga0496106_0460348 3300048909 Bacteria 1022
501 Ga0496107_0002757 3300048910 Bacteria 11563
502 Ga0496107_0123754 3300048910 Bacteria 1906
503 Ga0496107_0229474 3300048910 Bacteria 1381
504 Ga0496107_0375564 3300048910 Unclassified 1057
505 Ga0496107_0638930 3300048910 Bacteria 785
506 Ga0496107_0753729 3300048910 Bacteria 714
507 Ga0496108_0010375 3300048911 Bacteria 7565
508 Ga0496108_0099945 3300048911 Bacteria 2474
509 Ga0496108_0118132 3300048911 Bacteria 2273
510 Ga0496108_0227846 3300048911 Bacteria 1620
511 Ga0496108_0395246 3300048911 Bacteria 1207
512 Ga0496108_0695962 3300048911 Bacteria 882
513 Ga0496108_0890920 3300048911 Bacteria 764
514 Ga0496109_0019972 3300048912 Bacteria 5915
515 Ga0496109_0022972 3300048912 Bacteria 5530
516 Ga0496109_0034234 3300048912 Bacteria 4573
517 Ga0496109_0148403 3300048912 Bacteria 2195
518 Ga0496109_0240903 3300048912 Bacteria 1702
519 Ga0496109_0270333 3300048912 Bacteria 1601
520 Ga0496109_0493526 3300048912 Unclassified 1156
521 Ga0496109_0819887 3300048912 Bacteria 868
522 Ga0496109_1765395 3300048912 Bacteria 552
523 Ga0496110_0020867 3300048913 Bacteria 5535
524 Ga0496110_0036918 3300048913 Bacteria 4245
525 Ga0496110_0054131 3300048913 Bacteria 3529
526 Ga0496110_0129384 3300048913 Bacteria 2279
527 Ga0496110_0181195 3300048913 Bacteria 1913
528 Ga0496110_0251618 3300048913 Unclassified 1608
529 Ga0496110_0421237 3300048913 Bacteria 1217
530 Ga0496110_0441653 3300048913 Bacteria 1186
531 Ga0496110_0539079 3300048913 Unclassified 1061
532 Ga0496110_1603981 3300048913 Unclassified 561
533 Ga0496111_0012906 3300048914 Bacteria 5668
534 Ga0496111_0172167 3300048914 Bacteria 1609
535 Ga0496111_0192521 3300048914 Bacteria 1516
536 Ga0496111_0582492 3300048914 Bacteria 820
537 Ga0496111_0819375 3300048914 Bacteria 673
538 Ga0496112_0023209 3300048915 Bacteria 5922
539 Ga0496112_0369149 3300048915 Bacteria 1377
540 Ga0496112_0719347 3300048915 Bacteria 926
541 Ga0496112_0737335 3300048915 Bacteria 912
542 Ga0496113_0018756 3300048916 Bacteria 4825
543 Ga0496113_0055701 3300048916 Bacteria 2965
544 Ga0496113_0246246 3300048916 Bacteria 1426
545 Ga0496113_0411674 3300048916 Unclassified 1086
546 Ga0496113_0658851 3300048916 Bacteria 837
547 Ga0496114_0010118 3300048917 Bacteria 7503
548 Ga0496114_0028001 3300048917 Bacteria 4620
549 Ga0496114_0030876 3300048917 Bacteria 4407
550 Ga0496114_0069435 3300048917 Bacteria 2959
551 Ga0496114_0122713 3300048917 Bacteria 2236
552 Ga0496114_0143601 3300048917 Bacteria 2068
553 Ga0496114_0178034 3300048917 Bacteria 1856
554 Ga0496114_0541887 3300048917 Bacteria 1028
555 Ga0496114_0608448 3300048917 Bacteria 963
556 Ga0496114_1398127 3300048917 Unclassified 587
557 Ga0496115_0045909 3300048918 Bacteria 3489
558 Ga0496115_0430832 3300048918 Bacteria 1067
559 Ga0501031_0098971 3300049568 Bacteria 1903
560 Ga0501031_0166234 3300049568 Bacteria 1442
561 Ga0501032_0244773 3300049569 Unclassified 1165
562 Ga0501032_0351418 3300049569 Bacteria 950
563 Ga0501036_0352651 3300049572 Bacteria 1229
564 Ga0501036_0431249 3300049572 Unclassified 1099
565 Ga0501036_1055183 3300049572 Bacteria 664
566 Ga0501038_0121347 3300049574 Bacteria 2155
567 Ga0501038_0505071 3300049574 Bacteria 924
568 Ga0501039_0144467 3300049575 Bacteria 1869
569 Ga0501039_0434378 3300049575 Bacteria 1031
570 Ga0501039_1001442 3300049575 Bacteria 649
571 Ga0501041_0035824 3300049577 Bacteria 3007
572 Ga0501041_0317712 3300049577 Unclassified 982
573 Ga0501041_0627489 3300049577 Bacteria 686
574 Ga0501042_0045852 3300049578 Bacteria 3116
575 Ga0501042_0503078 3300049578 Bacteria 880
576 Ga0501043_0717753 3300049579 Unclassified 729
577 Ga0501048_0353609 3300049582 Bacteria 1048
578 Ga0501067_0034825 3300049583 Bacteria 2795
579 Ga0501067_0109059 3300049583 Bacteria 1539
580 Ga0501068_0064568 3300049584 Bacteria 2228
581 Ga0501068_0090055 3300049584 Bacteria 1892
582 Ga0501068_0450798 3300049584 Bacteria 832
583 Ga0501069_0125568 3300049585 Bacteria 1467
584 Ga0501071_0019075 3300049587 Bacteria 4759
585 Ga0501071_0214790 3300049587 Bacteria 1447
586 Ga0501071_0232614 3300049587 Bacteria 1389
587 Ga0501071_0693308 3300049587 Unclassified 784
588 Ga0501072_0004385 3300049588 Bacteria 10710
589 Ga0501072_0493107 3300049588 Bacteria 969
590 Ga0501075_0039404 3300049591 Bacteria 3536
591 Ga0501075_0243547 3300049591 Bacteria 1371
592 Ga0501075_0552307 3300049591 Bacteria 879
593 Ga0501075_1104297 3300049591 Bacteria 602
594 Ga0501076_0022005 3300049592 Bacteria 4897
595 Ga0501076_0191913 3300049592 Bacteria 1667
596 Ga0501077_0363507 3300049593 Bacteria 924
597 Ga0501077_0414138 3300049593 Bacteria 862
598 Ga0501227_090680 3300049665 Bacteria 807
599 Ga0501243_021336 3300049675 Bacteria 1069
600 Ga0501253_110646 3300049683 Unclassified 655
601 Ga0501079_0029262 3300049741 Bacteria 4229
602 Ga0501079_0324670 3300049741 Bacteria 1205
603 Ga0501081_0036114 3300049743 Bacteria 3368
604 Ga0501081_0805618 3300049743 Bacteria 707
605 Ga0501081_1027136 3300049743 Bacteria 623
606 Ga0501271_005436 3300049768 Bacteria 1240
607 Ga0501271_033173 3300049768 Bacteria 646
608 Ga0501035_0103695 3300049822 Bacteria 2495
609 Ga0501035_0571757 3300049822 Bacteria 924
610 Ga0501035_1017732 3300049822 Bacteria 651
611 Ga0501044_0612931 3300049823 Bacteria 981
612 Ga0501045_0008716 3300049824 Bacteria 7073
613 Ga0501045_0327454 3300049824 Unclassified 1140
614 Ga0501212_082751 3300049851 Bacteria 583
615 nmdc:mga03n38_74604_c1 3300050490 Bacteria 1578
616 nmdc:mga00v17_38514_c1 3300050491 Bacteria 2859
617 nmdc:mga0yw44_85256_c1 3300050492 Bacteria 1987
618 nmdc:mga0yw44_86991_c1 3300050492 Bacteria 1969
619 nmdc:mga05p37_2708_c1 3300050507 Bacteria 20586
620 nmdc:mga05p37_587_c1 3300050507 Bacteria 40013
621 nmdc:mga05p37_633239_c1 3300050507 Bacteria 1201
622 nmdc:mga05p37_67900_c1 3300050507 Bacteria 4386
623 nmdc:mga05p37_748201_c1 3300050507 Bacteria 1078
624 nmdc:mga09592_1203_c1 3300050508 Bacteria 20729
625 nmdc:mga09592_309088_c1 3300050508 Bacteria 1370
626 nmdc:mga09592_5441_c1 3300050508 Bacteria 10354
627 nmdc:mga0qj67_1670_c1 3300050509 Bacteria 15624
628 nmdc:mga0qj67_427709_c1 3300050509 Bacteria 1067
629 nmdc:mga0qj67_7135_c1 3300050509 Bacteria 8244
630 nmdc:mga06r32_1216_c1 3300050510 Bacteria 23199
631 nmdc:mga06r32_12825_c1 3300050510 Bacteria 7576
632 nmdc:mga06r32_447769_c1 3300050510 Bacteria 1271
633 nmdc:mga06r32_90453_c1 3300050510 Bacteria 2990
634 nmdc:mga08y16_1016555_c1 3300050511 Bacteria 808
635 nmdc:mga08y16_147490_c1 3300050511 Bacteria 2446
636 nmdc:mga08y16_17435_c1 3300050511 Bacteria 7562
637 nmdc:mga08y16_557966_c1 3300050511 Unclassified 1158
638 nmdc:mga0n895_102349_c1 3300050512 Bacteria 2875
639 nmdc:mga0n895_893940_c1 3300050512 Unclassified 874
640 nmdc:mga0rr50_127584_c1 3300050513 Bacteria 2033
641 nmdc:mga08x19_4040_c1 3300050514 Bacteria 8720
642 nmdc:mga08x19_84214_c1 3300050514 Bacteria 2091
643 nmdc:mga0a205_14840_c1 3300050515 Bacteria 7271
644 nmdc:mga0a205_152571_c1 3300050515 Bacteria 2209
645 nmdc:mga0a205_88277_c1 3300050515 Bacteria 2997
646 Ga0495619_0793346 3300053085 Bacteria 641
647 Ga0500620_004173 3300053155 Bacteria 3191
648 Ga0501084_0079558 3300054114 Bacteria 2747
649 Ga0501084_0394287 3300054114 Bacteria 1170
650 Ga0501084_1639128 3300054114 Archaea 538
651 Ga0501082_0016535 3300060353 Bacteria 6351
652 Ga0501082_0322587 3300060353 Bacteria 1346
653 Ga0530510_0170553 3300061734 Bacteria 1612
654 Ga0530510_0184842 3300061734 Bacteria 1546
655 Ga0530510_0532846 3300061734 Bacteria 891
656 Ga0530510_0653099 3300061734 Bacteria 801
657 2819664262 2818991458 Bacteria 4794049
658 2819689954 2818991462 Bacteria 4320267
659 2819692093 2818991462 Bacteria 4320267
660 2819728593 2818991469 Bacteria 4644110
661 2884995282 2884994152 Bacteria 4492978
662 Ga0068862_100446542
663 JGI24738J21930_10009075
664 JGI24744J21845_10003109
665 JGI25405J52794_10014869
666 JGI25405J52794_10021911
667 Ga0070658_10388520
668 Ga0070658_10866315
669 Ga0070683_100032655
670 Ga0070683_100088472
671 Ga0070683_100124027
672 Ga0070683_100543214
673 Ga0070683_100568845
674 Ga0070683_100804043
675 Ga0070670_101737827
676 Ga0070677_10022382
677 Ga0068869_100232195
678 Ga0070682_100007506
679 Ga0070682_100028384
680 Ga0070682_100078993
681 Ga0070682_100085046
682 Ga0070682_100752349
683 Ga0068868_100021601
684 Ga0068868_100147812
685 Ga0068868_100904571
686 Ga0070660_100462502
687 Ga0070660_101223633
688 Ga0070692_10001752
689 Ga0070692_10480449
690 Ga0070668_100447218
691 Ga0070668_100586785
692 Ga0070675_100077155
693 Ga0070675_100962893
694 Ga0070671_101758353
695 Ga0070674_100062215
696 Ga0070674_100486336
697 Ga0070674_100713309
698 Ga0070674_100877223
699 Ga0070673_100018803
700 Ga0070688_100320471
701 Ga0070659_100089798
702 Ga0070659_100163727
703 Ga0070701_10004458
704 Ga0070700_100004932
705 Ga0070700_100226354
706 Ga0070694_101123615
707 Ga0070663_100335555
708 Ga0070663_101283437
709 Ga0070678_100486929
710 Ga0070678_101122242
711 Ga0070662_100007456
712 Ga0070662_100965311
713 Ga0068867_100029071
714 Ga0068867_100222304
715 Ga0068867_100688595
716 Ga0070685_10092680
717 Ga0070685_10481500
718 Ga0070685_10846530
719 Ga0070679_100535360
720 Ga0070679_100769432
721 Ga0070684_100014497
722 Ga0070684_100165775
723 Ga0070684_100484378
724 Ga0070684_100503096
725 Ga0070684_100531024
726 Ga0070684_100845029
727 Ga0070684_101113493
728 Ga0070672_100008593
729 Ga0070672_100194418
730 Ga0070672_100810910
731 Ga0070686_100402906
732 Ga0070693_100113454
733 Ga0070693_100460100
734 Ga0070693_100736706
735 Ga0070665_100646347
736 Ga0070664_100512838
737 Ga0068857_100230595
738 Ga0068854_100899554
739 Ga0068856_100911635
740 Ga0068856_101624997
741 Ga0070702_100091411
742 Ga0070702_100167798
743 Ga0070702_100289415
744 Ga0070702_100449846
745 Ga0070702_100710580
746 Ga0068852_100071523
747 Ga0068852_101330156
748 Ga0068859_101088240
749 Ga0068864_100065231
750 Ga0068864_100302744
751 Ga0068864_101730266
752 Ga0068864_102100415
753 Ga0068866_10009295
754 Ga0068866_10069682
755 Ga0068866_11011226
756 Ga0068861_100005524
757 Ga0068861_100185448
758 Ga0068861_100334885
759 Ga0068861_100450820
760 Ga0068861_100813336
761 Ga0068851_10171077
762 Ga0068851_10295988
763 Ga0068870_10002761
764 Ga0068863_100245296
765 Ga0068858_100302060
766 Ga0068858_100612142
767 Ga0068860_100147105
768 Ga0068860_100577049
769 Ga0068862_100133096
770 Ga0081455_10000201
771 Ga0081455_10004225
772 Ga0081455_10007760
773 Ga0081455_10012750
774 Ga0081455_10021400
775 Ga0081455_10157409
776 Ga0081455_10220451
777 Ga0081538_10025167
778 Ga0075365_10095754
779 Ga0075368_10020360
780 Ga0075363_100153293
781 Ga0075364_10219643
782 Ga0075432_10002266
783 Ga0075432_10003696
784 Ga0075432_10090202
785 Ga0075367_10482016
786 Ga0068871_100154760
787 Ga0068871_101079672
788 Ga0075428_100000783
789 Ga0075428_100003037
790 Ga0075428_100007448
791 Ga0075428_100130456
792 Ga0075428_100366447
793 Ga0075428_100532291
794 Ga0075428_100550453
795 Ga0075428_100592202
796 Ga0075430_100002901
797 Ga0075430_100014583
798 Ga0075430_100623095
799 Ga0075431_100002472
800 Ga0075431_100003106
801 Ga0075431_100214439
802 Ga0075431_100319829
803 Ga0075431_100435212
804 Ga0075431_100488917
805 Ga0075433_10040050
806 Ga0075433_10053160
807 Ga0075433_10200844
808 Ga0075434_100004227
809 Ga0075434_100064387
810 Ga0075434_100949694
811 Ga0075429_100003168
812 Ga0075429_100061737
813 Ga0075429_100073962
814 Ga0075429_100185908
815 Ga0068865_100059114
816 Ga0068865_100791447
817 Ga0068865_101197302
818 Ga0075436_100009075
819 Ga0097620_101088336
820 Ga0075435_100002623
821 Ga0105244_10243795
822 Ga0111539_10015272
823 Ga0111539_10105835
824 Ga0111539_10513556
825 Ga0111539_10532982
826 Ga0111539_11183258
827 Ga0111539_11932875
828 Ga0105245_10022530
829 Ga0105245_10047452
830 Ga0105245_10074038
831 Ga0105245_10304601
832 Ga0105245_10483281
833 Ga0105245_10534054
834 Ga0105245_10615808
835 Ga0114129_10002404
836 Ga0114129_10005929
837 Ga0114129_10051461
838 Ga0114129_10142634
839 Ga0114129_10569142
840 Ga0105243_10021261
841 Ga0105243_10038740
842 Ga0105243_10071647
843 Ga0105243_10092876
844 Ga0105243_10101368
845 Ga0105243_10154954
846 Ga0105243_10407225
847 Ga0105243_10653325
848 Ga0105243_10701171
849 Ga0105243_10914954
850 Ga0105243_11035833
851 Ga0105243_11868146
852 Ga0105242_10139630
853 Ga0105242_12158597
854 Ga0105248_10013985
855 Ga0105248_10321833
856 Ga0105248_10484420
857 Ga0105248_11361259
858 Ga0105248_12198649
859 Ga0105238_10040351
860 Ga0105238_10105310
861 Ga0105238_10367695
862 Ga0105238_11167126
863 Ga0105238_11196568
864 Ga0105238_11323654
865 Ga0105238_12208210
866 Ga0105249_10032754
867 Ga0105249_10048009
868 Ga0105249_10154390
869 Ga0105249_10305041
870 Ga0105249_10364599
871 Ga0105249_10915490
872 Ga0105249_10943149
873 Ga0105249_11466175
874 Ga0105249_12375390
875 Ga0105239_10023970
876 Ga0105239_11108078
877 Ga0105239_12749841
878 Ga0105246_10050704
879 Ga0105246_10267481
880 Ga0105246_10351689
881 Ga0105246_10469588
882 Ga0157369_10602973
883 Ga0157369_10674499
884 Ga0157374_10278508
885 Ga0157374_11855238
886 Ga0157378_11470042
887 Ga0163162_10159969
888 Ga0163162_10167448
889 Ga0163162_10333303
890 Ga0163162_10636848
891 Ga0163162_11508029
892 Ga0157372_10030690
893 Ga0157372_10252926
894 Ga0157372_10583803
895 Ga0157372_10708167
896 Ga0157372_10979233
897 Ga0157372_11397033
898 Ga0157375_10001919
899 Ga0157375_10076144
900 Ga0157375_10234385
901 Ga0157375_10709585
902 Ga0157375_10742478
903 Ga0157375_10778921
904 Ga0157375_10990811
905 Ga0157375_12129036
906 Ga0163163_10042590
907 Ga0163163_10070862
908 Ga0163163_10085916
909 Ga0163163_10133475
910 Ga0163163_10329689
911 Ga0163163_10375804
912 Ga0163163_10760344
913 Ga0163163_11077731
914 Ga0163163_11092316
915 Ga0163163_11168264
916 Ga0157380_10037552
917 Ga0157380_10060002
918 Ga0157380_10072332
919 Ga0157380_10359097
920 Ga0157380_10391610
921 Ga0157380_10796021
922 Ga0157377_10009526
923 Ga0157377_10045366
924 Ga0157377_10284266
925 Ga0157377_10579992
926 Ga0157377_10601499
927 Ga0157379_10768136
928 Ga0157376_10437244
929 Ga0157376_10599139
930 Ga0163161_10308363
931 Ga0163161_10363724
932 Ga0163161_11106539
933 Ga0206356_11647684
934 Ga0206353_10160592
935 Ga0224712_10404523
936 Ga0207697_10053328
937 Ga0207682_10178452
938 Ga0207642_10040031
939 Ga0207642_10116379
940 Ga0207688_10024960
941 Ga0207688_10169573
942 Ga0207688_10203801
943 Ga0207647_10139709
944 Ga0207647_10141978
945 Ga0207643_10001431
946 Ga0207643_10594764
947 Ga0207705_10134494
948 Ga0207705_11395502
949 Ga0207662_10044338
950 Ga0207662_10539168
951 Ga0207652_10526440
952 Ga0207652_10674746
953 Ga0207694_10092361
954 Ga0207694_10143874
955 Ga0207694_10626213
956 Ga0207694_10810146
957 Ga0207694_11021728
958 Ga0207659_10598471
959 Ga0207659_10896367
960 Ga0207687_10029485
961 Ga0207687_10332317
962 Ga0207687_10454675
963 Ga0207687_10515753
964 Ga0207644_10456997
965 Ga0207690_10028893
966 Ga0207706_10006460
967 Ga0207706_10079520
968 Ga0207686_10087213
969 Ga0207686_10221494
970 Ga0207686_10258735
971 Ga0207686_11455492
972 Ga0207709_10044866
973 Ga0207709_10118346
974 Ga0207709_10140461
975 Ga0207709_10192932
976 Ga0207709_10533894
977 Ga0207709_10710146
978 Ga0207709_11284487
979 Ga0207669_10029656
980 Ga0207669_10074140
981 Ga0207669_10379278
982 Ga0207669_10433488
983 Ga0207669_10751953
984 Ga0207704_10490139
985 Ga0207704_10729084
986 Ga0207691_10002825
987 Ga0207691_10157440
988 Ga0207691_10331591
989 Ga0207711_10161138
990 Ga0207711_10616289
991 Ga0207711_11042973
992 Ga0207689_10118052
993 Ga0207689_10260503
994 Ga0207661_10058306
995 Ga0207661_10077797
996 Ga0207661_10227275
997 Ga0207661_10520833
998 Ga0207661_10691716
999 Ga0207661_10783623
1000 Ga0207661_11289729
1001 Ga0207667_10745886
1002 Ga0207651_10344691
1003 Ga0207651_11061723
1004 Ga0207712_10057152
1005 Ga0207712_10073401
1006 Ga0207712_10161749
1007 Ga0207712_11508075
1008 Ga0207712_11598680
1009 Ga0207668_10096013
1010 Ga0207668_10219984
1011 Ga0207640_10438009
1012 Ga0207658_10166407
1013 Ga0207677_10382624
1014 Ga0207677_10694392
1015 Ga0207677_11609360
1016 Ga0207678_10826643
1017 Ga0207708_10001532
1018 Ga0207708_10156514
1019 Ga0207708_10286961
1020 Ga0207708_10452205
1021 Ga0207702_10385435
1022 Ga0207648_10058747
1023 Ga0207648_10115037
1024 Ga0207648_10384512
1025 Ga0207676_11080276
1026 Ga0207676_11743830
1027 Ga0207675_100004494
1028 Ga0207675_100008587
1029 Ga0207675_100070909
1030 Ga0207675_100101448
1031 Ga0207675_100123618
1032 Ga0207675_100366967
1033 Ga0207683_10027540
1034 Ga0207683_10464667
1035 Ga0207683_10686456
1036 Ga0207683_10879475
1037 Ga0207698_11147442
1038 Ga0207698_11151811
1039 Ga0207698_11218372
1040 Ga0207428_10000752
1041 Ga0207428_10003453
1042 Ga0207428_10003523
1043 Ga0268265_10091750
1044 Ga0268265_10398775
1045 Ga0268264_11371901
1046 Ga0307408_100334220
1047 Ga0307408_100520239
1048 Ga0307405_10004385
1049 Ga0307413_10180921
1050 Ga0307413_11105635
1051 Ga0307410_10005569
1052 Ga0307410_10006765
1053 Ga0307410_10177113
1054 Ga0307410_10400390
1055 Ga0307410_11940024
1056 Ga0307406_10089149
1057 Ga0307406_10113661
1058 Ga0307406_10314992
1059 Ga0307407_10001429
1060 Ga0307407_10016884
1061 Ga0307407_10036606
1062 Ga0307407_10530773
1063 Ga0307412_10570441
1064 Ga0307409_100097709
1065 Ga0307409_100182883
1066 Ga0307409_100191456
1067 Ga0307409_100291092
1068 Ga0307409_100439414
1069 Ga0307409_101991091
1070 Ga0307416_100032089
1071 Ga0307416_100419283
1072 Ga0307416_100673729
1073 Ga0307416_102322598
1074 Ga0307414_10035195
1075 Ga0307414_10046507
1076 Ga0307411_10020714
1077 Ga0307411_10077503
1078 Ga0307411_10229213
1079 Ga0307411_10839773
1080 Ga0307415_100022111
1081 Ga0307415_100107310
1082 Ga0373958_0062444
1083 Ga0373952_0067736
1084 Ga0373960_0342773
1085 Ga0373931_0430982
1086 Ga0373931_0453687
1087 Ga0395900_0276456
1088 Ga0395900_0409704
1089 Ga0395900_0666806
1090 Ga0395898_0061536
1091 Ga0395898_0189251
1092 Ga0395898_0388017
1093 Ga0395901_0010566
1094 Ga0395901_0078673
1095 Ga0395901_1343779
1096 Ga0242419_007915
1097 Ga0451789_0945468
1098 Ga0451798_0796952
1099 Ga0451800_0629605
1100 Ga0451802_1449987
1101 Ga0451847_0529191
1102 Ga0451853_0897774
1103 Ga0439450_126792
1104 Ga0439450_147878
1105 Ga0439464_0030568
1106 Ga0439440_0016170
1107 Ga0439440_0109813
1108 Ga0466965_0155671
1109 Ga0466965_0230550
1110 Ga0466961_0109070
1111 Ga0466963_0036839
1112 Ga0466964_0190293
1113 Ga0466970_0012932
1114 Ga0466957_0095702
1115 Ga0466957_0311373
1116 Ga0466960_0008687
1117 Ga0466960_0054202
1118 Ga0466958_0838471
1119 Ga0466967_0244797
1120 Ga0466967_0484341
1121 Ga0466967_0798947
1122 Ga0495629_0515990
1123 Ga0495653_0401669
1124 Ga0495582_0226912
1125 Ga0495608_0406910
1126 Ga0495620_0234336
1127 Ga0495587_0586445
1128 Ga0495597_0369101
1129 Ga0495656_0716787
1130 Ga0495658_0375172
1131 Ga0495658_0554516
1132 Ga0495649_0388263
1133 Ga0495674_1000234
1134 Ga0496100_0019560
1135 Ga0496100_0069929
1136 Ga0496100_0369447
1137 Ga0496100_0811566
1138 Ga0496101_0014130
1139 Ga0496101_0017487
1140 Ga0496101_0023006
1141 Ga0496102_0011373
1142 Ga0496102_0028598
1143 Ga0496102_0440331
1144 Ga0496102_0530204
1145 Ga0496102_0657797
1146 Ga0496102_0687892
1147 Ga0496102_0771198
1148 Ga0496103_0026833
1149 Ga0496103_0063087
1150 Ga0496103_0397765
1151 Ga0496104_0005520
1152 Ga0496104_0087569
1153 Ga0496104_0167221
1154 Ga0496104_1397444
1155 Ga0496105_0018879
1156 Ga0496105_0024829
1157 Ga0496105_0702763
1158 Ga0496105_0799619
1159 Ga0496106_0020571
1160 Ga0496106_0080256
1161 Ga0496106_0460348
1162 Ga0496107_0002757
1163 Ga0496107_0123754
1164 Ga0496107_0229474
1165 Ga0496107_0375564
1166 Ga0496107_0638930
1167 Ga0496107_0753729
1168 Ga0496108_0010375
1169 Ga0496108_0099945
1170 Ga0496108_0118132
1171 Ga0496108_0227846
1172 Ga0496108_0395246
1173 Ga0496108_0695962
1174 Ga0496108_0890920
1175 Ga0496109_0019972
1176 Ga0496109_0022972
1177 Ga0496109_0034234
1178 Ga0496109_0148403
1179 Ga0496109_0240903
1180 Ga0496109_0270333
1181 Ga0496109_0493526
1182 Ga0496109_0819887
1183 Ga0496109_1765395
1184 Ga0496110_0020867
1185 Ga0496110_0036918
1186 Ga0496110_0054131
1187 Ga0496110_0129384
1188 Ga0496110_0181195
1189 Ga0496110_0251618
1190 Ga0496110_0421237
1191 Ga0496110_0441653
1192 Ga0496110_0539079
1193 Ga0496110_1603981
1194 Ga0496111_0012906
1195 Ga0496111_0172167
1196 Ga0496111_0192521
1197 Ga0496111_0582492
1198 Ga0496111_0819375
1199 Ga0496112_0023209
1200 Ga0496112_0369149
1201 Ga0496112_0719347
1202 Ga0496112_0737335
1203 Ga0496113_0018756
1204 Ga0496113_0055701
1205 Ga0496113_0246246
1206 Ga0496113_0411674
1207 Ga0496113_0658851
1208 Ga0496114_0010118
1209 Ga0496114_0028001
1210 Ga0496114_0030876
1211 Ga0496114_0069435
1212 Ga0496114_0122713
1213 Ga0496114_0143601
1214 Ga0496114_0178034
1215 Ga0496114_0541887
1216 Ga0496114_0608448
1217 Ga0496114_1398127
1218 Ga0496115_0045909
1219 Ga0496115_0430832
1220 Ga0501031_0098971
1221 Ga0501031_0166234
1222 Ga0501032_0244773
1223 Ga0501032_0351418
1224 Ga0501036_0352651
1225 Ga0501036_0431249
1226 Ga0501036_1055183
1227 Ga0501038_0121347
1228 Ga0501038_0505071
1229 Ga0501039_0144467
1230 Ga0501039_0434378
1231 Ga0501039_1001442
1232 Ga0501041_0035824
1233 Ga0501041_0317712
1234 Ga0501041_0627489
1235 Ga0501042_0045852
1236 Ga0501042_0503078
1237 Ga0501043_0717753
1238 Ga0501048_0353609
1239 Ga0501067_0034825
1240 Ga0501067_0109059
1241 Ga0501068_0064568
1242 Ga0501068_0090055
1243 Ga0501068_0450798
1244 Ga0501069_0125568
1245 Ga0501071_0019075
1246 Ga0501071_0214790
1247 Ga0501071_0232614
1248 Ga0501071_0693308
1249 Ga0501072_0004385
1250 Ga0501072_0493107
1251 Ga0501075_0039404
1252 Ga0501075_0243547
1253 Ga0501075_0552307
1254 Ga0501075_1104297
1255 Ga0501076_0022005
1256 Ga0501076_0191913
1257 Ga0501077_0363507
1258 Ga0501077_0414138
1259 Ga0501227_090680
1260 Ga0501243_021336
1261 Ga0501253_110646
1262 Ga0501079_0029262
1263 Ga0501079_0324670
1264 Ga0501081_0036114
1265 Ga0501081_0805618
1266 Ga0501081_1027136
1267 Ga0501271_005436
1268 Ga0501271_033173
1269 Ga0501035_0103695
1270 Ga0501035_0571757
1271 Ga0501035_1017732
1272 Ga0501044_0612931
1273 Ga0501045_0008716
1274 Ga0501045_0327454
1275 Ga0501212_082751
1276 nmdc:mga03n38_74604_c1
1277 nmdc:mga00v17_38514_c1
1278 nmdc:mga0yw44_85256_c1
1279 nmdc:mga0yw44_86991_c1
1280 nmdc:mga05p37_2708_c1
1281 nmdc:mga05p37_587_c1
1282 nmdc:mga05p37_633239_c1
1283 nmdc:mga05p37_67900_c1
1284 nmdc:mga05p37_748201_c1
1285 nmdc:mga09592_1203_c1
1286 nmdc:mga09592_309088_c1
1287 nmdc:mga09592_5441_c1
1288 nmdc:mga0qj67_1670_c1
1289 nmdc:mga0qj67_427709_c1
1290 nmdc:mga0qj67_7135_c1
1291 nmdc:mga06r32_1216_c1
1292 nmdc:mga06r32_12825_c1
1293 nmdc:mga06r32_447769_c1
1294 nmdc:mga06r32_90453_c1
1295 nmdc:mga08y16_1016555_c1
1296 nmdc:mga08y16_147490_c1
1297 nmdc:mga08y16_17435_c1
1298 nmdc:mga08y16_557966_c1
1299 nmdc:mga0n895_102349_c1
1300 nmdc:mga0n895_893940_c1
1301 nmdc:mga0rr50_127584_c1
1302 nmdc:mga08x19_4040_c1
1303 nmdc:mga08x19_84214_c1
1304 nmdc:mga0a205_14840_c1
1305 nmdc:mga0a205_152571_c1
1306 nmdc:mga0a205_88277_c1
1307 Ga0495619_0793346
1308 Ga0500620_004173
1309 Ga0501084_0079558
1310 Ga0501084_0394287
1311 Ga0501084_1639128
1312 Ga0501082_0016535
1313 Ga0501082_0322587
1314 Ga0530510_0170553
1315 Ga0530510_0184842
1316 Ga0530510_0532846
1317 Ga0530510_0653099
1318 2819664262
1319 2819689954
1320 2819692093
1321 2819728593
1322 2884995282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fl0-assembly1.cif.gz_A-2 oxidized (all ferric) form of the azotobacter vinelandii bacterioferritin 0.422 7 124
2fl0-assembly1.cif.gz_A-3 oxidized (all ferric) form of the azotobacter vinelandii bacterioferritin 0.422 7 124
2lpj-assembly1.cif.gz_A nmr structure of major ampullate spidroin 1 n-terminal domain at ph 7.2 0.4192 22 151
3lr8-assembly1.cif.gz_B self-assembly of spider silk proteins is controlled by a ph-sensitive relay 0.3959 22 151
3lr2-assembly1.cif.gz_A self-assembly of spider silk proteins is controlled by a ph-sensitive relay 0.3915 19 151
ID Description Score Start End Superfamily
af_Q5SX79_610_798_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4751 5 149 1.10.287.1490
af_M0RB44_648_833_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4706 4 151 1.10.287.1490
af_P19659_6_90_1.10.246.20 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain 0.4468 1 99 1.10.246.20
af_P19659_6_90_1.10.246.20 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain 0.4359 1 99 1.10.246.20
af_Q2M3G4_641_827_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4203 4 149 1.10.287.1490
ID Description Score Start End GO Terms
AF-A0A0Q8UB11-F1-model_v4 Uncharacterized protein 0.9414 1 152
AF-A0A0Q8UB11-F1-model_v4 Uncharacterized protein 0.9353 1 152
AF-A0A7Y9E852-F1-model_v4 Uncharacterized protein 0.9221 1 152
AF-A0A7Y9E852-F1-model_v4 Uncharacterized protein 0.9162 1 152
AF-A0A399FCD8-F1-model_v4 Uncharacterized protein 0.8314 4 151

Map