F473286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 659 | 364 | 1318 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300049554|Ga0501338_00782|Ga0501338_00782_646_1425 |
| Length | 259 |
| Sequence | LNEYLGKVLALFYVGGYSAKTTIKEEIKMAKKGKKYLEAAKLVDRSKAYPIGEAVELVKQTSFTKFDASVEAAFRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKVKEAEAAGADYVGDTEYINKISQGWFEFDVIVATPDMMGEVGKLGRTLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEYRVDKAGNIHVPIGKASFETEKLVENFNTIFETMVKVKPAAAKGTYMKNVAVTSTMGPSVKVDPATAGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 103 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300029272 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 | Metatranscriptome | Rhizosphere |
| 110 | 3300029273 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stno.R1 | Metatranscriptome | Rhizosphere |
| 111 | 3300029280 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 | Metatranscriptome | Rhizosphere |
| 112 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 113 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 115 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 116 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 117 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 118 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 120 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 121 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 125 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 128 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 130 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 135 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 136 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 137 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 138 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 139 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 140 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 186 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 187 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 188 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 189 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 190 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 191 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 194 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 199 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 200 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 201 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 202 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 203 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 204 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 205 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 206 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300049555 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 257 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 258 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 263 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 264 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 277 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 278 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 279 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 280 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 281 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 282 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 283 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 284 | 2600255229 | Lactobacillus acidophilus A 16 | Isolate | Rhizosphere |
| 285 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 286 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 287 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 288 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 289 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 290 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 291 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 292 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 293 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 294 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 295 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 296 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 297 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 298 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 299 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 300 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 301 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 302 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 303 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 304 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 305 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 306 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 307 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 308 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 309 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 310 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 311 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 312 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 313 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 314 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 315 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 316 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 317 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 318 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 319 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 320 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 321 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 322 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 323 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 324 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 325 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 326 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 327 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 328 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 329 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 330 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 331 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 332 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 333 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 334 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 335 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 336 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 337 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 338 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 339 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 340 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 341 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 342 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 343 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 344 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 345 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 346 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 347 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 348 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 349 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 350 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 351 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 352 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 353 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 354 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 355 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 356 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
| 357 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 358 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 359 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 360 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 361 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 362 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 363 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 364 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 54.17 |
| Metatranscriptomes | 32.32 |
| Isolates | 13.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.88 |
| Nodule | 0.91 |
| Rhizoplane | 5.46 |
| Rhizosphere | 82.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501338_00782 | 3300049554 | Bacteria | 1547 |
| 2 | JGI25151J46595_10000735 | 3300003187 | Bacteria | 26974 |
| 3 | JGI25151J46595_10001136 | 3300003187 | Bacteria | 19348 |
| 4 | JGI25151J46595_10003308 | 3300003187 | Bacteria | 8947 |
| 5 | JGI25151J46595_10012381 | 3300003187 | Bacteria | 3883 |
| 6 | rootH1_10000848 | 3300003316 | Bacteria | 58943 |
| 7 | rootL2_10052955 | 3300003322 | Bacteria | 32035 |
| 8 | Ga0006562J51391_1000046 | 3300003578 | Bacteria | 48312 |
| 9 | Ga0006562J51391_1000677 | 3300003578 | Bacteria | 45519 |
| 10 | Ga0055538_1000081 | 3300003751 | Bacteria | 85159 |
| 11 | Ga0055528_1001614 | 3300003790 | Bacteria | 13323 |
| 12 | Ga0065704_10019174 | 3300005289 | Bacteria | 1706 |
| 13 | Ga0065712_10079230 | 3300005290 | Bacteria | 3236 |
| 14 | Ga0065712_10189397 | 3300005290 | Bacteria | 1155 |
| 15 | Ga0065715_10190587 | 3300005293 | Bacteria | 1417 |
| 16 | Ga0070676_10006452 | 3300005328 | Bacteria | 6271 |
| 17 | Ga0070676_10240833 | 3300005328 | Bacteria | 1203 |
| 18 | Ga0070670_100019013 | 3300005331 | Bacteria | 5892 |
| 19 | Ga0070670_100020078 | 3300005331 | Bacteria | 5738 |
| 20 | Ga0070670_100560597 | 3300005331 | Bacteria | 1020 |
| 21 | Ga0068869_100075173 | 3300005334 | Bacteria | 2509 |
| 22 | Ga0068868_100339119 | 3300005338 | Bacteria | 1285 |
| 23 | Ga0070689_100027530 | 3300005340 | Bacteria | 4286 |
| 24 | Ga0070692_10398912 | 3300005345 | Bacteria | 868 |
| 25 | Ga0070669_100199350 | 3300005353 | Bacteria | 1574 |
| 26 | Ga0070675_100066415 | 3300005354 | Bacteria | 2984 |
| 27 | Ga0070675_100398625 | 3300005354 | Bacteria | 1227 |
| 28 | Ga0070671_100011607 | 3300005355 | Bacteria | 7086 |
| 29 | Ga0070674_100570710 | 3300005356 | Bacteria | 952 |
| 30 | Ga0070688_100026187 | 3300005365 | Bacteria | 3462 |
| 31 | Ga0070659_100814034 | 3300005366 | Bacteria | 813 |
| 32 | Ga0070700_100522998 | 3300005441 | Bacteria | 917 |
| 33 | Ga0070694_100528691 | 3300005444 | Bacteria | 942 |
| 34 | Ga0070708_100715719 | 3300005445 | Bacteria | 942 |
| 35 | Ga0070678_100272510 | 3300005456 | Bacteria | 1428 |
| 36 | Ga0070678_100316314 | 3300005456 | Bacteria | 1332 |
| 37 | Ga0070678_100375143 | 3300005456 | Bacteria | 1229 |
| 38 | Ga0068867_100023582 | 3300005459 | Bacteria | 4405 |
| 39 | Ga0070685_10006863 | 3300005466 | Bacteria | 5812 |
| 40 | Ga0070706_100466541 | 3300005467 | Bacteria | 1175 |
| 41 | Ga0070707_100709667 | 3300005468 | Bacteria | 969 |
| 42 | Ga0070698_100278933 | 3300005471 | Bacteria | 1603 |
| 43 | Ga0070699_100080347 | 3300005518 | Bacteria | 2841 |
| 44 | Ga0070679_100432153 | 3300005530 | Bacteria | 1262 |
| 45 | Ga0070697_100017739 | 3300005536 | Bacteria | 5607 |
| 46 | Ga0070697_100253963 | 3300005536 | Bacteria | 1504 |
| 47 | Ga0070672_100025082 | 3300005543 | Bacteria | 4417 |
| 48 | Ga0070665_101155262 | 3300005548 | Bacteria | 785 |
| 49 | Ga0068857_100013317 | 3300005577 | Bacteria | 7161 |
| 50 | Ga0068859_100028015 | 3300005617 | Bacteria | 5649 |
| 51 | Ga0068862_100128838 | 3300005844 | Bacteria | 2237 |
| 52 | Ga0075364_10006779 | 3300006051 | Bacteria | 6755 |
| 53 | Ga0070715_10058571 | 3300006163 | Bacteria | 1682 |
| 54 | Ga0070715_10065228 | 3300006163 | Bacteria | 1611 |
| 55 | Ga0075367_10195954 | 3300006178 | Bacteria | 1261 |
| 56 | Ga0075428_100063863 | 3300006844 | Bacteria | 4031 |
| 57 | Ga0075428_100542290 | 3300006844 | Bacteria | 1243 |
| 58 | Ga0075431_100177183 | 3300006847 | Bacteria | 2189 |
| 59 | Ga0075434_100062039 | 3300006871 | Bacteria | 3720 |
| 60 | Ga0068865_100123349 | 3300006881 | Bacteria | 1930 |
| 61 | Ga0068865_100450720 | 3300006881 | Bacteria | 1064 |
| 62 | Ga0075436_100041067 | 3300006914 | Bacteria | 3192 |
| 63 | Ga0097620_100028015 | 3300006931 | Bacteria | 5649 |
| 64 | Ga0079104_1001572 | 3300006946 | Bacteria | 14942 |
| 65 | Ga0079104_1009498 | 3300006946 | Bacteria | 3287 |
| 66 | Ga0075435_100148690 | 3300007076 | Bacteria | 1968 |
| 67 | Ga0105244_10026966 | 3300009036 | Bacteria | 3103 |
| 68 | Ga0105244_10094277 | 3300009036 | Bacteria | 1470 |
| 69 | Ga0105250_10018759 | 3300009092 | Bacteria | 2800 |
| 70 | Ga0111539_10042697 | 3300009094 | Bacteria | 5443 |
| 71 | Ga0111539_10076046 | 3300009094 | Bacteria | 3954 |
| 72 | Ga0111539_10741310 | 3300009094 | Bacteria | 1143 |
| 73 | Ga0111539_11101146 | 3300009094 | Bacteria | 923 |
| 74 | Ga0105245_10006900 | 3300009098 | Bacteria | 9956 |
| 75 | Ga0105245_10129583 | 3300009098 | Bacteria | 2365 |
| 76 | Ga0105247_10000354 | 3300009101 | Bacteria | 39709 |
| 77 | Ga0105243_10000301 | 3300009148 | Bacteria | 54622 |
| 78 | Ga0105243_10228729 | 3300009148 | Bacteria | 1649 |
| 79 | Ga0105241_10088992 | 3300009174 | Bacteria | 2432 |
| 80 | Ga0105242_10004076 | 3300009176 | Bacteria | 11356 |
| 81 | Ga0105242_10065634 | 3300009176 | Bacteria | 2995 |
| 82 | Ga0099796_10025844 | 3300010159 | Bacteria | 1859 |
| 83 | Ga0105246_10000077 | 3300011119 | Bacteria | 41151 |
| 84 | Ga0157371_10005050 | 3300013102 | Bacteria | 11283 |
| 85 | Ga0157374_10013578 | 3300013296 | Bacteria | 7114 |
| 86 | Ga0157378_10000237 | 3300013297 | Bacteria | 53846 |
| 87 | Ga0157378_10066150 | 3300013297 | Bacteria | 3237 |
| 88 | Ga0157375_10153511 | 3300013308 | Bacteria | 2440 |
| 89 | Ga0157375_10249039 | 3300013308 | Bacteria | 1937 |
| 90 | Ga0157380_10046726 | 3300014326 | Bacteria | 3402 |
| 91 | Ga0157377_10002894 | 3300014745 | Bacteria | 7675 |
| 92 | Ga0157376_10014258 | 3300014969 | Bacteria | 5959 |
| 93 | Ga0224712_10011825 | 3300022467 | Bacteria | 2722 |
| 94 | Ga0209784_100044 | 3300025224 | Bacteria | 206858 |
| 95 | Ga0209147_100806 | 3300025229 | Bacteria | 15071 |
| 96 | Ga0209673_1001881 | 3300025273 | Bacteria | 16921 |
| 97 | Ga0209676_1057025 | 3300025292 | Bacteria | 992 |
| 98 | Ga0209025_1000639 | 3300025294 | Bacteria | 61845 |
| 99 | Ga0209025_1002868 | 3300025294 | Bacteria | 17284 |
| 100 | Ga0209025_1016387 | 3300025294 | Bacteria | 4378 |
| 101 | Ga0209025_1021451 | 3300025294 | Bacteria | 3478 |
| 102 | Ga0207426_1008659 | 3300025302 | Bacteria | 4084 |
| 103 | Ga0207696_1004774 | 3300025711 | Bacteria | 5763 |
| 104 | Ga0207655_1007619 | 3300025728 | Bacteria | 6993 |
| 105 | Ga0207713_1000405 | 3300025735 | Bacteria | 46074 |
| 106 | Ga0207688_10121887 | 3300025901 | Bacteria | 1522 |
| 107 | Ga0207685_10228621 | 3300025905 | Bacteria | 889 |
| 108 | Ga0207645_10036479 | 3300025907 | Bacteria | 3156 |
| 109 | Ga0207646_10012863 | 3300025922 | Bacteria | 8022 |
| 110 | Ga0207646_10166025 | 3300025922 | Bacteria | 1993 |
| 111 | Ga0207681_10110484 | 3300025923 | Bacteria | 1999 |
| 112 | Ga0207681_10254309 | 3300025923 | Bacteria | 1373 |
| 113 | Ga0207681_10440745 | 3300025923 | Bacteria | 1058 |
| 114 | Ga0207681_10527108 | 3300025923 | Bacteria | 970 |
| 115 | Ga0207650_10013760 | 3300025925 | Bacteria | 5611 |
| 116 | Ga0207659_10053626 | 3300025926 | Bacteria | 2876 |
| 117 | Ga0207659_10274297 | 3300025926 | Bacteria | 1377 |
| 118 | Ga0207687_10006698 | 3300025927 | Bacteria | 7599 |
| 119 | Ga0207687_10095721 | 3300025927 | Bacteria | 2175 |
| 120 | Ga0207644_10001801 | 3300025931 | Bacteria | 13903 |
| 121 | Ga0207686_10004946 | 3300025934 | Bacteria | 7173 |
| 122 | Ga0207686_10169188 | 3300025934 | Bacteria | 1539 |
| 123 | Ga0207709_10000416 | 3300025935 | Bacteria | 41461 |
| 124 | Ga0207709_10374243 | 3300025935 | Bacteria | 1082 |
| 125 | Ga0207670_10059001 | 3300025936 | Bacteria | 2609 |
| 126 | Ga0207669_10074531 | 3300025937 | Bacteria | 2147 |
| 127 | Ga0207669_10475814 | 3300025937 | Bacteria | 995 |
| 128 | Ga0207704_10043139 | 3300025938 | Bacteria | 2660 |
| 129 | Ga0207704_10179121 | 3300025938 | Bacteria | 1530 |
| 130 | Ga0207691_10039329 | 3300025940 | Bacteria | 4375 |
| 131 | Ga0207689_10085506 | 3300025942 | Bacteria | 2592 |
| 132 | Ga0207712_10048314 | 3300025961 | Bacteria | 2959 |
| 133 | Ga0207668_10298490 | 3300025972 | Bacteria | 1329 |
| 134 | Ga0207677_10253818 | 3300026023 | Bacteria | 1430 |
| 135 | Ga0207677_10465257 | 3300026023 | Bacteria | 1086 |
| 136 | Ga0207678_10356877 | 3300026067 | Bacteria | 1261 |
| 137 | Ga0207708_10132970 | 3300026075 | Bacteria | 1946 |
| 138 | Ga0207648_10033930 | 3300026089 | Bacteria | 4500 |
| 139 | Ga0207648_10068016 | 3300026089 | Bacteria | 3104 |
| 140 | Ga0207675_100087087 | 3300026118 | Bacteria | 2933 |
| 141 | Ga0207675_100709680 | 3300026118 | Bacteria | 1015 |
| 142 | Ga0207683_10206718 | 3300026121 | Bacteria | 1786 |
| 143 | Ga0207683_10249025 | 3300026121 | Bacteria | 1621 |
| 144 | Ga0207683_10615407 | 3300026121 | Bacteria | 1005 |
| 145 | Ga0209281_1000059 | 3300027111 | Bacteria | 295913 |
| 146 | Ga0209281_1000435 | 3300027111 | Bacteria | 61761 |
| 147 | Ga0209281_1008199 | 3300027111 | Bacteria | 2558 |
| 148 | Ga0209281_1027375 | 3300027111 | Bacteria | 1045 |
| 149 | Ga0209970_1002684 | 3300027614 | Bacteria | 3012 |
| 150 | Ga0209588_1019099 | 3300027671 | Bacteria | 2138 |
| 151 | Ga0207428_10658161 | 3300027907 | Bacteria | 751 |
| 152 | Ga0268266_10555901 | 3300028379 | Bacteria | 1100 |
| 153 | Ga0268265_10241703 | 3300028380 | Bacteria | 1594 |
| 154 | Ga0265334_10043783 | 3300028573 | Bacteria | 1741 |
| 155 | Ga0311000_121821 | 3300029272 | Bacteria | 1739 |
| 156 | Ga0311008_105417 | 3300029273 | Bacteria | 1160 |
| 157 | Ga0311011_144096 | 3300029280 | Bacteria | 1125 |
| 158 | Ga0316176_1026675 | 3300030732 | Bacteria | 1253 |
| 159 | Ga0265327_10057128 | 3300031251 | Bacteria | 2008 |
| 160 | Ga0265327_10094537 | 3300031251 | Bacteria | 1452 |
| 161 | Ga0307408_100017547 | 3300031548 | Bacteria | 4790 |
| 162 | Ga0307408_100028935 | 3300031548 | Bacteria | 3833 |
| 163 | Ga0316579_10073769 | 3300031691 | Bacteria | 1619 |
| 164 | Ga0316576_10025195 | 3300031727 | Bacteria | 4161 |
| 165 | Ga0316578_10037404 | 3300031728 | Bacteria | 2796 |
| 166 | Ga0307405_10021522 | 3300031731 | Bacteria | 3627 |
| 167 | Ga0307405_10215272 | 3300031731 | Bacteria | 1406 |
| 168 | Ga0316577_10048191 | 3300031733 | Bacteria | 2380 |
| 169 | Ga0307407_10029070 | 3300031903 | Bacteria | 2964 |
| 170 | Ga0307412_10505837 | 3300031911 | Bacteria | 1007 |
| 171 | Ga0307409_100018876 | 3300031995 | Bacteria | 4652 |
| 172 | Ga0307409_100071775 | 3300031995 | Bacteria | 2754 |
| 173 | Ga0307409_100088345 | 3300031995 | Bacteria | 2530 |
| 174 | Ga0307416_100018258 | 3300032002 | Bacteria | 4936 |
| 175 | Ga0307416_100044091 | 3300032002 | Bacteria | 3498 |
| 176 | Ga0307416_100078459 | 3300032002 | Bacteria | 2778 |
| 177 | Ga0307416_100198442 | 3300032002 | Bacteria | 1901 |
| 178 | Ga0316583_10023640 | 3300032133 | Bacteria | 2195 |
| 179 | Ga0316593_10087435 | 3300032168 | Bacteria | 1094 |
| 180 | Ga0316596_1014855 | 3300033541 | Bacteria | 1936 |
| 181 | Ga0373956_0164319 | 3300035119 | Bacteria | 1047 |
| 182 | Ga0373946_0074711 | 3300035171 | Bacteria | 1472 |
| 183 | Ga0316574_0071026 | 3300035398 | Bacteria | 2198 |
| 184 | Ga0373933_0064935 | 3300035724 | Bacteria | 2209 |
| 185 | Ga0373937_0035502 | 3300036401 | Bacteria | 4538 |
| 186 | Ga0373937_0112227 | 3300036401 | Bacteria | 2536 |
| 187 | Ga0373937_0305712 | 3300036401 | Bacteria | 1504 |
| 188 | Ga0373937_0931437 | 3300036401 | Bacteria | 818 |
| 189 | Ga0316584_0056348 | 3300036712 | Bacteria | 2942 |
| 190 | Ga0395901_0400270 | 3300038443 | Bacteria | 1411 |
| 191 | Ga0436363_0569927 | 3300039450 | Bacteria | 1027 |
| 192 | Ga0451837_1797435 | 3300041494 | Bacteria | 1347 |
| 193 | Ga0451849_1220464 | 3300041505 | Bacteria | 898 |
| 194 | Ga0439432_084115 | 3300042006 | Bacteria | 962 |
| 195 | Ga0439434_0016420 | 3300042435 | Bacteria | 2212 |
| 196 | Ga0451577_0000006 | 3300042876 | Bacteria | 709265 |
| 197 | Ga0451577_0003986 | 3300042876 | Bacteria | 15905 |
| 198 | Ga0451577_0013644 | 3300042876 | Bacteria | 7597 |
| 199 | Ga0451577_0044106 | 3300042876 | Bacteria | 3992 |
| 200 | Ga0451577_0049529 | 3300042876 | Bacteria | 3751 |
| 201 | Ga0451577_0406614 | 3300042876 | Bacteria | 1235 |
| 202 | Ga0453683_0000088 | 3300044673 | Bacteria | 138620 |
| 203 | Ga0453683_0054407 | 3300044673 | Bacteria | 2504 |
| 204 | Ga0453683_0060221 | 3300044673 | Bacteria | 2374 |
| 205 | Ga0453683_0061026 | 3300044673 | Bacteria | 2358 |
| 206 | Ga0453683_0120787 | 3300044673 | Bacteria | 1649 |
| 207 | Ga0453684_0000037 | 3300044712 | Bacteria | 709327 |
| 208 | Ga0453684_0014172 | 3300044712 | Bacteria | 12805 |
| 209 | Ga0453684_0041342 | 3300044712 | Bacteria | 6238 |
| 210 | Ga0453684_0084669 | 3300044712 | Bacteria | 3942 |
| 211 | Ga0453684_0111896 | 3300044712 | Bacteria | 3315 |
| 212 | Ga0453684_0354000 | 3300044712 | Bacteria | 1655 |
| 213 | Ga0451576_0005544 | 3300045051 | Bacteria | 15765 |
| 214 | Ga0451576_0046384 | 3300045051 | Bacteria | 4576 |
| 215 | Ga0451576_0047429 | 3300045051 | Bacteria | 4517 |
| 216 | Ga0451576_0125712 | 3300045051 | Bacteria | 2672 |
| 217 | Ga0451576_0132882 | 3300045051 | Bacteria | 2594 |
| 218 | Ga0451576_0167626 | 3300045051 | Bacteria | 2292 |
| 219 | Ga0466967_0495836 | 3300045976 | Bacteria | 1198 |
| 220 | Ga0495592_0070640 | 3300046454 | Bacteria | 2543 |
| 221 | Ga0495603_0087286 | 3300046455 | Bacteria | 1825 |
| 222 | Ga0495591_045300 | 3300046458 | Bacteria | 1227 |
| 223 | Ga0495629_0172448 | 3300046459 | Bacteria | 1501 |
| 224 | Ga0495653_0067992 | 3300046463 | Bacteria | 2673 |
| 225 | Ga0495653_0084133 | 3300046463 | Bacteria | 2344 |
| 226 | Ga0495653_0163694 | 3300046463 | Bacteria | 1542 |
| 227 | Ga0495582_0145586 | 3300046473 | Bacteria | 1344 |
| 228 | Ga0495582_0298656 | 3300046473 | Bacteria | 926 |
| 229 | Ga0495605_0031123 | 3300046474 | Bacteria | 2728 |
| 230 | Ga0495664_0051180 | 3300046477 | Bacteria | 2453 |
| 231 | Ga0495584_0010128 | 3300046491 | Bacteria | 4842 |
| 232 | Ga0495585_0012105 | 3300046492 | Bacteria | 5090 |
| 233 | Ga0495608_0064181 | 3300046511 | Bacteria | 2408 |
| 234 | Ga0495608_0110656 | 3300046511 | Bacteria | 1766 |
| 235 | Ga0495608_0195916 | 3300046511 | Bacteria | 1274 |
| 236 | Ga0495618_0063017 | 3300046514 | Bacteria | 2353 |
| 237 | Ga0495620_0007139 | 3300046515 | Bacteria | 6087 |
| 238 | Ga0495620_0067795 | 3300046515 | Bacteria | 1467 |
| 239 | Ga0495628_0038439 | 3300046516 | Bacteria | 3831 |
| 240 | Ga0495630_0058372 | 3300046517 | Bacteria | 2893 |
| 241 | Ga0495630_0063945 | 3300046517 | Bacteria | 2764 |
| 242 | Ga0495630_0266288 | 3300046517 | Bacteria | 1309 |
| 243 | Ga0495630_0307226 | 3300046517 | Bacteria | 1212 |
| 244 | Ga0495666_0018757 | 3300046526 | Bacteria | 3437 |
| 245 | Ga0495654_0060239 | 3300046530 | Bacteria | 1825 |
| 246 | Ga0495654_0110322 | 3300046530 | Bacteria | 1256 |
| 247 | Ga0495654_0139995 | 3300046530 | Bacteria | 1079 |
| 248 | Ga0495640_0098790 | 3300046533 | Bacteria | 1918 |
| 249 | Ga0495640_0102471 | 3300046533 | Bacteria | 1878 |
| 250 | Ga0495640_0185275 | 3300046533 | Bacteria | 1325 |
| 251 | Ga0495645_0170033 | 3300046543 | Bacteria | 1501 |
| 252 | Ga0495622_0014485 | 3300046557 | Bacteria | 3662 |
| 253 | Ga0495622_0018727 | 3300046557 | Bacteria | 3224 |
| 254 | Ga0495622_0173473 | 3300046557 | Bacteria | 969 |
| 255 | Ga0495633_0262847 | 3300046558 | Bacteria | 786 |
| 256 | Ga0495634_0021845 | 3300046642 | Bacteria | 4516 |
| 257 | Ga0495634_0079214 | 3300046642 | Bacteria | 2152 |
| 258 | Ga0495611_0277620 | 3300046648 | Bacteria | 774 |
| 259 | Ga0495635_0220469 | 3300046663 | Bacteria | 1283 |
| 260 | Ga0495635_0407410 | 3300046663 | Bacteria | 903 |
| 261 | Ga0495661_0071169 | 3300046665 | Bacteria | 2033 |
| 262 | Ga0495661_0090130 | 3300046665 | Bacteria | 1746 |
| 263 | Ga0495661_0100675 | 3300046665 | Bacteria | 1627 |
| 264 | Ga0495661_0193121 | 3300046665 | Bacteria | 1071 |
| 265 | Ga0495657_0057798 | 3300046675 | Bacteria | 2578 |
| 266 | Ga0495657_0194364 | 3300046675 | Bacteria | 1239 |
| 267 | Ga0495658_0135894 | 3300046683 | Bacteria | 1500 |
| 268 | Ga0495613_0001886 | 3300046689 | Bacteria | 15917 |
| 269 | Ga0495613_0113102 | 3300046689 | Bacteria | 1955 |
| 270 | Ga0495624_0316939 | 3300046690 | Bacteria | 939 |
| 271 | Ga0495660_0031747 | 3300046810 | Bacteria | 2968 |
| 272 | Ga0495672_0007452 | 3300047320 | Bacteria | 8231 |
| 273 | Ga0495676_0059397 | 3300047321 | Bacteria | 3003 |
| 274 | Ga0495676_0096860 | 3300047321 | Bacteria | 2192 |
| 275 | Ga0495676_0183628 | 3300047321 | Bacteria | 1464 |
| 276 | Ga0495680_0132020 | 3300047322 | Bacteria | 1834 |
| 277 | Ga0495683_0040440 | 3300047323 | Bacteria | 2356 |
| 278 | Ga0495675_0065031 | 3300047444 | Bacteria | 2307 |
| 279 | Ga0495684_0117934 | 3300047471 | Bacteria | 2000 |
| 280 | Ga0495684_0196949 | 3300047471 | Bacteria | 1487 |
| 281 | Ga0495684_0415683 | 3300047471 | Bacteria | 941 |
| 282 | Ga0495602_0168676 | 3300048088 | Bacteria | 1701 |
| 283 | Ga0495614_0010194 | 3300048089 | Bacteria | 4144 |
| 284 | Ga0495626_0079304 | 3300048091 | Bacteria | 1461 |
| 285 | Ga0496100_0005282 | 3300048903 | Bacteria | 6938 |
| 286 | Ga0496100_0024474 | 3300048903 | Bacteria | 3684 |
| 287 | Ga0496100_0160296 | 3300048903 | Bacteria | 1612 |
| 288 | Ga0496101_0110123 | 3300048904 | Bacteria | 2072 |
| 289 | Ga0496101_0228242 | 3300048904 | Bacteria | 1447 |
| 290 | Ga0496102_0010275 | 3300048905 | Bacteria | 8048 |
| 291 | Ga0496102_0270627 | 3300048905 | Bacteria | 1602 |
| 292 | Ga0496102_0389929 | 3300048905 | Bacteria | 1310 |
| 293 | Ga0496102_0485597 | 3300048905 | Bacteria | 1157 |
| 294 | Ga0496102_0573952 | 3300048905 | Bacteria | 1051 |
| 295 | Ga0496103_0001500 | 3300048906 | Bacteria | 15621 |
| 296 | Ga0496104_0001186 | 3300048907 | Bacteria | 22389 |
| 297 | Ga0496104_0187871 | 3300048907 | Bacteria | 1977 |
| 298 | Ga0496104_0876139 | 3300048907 | Bacteria | 803 |
| 299 | Ga0496105_0000964 | 3300048908 | Bacteria | 19760 |
| 300 | Ga0496105_0053016 | 3300048908 | Bacteria | 3350 |
| 301 | Ga0496105_0248853 | 3300048908 | Bacteria | 1440 |
| 302 | Ga0496106_0000361 | 3300048909 | Bacteria | 32313 |
| 303 | Ga0496106_0476293 | 3300048909 | Bacteria | 1003 |
| 304 | Ga0496107_0000282 | 3300048910 | Bacteria | 26883 |
| 305 | Ga0496108_0000443 | 3300048911 | Bacteria | 33208 |
| 306 | Ga0496109_0000778 | 3300048912 | Bacteria | 26502 |
| 307 | Ga0496109_0013733 | 3300048912 | Bacteria | 7037 |
| 308 | Ga0496109_0827626 | 3300048912 | Bacteria | 864 |
| 309 | Ga0496110_0002382 | 3300048913 | Bacteria | 14089 |
| 310 | Ga0496110_0117605 | 3300048913 | Bacteria | 2394 |
| 311 | Ga0496111_0000191 | 3300048914 | Bacteria | 28382 |
| 312 | Ga0496111_0206802 | 3300048914 | Bacteria | 1459 |
| 313 | Ga0496112_0006179 | 3300048915 | Bacteria | 10476 |
| 314 | Ga0496112_0251313 | 3300048915 | Bacteria | 1719 |
| 315 | Ga0496113_0001366 | 3300048916 | Bacteria | 13528 |
| 316 | Ga0496113_0113068 | 3300048916 | Bacteria | 2116 |
| 317 | Ga0496113_0364520 | 3300048916 | Bacteria | 1159 |
| 318 | Ga0496114_0113786 | 3300048917 | Bacteria | 2320 |
| 319 | Ga0496116_0001671 | 3300048919 | Bacteria | 24360 |
| 320 | Ga0496117_0022031 | 3300048920 | Bacteria | 5124 |
| 321 | Ga0496119_0005613 | 3300048922 | Bacteria | 11930 |
| 322 | Ga0496120_0007962 | 3300048923 | Bacteria | 7802 |
| 323 | Ga0496122_0013343 | 3300048925 | Bacteria | 8048 |
| 324 | Ga0496122_0022454 | 3300048925 | Bacteria | 5608 |
| 325 | Ga0496123_0004637 | 3300048926 | Bacteria | 14282 |
| 326 | Ga0496125_0004215 | 3300048928 | Bacteria | 16755 |
| 327 | Ga0496126_0004639 | 3300048929 | Bacteria | 16261 |
| 328 | Ga0496126_0005295 | 3300048929 | Bacteria | 14809 |
| 329 | Ga0501306_000031 | 3300049127 | Bacteria | 7963 |
| 330 | Ga0501306_000487 | 3300049127 | Bacteria | 3061 |
| 331 | Ga0501306_000497 | 3300049127 | Bacteria | 3050 |
| 332 | Ga0501306_000655 | 3300049127 | Bacteria | 2790 |
| 333 | Ga0501306_000823 | 3300049127 | Bacteria | 2631 |
| 334 | Ga0501306_001717 | 3300049127 | Bacteria | 2125 |
| 335 | Ga0501306_002383 | 3300049127 | Bacteria | 1920 |
| 336 | Ga0501306_002549 | 3300049127 | Bacteria | 1881 |
| 337 | Ga0501306_002657 | 3300049127 | Bacteria | 1858 |
| 338 | Ga0501308_000210 | 3300049128 | Bacteria | 3315 |
| 339 | Ga0501308_000287 | 3300049128 | Bacteria | 3046 |
| 340 | Ga0501308_001173 | 3300049128 | Bacteria | 2022 |
| 341 | Ga0501308_001828 | 3300049128 | Bacteria | 1778 |
| 342 | Ga0501308_003751 | 3300049128 | Bacteria | 1427 |
| 343 | Ga0501308_005283 | 3300049128 | Bacteria | 1280 |
| 344 | Ga0501309_000397 | 3300049129 | Bacteria | 3395 |
| 345 | Ga0501309_000721 | 3300049129 | Bacteria | 2871 |
| 346 | Ga0501309_001124 | 3300049129 | Bacteria | 2506 |
| 347 | Ga0501309_001463 | 3300049129 | Bacteria | 2329 |
| 348 | Ga0501309_010685 | 3300049129 | Bacteria | 1187 |
| 349 | Ga0501310_000371 | 3300049130 | Bacteria | 4033 |
| 350 | Ga0501310_000609 | 3300049130 | Bacteria | 3152 |
| 351 | Ga0501310_001129 | 3300049130 | Bacteria | 2402 |
| 352 | Ga0501310_002486 | 3300049130 | Bacteria | 1754 |
| 353 | Ga0501341_00107 | 3300049131 | Bacteria | 2594 |
| 354 | Ga0501341_00208 | 3300049131 | Bacteria | 2141 |
| 355 | Ga0501341_00221 | 3300049131 | Bacteria | 2117 |
| 356 | Ga0501341_00334 | 3300049131 | Bacteria | 1872 |
| 357 | Ga0501341_00436 | 3300049131 | Bacteria | 1746 |
| 358 | Ga0501341_05480 | 3300049131 | Bacteria | 761 |
| 359 | Ga0501343_000282 | 3300049132 | Bacteria | 2803 |
| 360 | Ga0501343_000822 | 3300049132 | Bacteria | 1952 |
| 361 | Ga0501343_001772 | 3300049132 | Bacteria | 1489 |
| 362 | Ga0501343_005673 | 3300049132 | Bacteria | 962 |
| 363 | Ga0501344_00106 | 3300049133 | Bacteria | 2723 |
| 364 | Ga0501344_00120 | 3300049133 | Bacteria | 2644 |
| 365 | Ga0501344_00965 | 3300049133 | Bacteria | 1323 |
| 366 | Ga0501345_00054 | 3300049134 | Bacteria | 2678 |
| 367 | Ga0501304_000742 | 3300049160 | Bacteria | 1845 |
| 368 | Ga0501304_001331 | 3300049160 | Bacteria | 1566 |
| 369 | Ga0501304_002229 | 3300049160 | Bacteria | 1330 |
| 370 | Ga0501305_000002 | 3300049161 | Bacteria | 17524 |
| 371 | Ga0501305_000036 | 3300049161 | Bacteria | 7597 |
| 372 | Ga0501305_000182 | 3300049161 | Bacteria | 4371 |
| 373 | Ga0501305_000320 | 3300049161 | Bacteria | 3757 |
| 374 | Ga0501305_000675 | 3300049161 | Bacteria | 2932 |
| 375 | Ga0501305_000790 | 3300049161 | Bacteria | 2796 |
| 376 | Ga0501305_001538 | 3300049161 | Bacteria | 2283 |
| 377 | Ga0501305_002447 | 3300049161 | Bacteria | 2004 |
| 378 | Ga0501305_002739 | 3300049161 | Bacteria | 1933 |
| 379 | Ga0501305_003224 | 3300049161 | Bacteria | 1834 |
| 380 | Ga0501305_006283 | 3300049161 | Bacteria | 1470 |
| 381 | Ga0501305_024578 | 3300049161 | Bacteria | 909 |
| 382 | Ga0501307_000012 | 3300049162 | Bacteria | 6382 |
| 383 | Ga0501307_000146 | 3300049162 | Bacteria | 3691 |
| 384 | Ga0501307_000209 | 3300049162 | Bacteria | 3392 |
| 385 | Ga0501307_000398 | 3300049162 | Bacteria | 2879 |
| 386 | Ga0501307_000466 | 3300049162 | Bacteria | 2738 |
| 387 | Ga0501307_000679 | 3300049162 | Bacteria | 2494 |
| 388 | Ga0501307_002114 | 3300049162 | Bacteria | 1809 |
| 389 | Ga0501342_00058 | 3300049163 | Bacteria | 2302 |
| 390 | Ga0501311_000004 | 3300049527 | Bacteria | 9566 |
| 391 | Ga0501311_000007 | 3300049527 | Bacteria | 8668 |
| 392 | Ga0501311_000810 | 3300049527 | Bacteria | 2422 |
| 393 | Ga0501311_001097 | 3300049527 | Bacteria | 2240 |
| 394 | Ga0501311_001468 | 3300049527 | Bacteria | 2058 |
| 395 | Ga0501311_002237 | 3300049527 | Bacteria | 1825 |
| 396 | Ga0501312_000003 | 3300049528 | Bacteria | 16850 |
| 397 | Ga0501312_000006 | 3300049528 | Bacteria | 10477 |
| 398 | Ga0501312_000567 | 3300049528 | Bacteria | 3090 |
| 399 | Ga0501312_000589 | 3300049528 | Bacteria | 3053 |
| 400 | Ga0501312_000598 | 3300049528 | Bacteria | 3037 |
| 401 | Ga0501312_000704 | 3300049528 | Bacteria | 2870 |
| 402 | Ga0501312_000761 | 3300049528 | Bacteria | 2807 |
| 403 | Ga0501312_000887 | 3300049528 | Bacteria | 2696 |
| 404 | Ga0501312_004363 | 3300049528 | Bacteria | 1663 |
| 405 | Ga0501313_000017 | 3300049529 | Bacteria | 8074 |
| 406 | Ga0501313_000080 | 3300049529 | Bacteria | 4457 |
| 407 | Ga0501313_000518 | 3300049529 | Bacteria | 2688 |
| 408 | Ga0501313_000585 | 3300049529 | Bacteria | 2623 |
| 409 | Ga0501313_001232 | 3300049529 | Bacteria | 2150 |
| 410 | Ga0501313_001631 | 3300049529 | Bacteria | 2004 |
| 411 | Ga0501313_006310 | 3300049529 | Bacteria | 1281 |
| 412 | Ga0501313_006820 | 3300049529 | Bacteria | 1246 |
| 413 | Ga0501314_000256 | 3300049530 | Bacteria | 3073 |
| 414 | Ga0501314_000364 | 3300049530 | Bacteria | 2732 |
| 415 | Ga0501314_000376 | 3300049530 | Bacteria | 2713 |
| 416 | Ga0501314_000408 | 3300049530 | Bacteria | 2651 |
| 417 | Ga0501314_000534 | 3300049530 | Bacteria | 2405 |
| 418 | Ga0501314_000966 | 3300049530 | Bacteria | 1949 |
| 419 | Ga0501314_001086 | 3300049530 | Bacteria | 1884 |
| 420 | Ga0501315_000019 | 3300049531 | Bacteria | 7980 |
| 421 | Ga0501315_000121 | 3300049531 | Bacteria | 4217 |
| 422 | Ga0501315_000389 | 3300049531 | Bacteria | 2964 |
| 423 | Ga0501315_000420 | 3300049531 | Bacteria | 2887 |
| 424 | Ga0501315_000455 | 3300049531 | Bacteria | 2824 |
| 425 | Ga0501315_001280 | 3300049531 | Bacteria | 2101 |
| 426 | Ga0501315_001361 | 3300049531 | Bacteria | 2067 |
| 427 | Ga0501315_002350 | 3300049531 | Bacteria | 1765 |
| 428 | Ga0501316_000029 | 3300049532 | Bacteria | 5933 |
| 429 | Ga0501316_000057 | 3300049532 | Bacteria | 4894 |
| 430 | Ga0501316_000077 | 3300049532 | Bacteria | 4588 |
| 431 | Ga0501316_000101 | 3300049532 | Bacteria | 4292 |
| 432 | Ga0501316_000267 | 3300049532 | Bacteria | 3270 |
| 433 | Ga0501316_000578 | 3300049532 | Bacteria | 2626 |
| 434 | Ga0501316_006198 | 3300049532 | Bacteria | 1267 |
| 435 | Ga0501317_000001 | 3300049533 | Bacteria | 21405 |
| 436 | Ga0501317_000015 | 3300049533 | Bacteria | 8499 |
| 437 | Ga0501317_000025 | 3300049533 | Bacteria | 7145 |
| 438 | Ga0501317_000117 | 3300049533 | Bacteria | 4257 |
| 439 | Ga0501317_000283 | 3300049533 | Bacteria | 3283 |
| 440 | Ga0501317_000743 | 3300049533 | Bacteria | 2483 |
| 441 | Ga0501317_001493 | 3300049533 | Bacteria | 2026 |
| 442 | Ga0501318_000001 | 3300049534 | Bacteria | 17462 |
| 443 | Ga0501318_000024 | 3300049534 | Bacteria | 6225 |
| 444 | Ga0501318_000298 | 3300049534 | Bacteria | 2899 |
| 445 | Ga0501318_000737 | 3300049534 | Bacteria | 2248 |
| 446 | Ga0501318_000818 | 3300049534 | Bacteria | 2175 |
| 447 | Ga0501318_001153 | 3300049534 | Bacteria | 1990 |
| 448 | Ga0501318_001644 | 3300049534 | Bacteria | 1804 |
| 449 | Ga0501319_000019 | 3300049535 | Bacteria | 5995 |
| 450 | Ga0501319_000069 | 3300049535 | Bacteria | 3482 |
| 451 | Ga0501319_000142 | 3300049535 | Bacteria | 2712 |
| 452 | Ga0501320_000031 | 3300049536 | Bacteria | 7449 |
| 453 | Ga0501320_000127 | 3300049536 | Bacteria | 3488 |
| 454 | Ga0501320_000269 | 3300049536 | Bacteria | 2795 |
| 455 | Ga0501320_000417 | 3300049536 | Bacteria | 2438 |
| 456 | Ga0501320_001252 | 3300049536 | Bacteria | 1810 |
| 457 | Ga0501320_011413 | 3300049536 | Bacteria | 920 |
| 458 | Ga0501321_000001 | 3300049537 | Bacteria | 16207 |
| 459 | Ga0501321_000032 | 3300049537 | Bacteria | 6962 |
| 460 | Ga0501321_000087 | 3300049537 | Bacteria | 4286 |
| 461 | Ga0501321_000347 | 3300049537 | Bacteria | 2848 |
| 462 | Ga0501321_000491 | 3300049537 | Bacteria | 2548 |
| 463 | Ga0501321_000499 | 3300049537 | Bacteria | 2534 |
| 464 | Ga0501321_005487 | 3300049537 | Bacteria | 1256 |
| 465 | Ga0501321_023432 | 3300049537 | Bacteria | 783 |
| 466 | Ga0501322_000105 | 3300049538 | Bacteria | 3214 |
| 467 | Ga0501322_000132 | 3300049538 | Bacteria | 2858 |
| 468 | Ga0501322_000252 | 3300049538 | Bacteria | 2333 |
| 469 | Ga0501322_000299 | 3300049538 | Bacteria | 2191 |
| 470 | Ga0501322_000543 | 3300049538 | Bacteria | 1820 |
| 471 | Ga0501322_000986 | 3300049538 | Bacteria | 1494 |
| 472 | Ga0501323_000031 | 3300049539 | Bacteria | 6387 |
| 473 | Ga0501323_000123 | 3300049539 | Bacteria | 4354 |
| 474 | Ga0501323_000356 | 3300049539 | Bacteria | 3260 |
| 475 | Ga0501323_000970 | 3300049539 | Bacteria | 2369 |
| 476 | Ga0501323_001243 | 3300049539 | Bacteria | 2202 |
| 477 | Ga0501323_001559 | 3300049539 | Bacteria | 2070 |
| 478 | Ga0501323_001588 | 3300049539 | Bacteria | 2058 |
| 479 | Ga0501323_002019 | 3300049539 | Bacteria | 1913 |
| 480 | Ga0501324_000001 | 3300049540 | Bacteria | 20831 |
| 481 | Ga0501324_000376 | 3300049540 | Bacteria | 2340 |
| 482 | Ga0501324_000524 | 3300049540 | Bacteria | 2114 |
| 483 | Ga0501324_000689 | 3300049540 | Bacteria | 1967 |
| 484 | Ga0501324_000710 | 3300049540 | Bacteria | 1950 |
| 485 | Ga0501324_001015 | 3300049540 | Bacteria | 1761 |
| 486 | Ga0501326_00062 | 3300049542 | Bacteria | 3234 |
| 487 | Ga0501326_00067 | 3300049542 | Bacteria | 3110 |
| 488 | Ga0501326_00091 | 3300049542 | Bacteria | 2798 |
| 489 | Ga0501326_00102 | 3300049542 | Bacteria | 2677 |
| 490 | Ga0501327_00098 | 3300049543 | Bacteria | 2655 |
| 491 | Ga0501327_00117 | 3300049543 | Bacteria | 2454 |
| 492 | Ga0501327_01095 | 3300049543 | Bacteria | 1251 |
| 493 | Ga0501328_00058 | 3300049544 | Bacteria | 2566 |
| 494 | Ga0501328_00120 | 3300049544 | Bacteria | 2054 |
| 495 | Ga0501328_00233 | 3300049544 | Bacteria | 1656 |
| 496 | Ga0501329_00035 | 3300049545 | Bacteria | 3186 |
| 497 | Ga0501330_000008 | 3300049546 | Bacteria | 6041 |
| 498 | Ga0501330_000037 | 3300049546 | Bacteria | 3347 |
| 499 | Ga0501330_000125 | 3300049546 | Bacteria | 2480 |
| 500 | Ga0501330_000173 | 3300049546 | Bacteria | 2255 |
| 501 | Ga0501330_000225 | 3300049546 | Bacteria | 2104 |
| 502 | Ga0501331_00059 | 3300049547 | Bacteria | 3195 |
| 503 | Ga0501332_00020 | 3300049548 | Bacteria | 4348 |
| 504 | Ga0501332_00078 | 3300049548 | Bacteria | 2904 |
| 505 | Ga0501332_00260 | 3300049548 | Bacteria | 2144 |
| 506 | Ga0501333_000285 | 3300049549 | Bacteria | 2172 |
| 507 | Ga0501333_000472 | 3300049549 | Bacteria | 1851 |
| 508 | Ga0501333_000872 | 3300049549 | Bacteria | 1520 |
| 509 | Ga0501334_00027 | 3300049550 | Bacteria | 4527 |
| 510 | Ga0501334_00251 | 3300049550 | Bacteria | 2218 |
| 511 | Ga0501335_000498 | 3300049551 | Bacteria | 2548 |
| 512 | Ga0501335_001188 | 3300049551 | Bacteria | 1952 |
| 513 | Ga0501335_001575 | 3300049551 | Bacteria | 1766 |
| 514 | Ga0501335_001947 | 3300049551 | Bacteria | 1638 |
| 515 | Ga0501335_002815 | 3300049551 | Bacteria | 1436 |
| 516 | Ga0501335_003930 | 3300049551 | Bacteria | 1279 |
| 517 | Ga0501335_006302 | 3300049551 | Bacteria | 1078 |
| 518 | Ga0501336_000091 | 3300049552 | Bacteria | 3189 |
| 519 | Ga0501337_000054 | 3300049553 | Bacteria | 3895 |
| 520 | Ga0501337_000088 | 3300049553 | Bacteria | 3392 |
| 521 | Ga0501337_000691 | 3300049553 | Bacteria | 1748 |
| 522 | Ga0501337_000729 | 3300049553 | Bacteria | 1713 |
| 523 | Ga0501338_00091 | 3300049554 | Bacteria | 2839 |
| 524 | Ga0501338_00103 | 3300049554 | Bacteria | 2781 |
| 525 | Ga0501338_00500 | 3300049554 | Bacteria | 1800 |
| 526 | Ga0501338_01785 | 3300049554 | Bacteria | 1187 |
| 527 | Ga0501339_00007 | 3300049555 | Bacteria | 2547 |
| 528 | Ga0501340_000099 | 3300049556 | Bacteria | 2752 |
| 529 | Ga0501340_000108 | 3300049556 | Bacteria | 2699 |
| 530 | Ga0501340_000251 | 3300049556 | Bacteria | 2075 |
| 531 | Ga0501034_0024059 | 3300049571 | Bacteria | 6197 |
| 532 | Ga0501040_0350956 | 3300049576 | Bacteria | 1057 |
| 533 | Ga0501041_0333186 | 3300049577 | Bacteria | 958 |
| 534 | Ga0501043_0094276 | 3300049579 | Bacteria | 2353 |
| 535 | Ga0501046_0049684 | 3300049580 | Bacteria | 3317 |
| 536 | Ga0501047_0063124 | 3300049581 | Bacteria | 3573 |
| 537 | Ga0501070_0011947 | 3300049586 | Bacteria | 7333 |
| 538 | Ga0501072_0170876 | 3300049588 | Bacteria | 1735 |
| 539 | Ga0501072_0209865 | 3300049588 | Bacteria | 1552 |
| 540 | Ga0501072_0266591 | 3300049588 | Bacteria | 1363 |
| 541 | Ga0501073_0118279 | 3300049589 | Bacteria | 1837 |
| 542 | Ga0501075_0236530 | 3300049591 | Bacteria | 1393 |
| 543 | Ga0501202_018425 | 3300049652 | Bacteria | 1371 |
| 544 | Ga0501217_004344 | 3300049661 | Bacteria | 2908 |
| 545 | Ga0501217_005351 | 3300049661 | Bacteria | 2679 |
| 546 | Ga0501227_021242 | 3300049665 | Bacteria | 1496 |
| 547 | Ga0501245_009931 | 3300049708 | Bacteria | 1371 |
| 548 | Ga0501080_0027162 | 3300049742 | Bacteria | 5323 |
| 549 | Ga0501270_001993 | 3300049767 | Bacteria | 2040 |
| 550 | Ga0501212_009766 | 3300049851 | Bacteria | 1358 |
| 551 | nmdc:mga00v17_13821_c1 | 3300050491 | Bacteria | 4490 |
| 552 | nmdc:mga06z11_228180_c1 | 3300050494 | Bacteria | 1090 |
| 553 | nmdc:mga0qj67_472396_c1 | 3300050509 | Bacteria | 1009 |
| 554 | nmdc:mga06r32_62945_c1 | 3300050510 | Bacteria | 3574 |
| 555 | nmdc:mga08y16_109076_c1 | 3300050511 | Bacteria | 2882 |
| 556 | nmdc:mga08y16_128140_c1 | 3300050511 | Bacteria | 2640 |
| 557 | nmdc:mga08y16_3103_c1 | 3300050511 | Bacteria | 17195 |
| 558 | nmdc:mga0n895_950611_c1 | 3300050512 | Bacteria | 843 |
| 559 | nmdc:mga0rr50_42251_c1 | 3300050513 | Bacteria | 3328 |
| 560 | Ga0495601_0010480 | 3300053077 | Bacteria | 5518 |
| 561 | Ga0495601_0160426 | 3300053077 | Bacteria | 1469 |
| 562 | Ga0495612_0040570 | 3300053078 | Bacteria | 1897 |
| 563 | Ga0495595_0020140 | 3300053084 | Bacteria | 2901 |
| 564 | Ga0495619_0021877 | 3300053085 | Bacteria | 4086 |
| 565 | Ga0495619_0025656 | 3300053085 | Bacteria | 3787 |
| 566 | Ga0495619_0152126 | 3300053085 | Bacteria | 1596 |
| 567 | Ga0495619_0296446 | 3300053085 | Bacteria | 1120 |
| 568 | Ga0501084_0000009 | 3300054114 | Bacteria | 194961 |
| 569 | Ga0587111_0017291 | 3300060346 | Bacteria | 1342 |
| 570 | Ga0587111_0077658 | 3300060346 | Bacteria | 788 |
| 571 | 2511697986 | 2511231119 | Bacteria | 4019861 |
| 572 | 2540605210 | 2540341094 | Bacteria | 4061186 |
| 573 | 2545559776 | 2545555800 | Bacteria | 4222588 |
| 574 | 2555470864 | 2554235283 | Bacteria | 3683090 |
| 575 | 2556065810 | 2554235469 | Bacteria | 3590176 |
| 576 | 2578930732 | 2576861599 | Bacteria | 4217202 |
| 577 | 2600199857 | 2599185353 | Bacteria | 2219443 |
| 578 | 2600402889 | 2600254943 | Bacteria | 2613887 |
| 579 | 2601444987 | 2600255229 | Bacteria | 1988965 |
| 580 | 2631982480 | 2630968484 | Bacteria | 3876276 |
| 581 | 2644721357 | 2643221731 | Bacteria | 5623886 |
| 582 | 2644723342 | 2643221732 | Bacteria | 5756404 |
| 583 | 2644741844 | 2643221735 | Bacteria | 3676263 |
| 584 | 2651530344 | 2648501850 | Bacteria | 3975476 |
| 585 | 2672333572 | 2671180330 | Bacteria | 5521719 |
| 586 | 2674421101 | 2671180844 | Bacteria | 4164150 |
| 587 | 2686995308 | 2684623153 | Bacteria | 3878815 |
| 588 | 2687496557 | 2687453109 | Bacteria | 3860091 |
| 589 | 2695629905 | 2695420354 | Bacteria | 3922431 |
| 590 | 2712198852 | 2711768088 | Bacteria | 3195027 |
| 591 | 2717918195 | 2716884898 | Bacteria | 3928789 |
| 592 | 2738817086 | 2738541295 | Bacteria | 5730091 |
| 593 | 2738838978 | 2738541299 | Bacteria | 4020721 |
| 594 | 2739234652 | 2738543010 | Bacteria | 5583595 |
| 595 | 2791215898 | 2788500588 | Bacteria | 4584915 |
| 596 | 2809057202 | 2808606399 | Bacteria | 4021018 |
| 597 | 2812314447 | 2811994870 | Bacteria | 3776934 |
| 598 | 2816866395 | 2816332186 | Bacteria | 5331395 |
| 599 | 2817478174 | 2816332295 | Bacteria | 4352468 |
| 600 | 2819571014 | 2818991441 | Bacteria | 5062707 |
| 601 | 2819627568 | 2818991451 | Bacteria | 4697364 |
| 602 | 2819711982 | 2818991465 | Bacteria | 5388835 |
| 603 | 2819726084 | 2818991468 | Bacteria | 3723169 |
| 604 | 2823526400 | 2823526263 | Bacteria | 3765752 |
| 605 | 2842688259 | 2842682962 | Bacteria | 5589973 |
| 606 | 2842887740 | 2842882022 | Bacteria | 6158489 |
| 607 | 2849144953 | 2849139964 | Bacteria | 5613304 |
| 608 | 2852676601 | 2852673933 | Bacteria | 3347676 |
| 609 | 2857586499 | 2857581216 | Bacteria | 5522813 |
| 610 | 2860837564 | 2860837431 | Bacteria | 4202080 |
| 611 | 2877768783 | 2877768649 | Bacteria | 3957164 |
| 612 | 2880169725 | 2880169592 | Bacteria | 3900066 |
| 613 | 2881646618 | 2881644220 | Bacteria | 5302661 |
| 614 | 2897109752 | 2897109615 | Bacteria | 4009619 |
| 615 | 2904530150 | 2904524088 | Bacteria | 5887454 |
| 616 | 2904564574 | 2904560550 | Bacteria | 4029838 |
| 617 | 2904610110 | 2904606771 | Bacteria | 4684500 |
| 618 | 2908669335 | 2908665501 | Bacteria | 3678115 |
| 619 | 2919097093 | 2919093281 | Bacteria | 3660974 |
| 620 | 2919149619 | 2919143609 | Bacteria | 6219228 |
| 621 | 2919419338 | 2919414237 | Bacteria | 5429133 |
| 622 | 2919523208 | 2919517244 | Bacteria | 5858162 |
| 623 | 2919726429 | 2919720352 | Bacteria | 5986006 |
| 624 | 2919730750 | 2919726948 | Bacteria | 3696050 |
| 625 | 2928099898 | 2928093941 | Bacteria | 5965005 |
| 626 | 2928513064 | 2928510474 | Bacteria | 4815308 |
| 627 | 2929009919 | 2929004312 | Bacteria | 5678476 |
| 628 | 2936363677 | 2936361878 | Bacteria | 5632809 |
| 629 | 2939596162 | 2939593269 | Bacteria | 4798695 |
| 630 | 2954776096 | 2954773129 | Bacteria | 3741715 |
| 631 | 2960324300 | 2960319331 | Bacteria | 5502575 |
| 632 | 2960378877 | 2960375949 | Bacteria | 5361395 |
| 633 | 2962290775 | 2962290636 | Bacteria | 4072939 |
| 634 | 2969136982 | 2969136845 | Bacteria | 3923176 |
| 635 | 2969141151 | 2969141011 | Bacteria | 4118468 |
| 636 | 2969766269 | 2969765954 | Bacteria | 4216713 |
| 637 | 2969774937 | 2969770375 | Bacteria | 4271280 |
| 638 | 2971893512 | 2971893375 | Bacteria | 3929648 |
| 639 | 2977254710 | 2977254563 | Bacteria | 4828420 |
| 640 | 2980492726 | 2980492589 | Bacteria | 4072961 |
| 641 | 2990275713 | 2990275345 | Bacteria | 4887158 |
| 642 | 3001271854 | 3001267043 | Bacteria | 4823521 |
| 643 | 3001275940 | 3001272096 | Bacteria | 4729684 |
| 644 | 3001898811 | 3001892409 | Bacteria | 6328293 |
| 645 | 3006858502 | 3006858327 | Bacteria | 4317835 |
| 646 | 3006883613 | 3006879489 | Bacteria | 4064221 |
| 647 | 3006973796 | 3006969106 | Bacteria | 4739423 |
| 648 | 3006978373 | 3006973921 | Bacteria | 4423788 |
| 649 | 3006988366 | 3006984091 | Bacteria | 4207523 |
| 650 | 3006993231 | 3006988479 | Bacteria | 4767936 |
| 651 | 8007379869 | 8007375930 | Bacteria | 4080554 |
| 652 | 8022631656 | 8022630665 | Bacteria | 3886130 |
| 653 | 8022893418 | 8022893055 | Bacteria | 5300455 |
| 654 | 8022917932 | 8022914991 | Bacteria | 5584517 |
| 655 | 8051956495 | 8051952484 | Bacteria | 3926774 |
| 656 | 8052174971 | 8052174270 | Bacteria | 3881265 |
| 657 | 8054282848 | 8054280661 | Bacteria | 4232245 |
| 658 | 8055537116 | 8055531788 | Bacteria | 5249694 |
| 659 | 8057632267 | 8057632132 | Bacteria | 4726859 |
| 660 | Ga0501338_00782 | |||
| 661 | JGI25151J46595_10000735 | |||
| 662 | JGI25151J46595_10001136 | |||
| 663 | JGI25151J46595_10003308 | |||
| 664 | JGI25151J46595_10012381 | |||
| 665 | rootH1_10000848 | |||
| 666 | rootL2_10052955 | |||
| 667 | Ga0006562J51391_1000046 | |||
| 668 | Ga0006562J51391_1000677 | |||
| 669 | Ga0055538_1000081 | |||
| 670 | Ga0055528_1001614 | |||
| 671 | Ga0065704_10019174 | |||
| 672 | Ga0065712_10079230 | |||
| 673 | Ga0065712_10189397 | |||
| 674 | Ga0065715_10190587 | |||
| 675 | Ga0070676_10006452 | |||
| 676 | Ga0070676_10240833 | |||
| 677 | Ga0070670_100019013 | |||
| 678 | Ga0070670_100020078 | |||
| 679 | Ga0070670_100560597 | |||
| 680 | Ga0068869_100075173 | |||
| 681 | Ga0068868_100339119 | |||
| 682 | Ga0070689_100027530 | |||
| 683 | Ga0070692_10398912 | |||
| 684 | Ga0070669_100199350 | |||
| 685 | Ga0070675_100066415 | |||
| 686 | Ga0070675_100398625 | |||
| 687 | Ga0070671_100011607 | |||
| 688 | Ga0070674_100570710 | |||
| 689 | Ga0070688_100026187 | |||
| 690 | Ga0070659_100814034 | |||
| 691 | Ga0070700_100522998 | |||
| 692 | Ga0070694_100528691 | |||
| 693 | Ga0070708_100715719 | |||
| 694 | Ga0070678_100272510 | |||
| 695 | Ga0070678_100316314 | |||
| 696 | Ga0070678_100375143 | |||
| 697 | Ga0068867_100023582 | |||
| 698 | Ga0070685_10006863 | |||
| 699 | Ga0070706_100466541 | |||
| 700 | Ga0070707_100709667 | |||
| 701 | Ga0070698_100278933 | |||
| 702 | Ga0070699_100080347 | |||
| 703 | Ga0070679_100432153 | |||
| 704 | Ga0070697_100017739 | |||
| 705 | Ga0070697_100253963 | |||
| 706 | Ga0070672_100025082 | |||
| 707 | Ga0070665_101155262 | |||
| 708 | Ga0068857_100013317 | |||
| 709 | Ga0068859_100028015 | |||
| 710 | Ga0068862_100128838 | |||
| 711 | Ga0075364_10006779 | |||
| 712 | Ga0070715_10058571 | |||
| 713 | Ga0070715_10065228 | |||
| 714 | Ga0075367_10195954 | |||
| 715 | Ga0075428_100063863 | |||
| 716 | Ga0075428_100542290 | |||
| 717 | Ga0075431_100177183 | |||
| 718 | Ga0075434_100062039 | |||
| 719 | Ga0068865_100123349 | |||
| 720 | Ga0068865_100450720 | |||
| 721 | Ga0075436_100041067 | |||
| 722 | Ga0097620_100028015 | |||
| 723 | Ga0079104_1001572 | |||
| 724 | Ga0079104_1009498 | |||
| 725 | Ga0075435_100148690 | |||
| 726 | Ga0105244_10026966 | |||
| 727 | Ga0105244_10094277 | |||
| 728 | Ga0105250_10018759 | |||
| 729 | Ga0111539_10042697 | |||
| 730 | Ga0111539_10076046 | |||
| 731 | Ga0111539_10741310 | |||
| 732 | Ga0111539_11101146 | |||
| 733 | Ga0105245_10006900 | |||
| 734 | Ga0105245_10129583 | |||
| 735 | Ga0105247_10000354 | |||
| 736 | Ga0105243_10000301 | |||
| 737 | Ga0105243_10228729 | |||
| 738 | Ga0105241_10088992 | |||
| 739 | Ga0105242_10004076 | |||
| 740 | Ga0105242_10065634 | |||
| 741 | Ga0099796_10025844 | |||
| 742 | Ga0105246_10000077 | |||
| 743 | Ga0157371_10005050 | |||
| 744 | Ga0157374_10013578 | |||
| 745 | Ga0157378_10000237 | |||
| 746 | Ga0157378_10066150 | |||
| 747 | Ga0157375_10153511 | |||
| 748 | Ga0157375_10249039 | |||
| 749 | Ga0157380_10046726 | |||
| 750 | Ga0157377_10002894 | |||
| 751 | Ga0157376_10014258 | |||
| 752 | Ga0224712_10011825 | |||
| 753 | Ga0209784_100044 | |||
| 754 | Ga0209147_100806 | |||
| 755 | Ga0209673_1001881 | |||
| 756 | Ga0209676_1057025 | |||
| 757 | Ga0209025_1000639 | |||
| 758 | Ga0209025_1002868 | |||
| 759 | Ga0209025_1016387 | |||
| 760 | Ga0209025_1021451 | |||
| 761 | Ga0207426_1008659 | |||
| 762 | Ga0207696_1004774 | |||
| 763 | Ga0207655_1007619 | |||
| 764 | Ga0207713_1000405 | |||
| 765 | Ga0207688_10121887 | |||
| 766 | Ga0207685_10228621 | |||
| 767 | Ga0207645_10036479 | |||
| 768 | Ga0207646_10012863 | |||
| 769 | Ga0207646_10166025 | |||
| 770 | Ga0207681_10110484 | |||
| 771 | Ga0207681_10254309 | |||
| 772 | Ga0207681_10440745 | |||
| 773 | Ga0207681_10527108 | |||
| 774 | Ga0207650_10013760 | |||
| 775 | Ga0207659_10053626 | |||
| 776 | Ga0207659_10274297 | |||
| 777 | Ga0207687_10006698 | |||
| 778 | Ga0207687_10095721 | |||
| 779 | Ga0207644_10001801 | |||
| 780 | Ga0207686_10004946 | |||
| 781 | Ga0207686_10169188 | |||
| 782 | Ga0207709_10000416 | |||
| 783 | Ga0207709_10374243 | |||
| 784 | Ga0207670_10059001 | |||
| 785 | Ga0207669_10074531 | |||
| 786 | Ga0207669_10475814 | |||
| 787 | Ga0207704_10043139 | |||
| 788 | Ga0207704_10179121 | |||
| 789 | Ga0207691_10039329 | |||
| 790 | Ga0207689_10085506 | |||
| 791 | Ga0207712_10048314 | |||
| 792 | Ga0207668_10298490 | |||
| 793 | Ga0207677_10253818 | |||
| 794 | Ga0207677_10465257 | |||
| 795 | Ga0207678_10356877 | |||
| 796 | Ga0207708_10132970 | |||
| 797 | Ga0207648_10033930 | |||
| 798 | Ga0207648_10068016 | |||
| 799 | Ga0207675_100087087 | |||
| 800 | Ga0207675_100709680 | |||
| 801 | Ga0207683_10206718 | |||
| 802 | Ga0207683_10249025 | |||
| 803 | Ga0207683_10615407 | |||
| 804 | Ga0209281_1000059 | |||
| 805 | Ga0209281_1000435 | |||
| 806 | Ga0209281_1008199 | |||
| 807 | Ga0209281_1027375 | |||
| 808 | Ga0209970_1002684 | |||
| 809 | Ga0209588_1019099 | |||
| 810 | Ga0207428_10658161 | |||
| 811 | Ga0268266_10555901 | |||
| 812 | Ga0268265_10241703 | |||
| 813 | Ga0265334_10043783 | |||
| 814 | Ga0311000_121821 | |||
| 815 | Ga0311008_105417 | |||
| 816 | Ga0311011_144096 | |||
| 817 | Ga0316176_1026675 | |||
| 818 | Ga0265327_10057128 | |||
| 819 | Ga0265327_10094537 | |||
| 820 | Ga0307408_100017547 | |||
| 821 | Ga0307408_100028935 | |||
| 822 | Ga0316579_10073769 | |||
| 823 | Ga0316576_10025195 | |||
| 824 | Ga0316578_10037404 | |||
| 825 | Ga0307405_10021522 | |||
| 826 | Ga0307405_10215272 | |||
| 827 | Ga0316577_10048191 | |||
| 828 | Ga0307407_10029070 | |||
| 829 | Ga0307412_10505837 | |||
| 830 | Ga0307409_100018876 | |||
| 831 | Ga0307409_100071775 | |||
| 832 | Ga0307409_100088345 | |||
| 833 | Ga0307416_100018258 | |||
| 834 | Ga0307416_100044091 | |||
| 835 | Ga0307416_100078459 | |||
| 836 | Ga0307416_100198442 | |||
| 837 | Ga0316583_10023640 | |||
| 838 | Ga0316593_10087435 | |||
| 839 | Ga0316596_1014855 | |||
| 840 | Ga0373956_0164319 | |||
| 841 | Ga0373946_0074711 | |||
| 842 | Ga0316574_0071026 | |||
| 843 | Ga0373933_0064935 | |||
| 844 | Ga0373937_0035502 | |||
| 845 | Ga0373937_0112227 | |||
| 846 | Ga0373937_0305712 | |||
| 847 | Ga0373937_0931437 | |||
| 848 | Ga0316584_0056348 | |||
| 849 | Ga0395901_0400270 | |||
| 850 | Ga0436363_0569927 | |||
| 851 | Ga0451837_1797435 | |||
| 852 | Ga0451849_1220464 | |||
| 853 | Ga0439432_084115 | |||
| 854 | Ga0439434_0016420 | |||
| 855 | Ga0451577_0000006 | |||
| 856 | Ga0451577_0003986 | |||
| 857 | Ga0451577_0013644 | |||
| 858 | Ga0451577_0044106 | |||
| 859 | Ga0451577_0049529 | |||
| 860 | Ga0451577_0406614 | |||
| 861 | Ga0453683_0000088 | |||
| 862 | Ga0453683_0054407 | |||
| 863 | Ga0453683_0060221 | |||
| 864 | Ga0453683_0061026 | |||
| 865 | Ga0453683_0120787 | |||
| 866 | Ga0453684_0000037 | |||
| 867 | Ga0453684_0014172 | |||
| 868 | Ga0453684_0041342 | |||
| 869 | Ga0453684_0084669 | |||
| 870 | Ga0453684_0111896 | |||
| 871 | Ga0453684_0354000 | |||
| 872 | Ga0451576_0005544 | |||
| 873 | Ga0451576_0046384 | |||
| 874 | Ga0451576_0047429 | |||
| 875 | Ga0451576_0125712 | |||
| 876 | Ga0451576_0132882 | |||
| 877 | Ga0451576_0167626 | |||
| 878 | Ga0466967_0495836 | |||
| 879 | Ga0495592_0070640 | |||
| 880 | Ga0495603_0087286 | |||
| 881 | Ga0495591_045300 | |||
| 882 | Ga0495629_0172448 | |||
| 883 | Ga0495653_0067992 | |||
| 884 | Ga0495653_0084133 | |||
| 885 | Ga0495653_0163694 | |||
| 886 | Ga0495582_0145586 | |||
| 887 | Ga0495582_0298656 | |||
| 888 | Ga0495605_0031123 | |||
| 889 | Ga0495664_0051180 | |||
| 890 | Ga0495584_0010128 | |||
| 891 | Ga0495585_0012105 | |||
| 892 | Ga0495608_0064181 | |||
| 893 | Ga0495608_0110656 | |||
| 894 | Ga0495608_0195916 | |||
| 895 | Ga0495618_0063017 | |||
| 896 | Ga0495620_0007139 | |||
| 897 | Ga0495620_0067795 | |||
| 898 | Ga0495628_0038439 | |||
| 899 | Ga0495630_0058372 | |||
| 900 | Ga0495630_0063945 | |||
| 901 | Ga0495630_0266288 | |||
| 902 | Ga0495630_0307226 | |||
| 903 | Ga0495666_0018757 | |||
| 904 | Ga0495654_0060239 | |||
| 905 | Ga0495654_0110322 | |||
| 906 | Ga0495654_0139995 | |||
| 907 | Ga0495640_0098790 | |||
| 908 | Ga0495640_0102471 | |||
| 909 | Ga0495640_0185275 | |||
| 910 | Ga0495645_0170033 | |||
| 911 | Ga0495622_0014485 | |||
| 912 | Ga0495622_0018727 | |||
| 913 | Ga0495622_0173473 | |||
| 914 | Ga0495633_0262847 | |||
| 915 | Ga0495634_0021845 | |||
| 916 | Ga0495634_0079214 | |||
| 917 | Ga0495611_0277620 | |||
| 918 | Ga0495635_0220469 | |||
| 919 | Ga0495635_0407410 | |||
| 920 | Ga0495661_0071169 | |||
| 921 | Ga0495661_0090130 | |||
| 922 | Ga0495661_0100675 | |||
| 923 | Ga0495661_0193121 | |||
| 924 | Ga0495657_0057798 | |||
| 925 | Ga0495657_0194364 | |||
| 926 | Ga0495658_0135894 | |||
| 927 | Ga0495613_0001886 | |||
| 928 | Ga0495613_0113102 | |||
| 929 | Ga0495624_0316939 | |||
| 930 | Ga0495660_0031747 | |||
| 931 | Ga0495672_0007452 | |||
| 932 | Ga0495676_0059397 | |||
| 933 | Ga0495676_0096860 | |||
| 934 | Ga0495676_0183628 | |||
| 935 | Ga0495680_0132020 | |||
| 936 | Ga0495683_0040440 | |||
| 937 | Ga0495675_0065031 | |||
| 938 | Ga0495684_0117934 | |||
| 939 | Ga0495684_0196949 | |||
| 940 | Ga0495684_0415683 | |||
| 941 | Ga0495602_0168676 | |||
| 942 | Ga0495614_0010194 | |||
| 943 | Ga0495626_0079304 | |||
| 944 | Ga0496100_0005282 | |||
| 945 | Ga0496100_0024474 | |||
| 946 | Ga0496100_0160296 | |||
| 947 | Ga0496101_0110123 | |||
| 948 | Ga0496101_0228242 | |||
| 949 | Ga0496102_0010275 | |||
| 950 | Ga0496102_0270627 | |||
| 951 | Ga0496102_0389929 | |||
| 952 | Ga0496102_0485597 | |||
| 953 | Ga0496102_0573952 | |||
| 954 | Ga0496103_0001500 | |||
| 955 | Ga0496104_0001186 | |||
| 956 | Ga0496104_0187871 | |||
| 957 | Ga0496104_0876139 | |||
| 958 | Ga0496105_0000964 | |||
| 959 | Ga0496105_0053016 | |||
| 960 | Ga0496105_0248853 | |||
| 961 | Ga0496106_0000361 | |||
| 962 | Ga0496106_0476293 | |||
| 963 | Ga0496107_0000282 | |||
| 964 | Ga0496108_0000443 | |||
| 965 | Ga0496109_0000778 | |||
| 966 | Ga0496109_0013733 | |||
| 967 | Ga0496109_0827626 | |||
| 968 | Ga0496110_0002382 | |||
| 969 | Ga0496110_0117605 | |||
| 970 | Ga0496111_0000191 | |||
| 971 | Ga0496111_0206802 | |||
| 972 | Ga0496112_0006179 | |||
| 973 | Ga0496112_0251313 | |||
| 974 | Ga0496113_0001366 | |||
| 975 | Ga0496113_0113068 | |||
| 976 | Ga0496113_0364520 | |||
| 977 | Ga0496114_0113786 | |||
| 978 | Ga0496116_0001671 | |||
| 979 | Ga0496117_0022031 | |||
| 980 | Ga0496119_0005613 | |||
| 981 | Ga0496120_0007962 | |||
| 982 | Ga0496122_0013343 | |||
| 983 | Ga0496122_0022454 | |||
| 984 | Ga0496123_0004637 | |||
| 985 | Ga0496125_0004215 | |||
| 986 | Ga0496126_0004639 | |||
| 987 | Ga0496126_0005295 | |||
| 988 | Ga0501306_000031 | |||
| 989 | Ga0501306_000487 | |||
| 990 | Ga0501306_000497 | |||
| 991 | Ga0501306_000655 | |||
| 992 | Ga0501306_000823 | |||
| 993 | Ga0501306_001717 | |||
| 994 | Ga0501306_002383 | |||
| 995 | Ga0501306_002549 | |||
| 996 | Ga0501306_002657 | |||
| 997 | Ga0501308_000210 | |||
| 998 | Ga0501308_000287 | |||
| 999 | Ga0501308_001173 | |||
| 1000 | Ga0501308_001828 | |||
| 1001 | Ga0501308_003751 | |||
| 1002 | Ga0501308_005283 | |||
| 1003 | Ga0501309_000397 | |||
| 1004 | Ga0501309_000721 | |||
| 1005 | Ga0501309_001124 | |||
| 1006 | Ga0501309_001463 | |||
| 1007 | Ga0501309_010685 | |||
| 1008 | Ga0501310_000371 | |||
| 1009 | Ga0501310_000609 | |||
| 1010 | Ga0501310_001129 | |||
| 1011 | Ga0501310_002486 | |||
| 1012 | Ga0501341_00107 | |||
| 1013 | Ga0501341_00208 | |||
| 1014 | Ga0501341_00221 | |||
| 1015 | Ga0501341_00334 | |||
| 1016 | Ga0501341_00436 | |||
| 1017 | Ga0501341_05480 | |||
| 1018 | Ga0501343_000282 | |||
| 1019 | Ga0501343_000822 | |||
| 1020 | Ga0501343_001772 | |||
| 1021 | Ga0501343_005673 | |||
| 1022 | Ga0501344_00106 | |||
| 1023 | Ga0501344_00120 | |||
| 1024 | Ga0501344_00965 | |||
| 1025 | Ga0501345_00054 | |||
| 1026 | Ga0501304_000742 | |||
| 1027 | Ga0501304_001331 | |||
| 1028 | Ga0501304_002229 | |||
| 1029 | Ga0501305_000002 | |||
| 1030 | Ga0501305_000036 | |||
| 1031 | Ga0501305_000182 | |||
| 1032 | Ga0501305_000320 | |||
| 1033 | Ga0501305_000675 | |||
| 1034 | Ga0501305_000790 | |||
| 1035 | Ga0501305_001538 | |||
| 1036 | Ga0501305_002447 | |||
| 1037 | Ga0501305_002739 | |||
| 1038 | Ga0501305_003224 | |||
| 1039 | Ga0501305_006283 | |||
| 1040 | Ga0501305_024578 | |||
| 1041 | Ga0501307_000012 | |||
| 1042 | Ga0501307_000146 | |||
| 1043 | Ga0501307_000209 | |||
| 1044 | Ga0501307_000398 | |||
| 1045 | Ga0501307_000466 | |||
| 1046 | Ga0501307_000679 | |||
| 1047 | Ga0501307_002114 | |||
| 1048 | Ga0501342_00058 | |||
| 1049 | Ga0501311_000004 | |||
| 1050 | Ga0501311_000007 | |||
| 1051 | Ga0501311_000810 | |||
| 1052 | Ga0501311_001097 | |||
| 1053 | Ga0501311_001468 | |||
| 1054 | Ga0501311_002237 | |||
| 1055 | Ga0501312_000003 | |||
| 1056 | Ga0501312_000006 | |||
| 1057 | Ga0501312_000567 | |||
| 1058 | Ga0501312_000589 | |||
| 1059 | Ga0501312_000598 | |||
| 1060 | Ga0501312_000704 | |||
| 1061 | Ga0501312_000761 | |||
| 1062 | Ga0501312_000887 | |||
| 1063 | Ga0501312_004363 | |||
| 1064 | Ga0501313_000017 | |||
| 1065 | Ga0501313_000080 | |||
| 1066 | Ga0501313_000518 | |||
| 1067 | Ga0501313_000585 | |||
| 1068 | Ga0501313_001232 | |||
| 1069 | Ga0501313_001631 | |||
| 1070 | Ga0501313_006310 | |||
| 1071 | Ga0501313_006820 | |||
| 1072 | Ga0501314_000256 | |||
| 1073 | Ga0501314_000364 | |||
| 1074 | Ga0501314_000376 | |||
| 1075 | Ga0501314_000408 | |||
| 1076 | Ga0501314_000534 | |||
| 1077 | Ga0501314_000966 | |||
| 1078 | Ga0501314_001086 | |||
| 1079 | Ga0501315_000019 | |||
| 1080 | Ga0501315_000121 | |||
| 1081 | Ga0501315_000389 | |||
| 1082 | Ga0501315_000420 | |||
| 1083 | Ga0501315_000455 | |||
| 1084 | Ga0501315_001280 | |||
| 1085 | Ga0501315_001361 | |||
| 1086 | Ga0501315_002350 | |||
| 1087 | Ga0501316_000029 | |||
| 1088 | Ga0501316_000057 | |||
| 1089 | Ga0501316_000077 | |||
| 1090 | Ga0501316_000101 | |||
| 1091 | Ga0501316_000267 | |||
| 1092 | Ga0501316_000578 | |||
| 1093 | Ga0501316_006198 | |||
| 1094 | Ga0501317_000001 | |||
| 1095 | Ga0501317_000015 | |||
| 1096 | Ga0501317_000025 | |||
| 1097 | Ga0501317_000117 | |||
| 1098 | Ga0501317_000283 | |||
| 1099 | Ga0501317_000743 | |||
| 1100 | Ga0501317_001493 | |||
| 1101 | Ga0501318_000001 | |||
| 1102 | Ga0501318_000024 | |||
| 1103 | Ga0501318_000298 | |||
| 1104 | Ga0501318_000737 | |||
| 1105 | Ga0501318_000818 | |||
| 1106 | Ga0501318_001153 | |||
| 1107 | Ga0501318_001644 | |||
| 1108 | Ga0501319_000019 | |||
| 1109 | Ga0501319_000069 | |||
| 1110 | Ga0501319_000142 | |||
| 1111 | Ga0501320_000031 | |||
| 1112 | Ga0501320_000127 | |||
| 1113 | Ga0501320_000269 | |||
| 1114 | Ga0501320_000417 | |||
| 1115 | Ga0501320_001252 | |||
| 1116 | Ga0501320_011413 | |||
| 1117 | Ga0501321_000001 | |||
| 1118 | Ga0501321_000032 | |||
| 1119 | Ga0501321_000087 | |||
| 1120 | Ga0501321_000347 | |||
| 1121 | Ga0501321_000491 | |||
| 1122 | Ga0501321_000499 | |||
| 1123 | Ga0501321_005487 | |||
| 1124 | Ga0501321_023432 | |||
| 1125 | Ga0501322_000105 | |||
| 1126 | Ga0501322_000132 | |||
| 1127 | Ga0501322_000252 | |||
| 1128 | Ga0501322_000299 | |||
| 1129 | Ga0501322_000543 | |||
| 1130 | Ga0501322_000986 | |||
| 1131 | Ga0501323_000031 | |||
| 1132 | Ga0501323_000123 | |||
| 1133 | Ga0501323_000356 | |||
| 1134 | Ga0501323_000970 | |||
| 1135 | Ga0501323_001243 | |||
| 1136 | Ga0501323_001559 | |||
| 1137 | Ga0501323_001588 | |||
| 1138 | Ga0501323_002019 | |||
| 1139 | Ga0501324_000001 | |||
| 1140 | Ga0501324_000376 | |||
| 1141 | Ga0501324_000524 | |||
| 1142 | Ga0501324_000689 | |||
| 1143 | Ga0501324_000710 | |||
| 1144 | Ga0501324_001015 | |||
| 1145 | Ga0501326_00062 | |||
| 1146 | Ga0501326_00067 | |||
| 1147 | Ga0501326_00091 | |||
| 1148 | Ga0501326_00102 | |||
| 1149 | Ga0501327_00098 | |||
| 1150 | Ga0501327_00117 | |||
| 1151 | Ga0501327_01095 | |||
| 1152 | Ga0501328_00058 | |||
| 1153 | Ga0501328_00120 | |||
| 1154 | Ga0501328_00233 | |||
| 1155 | Ga0501329_00035 | |||
| 1156 | Ga0501330_000008 | |||
| 1157 | Ga0501330_000037 | |||
| 1158 | Ga0501330_000125 | |||
| 1159 | Ga0501330_000173 | |||
| 1160 | Ga0501330_000225 | |||
| 1161 | Ga0501331_00059 | |||
| 1162 | Ga0501332_00020 | |||
| 1163 | Ga0501332_00078 | |||
| 1164 | Ga0501332_00260 | |||
| 1165 | Ga0501333_000285 | |||
| 1166 | Ga0501333_000472 | |||
| 1167 | Ga0501333_000872 | |||
| 1168 | Ga0501334_00027 | |||
| 1169 | Ga0501334_00251 | |||
| 1170 | Ga0501335_000498 | |||
| 1171 | Ga0501335_001188 | |||
| 1172 | Ga0501335_001575 | |||
| 1173 | Ga0501335_001947 | |||
| 1174 | Ga0501335_002815 | |||
| 1175 | Ga0501335_003930 | |||
| 1176 | Ga0501335_006302 | |||
| 1177 | Ga0501336_000091 | |||
| 1178 | Ga0501337_000054 | |||
| 1179 | Ga0501337_000088 | |||
| 1180 | Ga0501337_000691 | |||
| 1181 | Ga0501337_000729 | |||
| 1182 | Ga0501338_00091 | |||
| 1183 | Ga0501338_00103 | |||
| 1184 | Ga0501338_00500 | |||
| 1185 | Ga0501338_01785 | |||
| 1186 | Ga0501339_00007 | |||
| 1187 | Ga0501340_000099 | |||
| 1188 | Ga0501340_000108 | |||
| 1189 | Ga0501340_000251 | |||
| 1190 | Ga0501034_0024059 | |||
| 1191 | Ga0501040_0350956 | |||
| 1192 | Ga0501041_0333186 | |||
| 1193 | Ga0501043_0094276 | |||
| 1194 | Ga0501046_0049684 | |||
| 1195 | Ga0501047_0063124 | |||
| 1196 | Ga0501070_0011947 | |||
| 1197 | Ga0501072_0170876 | |||
| 1198 | Ga0501072_0209865 | |||
| 1199 | Ga0501072_0266591 | |||
| 1200 | Ga0501073_0118279 | |||
| 1201 | Ga0501075_0236530 | |||
| 1202 | Ga0501202_018425 | |||
| 1203 | Ga0501217_004344 | |||
| 1204 | Ga0501217_005351 | |||
| 1205 | Ga0501227_021242 | |||
| 1206 | Ga0501245_009931 | |||
| 1207 | Ga0501080_0027162 | |||
| 1208 | Ga0501270_001993 | |||
| 1209 | Ga0501212_009766 | |||
| 1210 | nmdc:mga00v17_13821_c1 | |||
| 1211 | nmdc:mga06z11_228180_c1 | |||
| 1212 | nmdc:mga0qj67_472396_c1 | |||
| 1213 | nmdc:mga06r32_62945_c1 | |||
| 1214 | nmdc:mga08y16_109076_c1 | |||
| 1215 | nmdc:mga08y16_128140_c1 | |||
| 1216 | nmdc:mga08y16_3103_c1 | |||
| 1217 | nmdc:mga0n895_950611_c1 | |||
| 1218 | nmdc:mga0rr50_42251_c1 | |||
| 1219 | Ga0495601_0010480 | |||
| 1220 | Ga0495601_0160426 | |||
| 1221 | Ga0495612_0040570 | |||
| 1222 | Ga0495595_0020140 | |||
| 1223 | Ga0495619_0021877 | |||
| 1224 | Ga0495619_0025656 | |||
| 1225 | Ga0495619_0152126 | |||
| 1226 | Ga0495619_0296446 | |||
| 1227 | Ga0501084_0000009 | |||
| 1228 | Ga0587111_0017291 | |||
| 1229 | Ga0587111_0077658 | |||
| 1230 | 2511697986 | |||
| 1231 | 2540605210 | |||
| 1232 | 2545559776 | |||
| 1233 | 2555470864 | |||
| 1234 | 2556065810 | |||
| 1235 | 2578930732 | |||
| 1236 | 2600199857 | |||
| 1237 | 2600402889 | |||
| 1238 | 2601444987 | |||
| 1239 | 2631982480 | |||
| 1240 | 2644721357 | |||
| 1241 | 2644723342 | |||
| 1242 | 2644741844 | |||
| 1243 | 2651530344 | |||
| 1244 | 2672333572 | |||
| 1245 | 2674421101 | |||
| 1246 | 2686995308 | |||
| 1247 | 2687496557 | |||
| 1248 | 2695629905 | |||
| 1249 | 2712198852 | |||
| 1250 | 2717918195 | |||
| 1251 | 2738817086 | |||
| 1252 | 2738838978 | |||
| 1253 | 2739234652 | |||
| 1254 | 2791215898 | |||
| 1255 | 2809057202 | |||
| 1256 | 2812314447 | |||
| 1257 | 2816866395 | |||
| 1258 | 2817478174 | |||
| 1259 | 2819571014 | |||
| 1260 | 2819627568 | |||
| 1261 | 2819711982 | |||
| 1262 | 2819726084 | |||
| 1263 | 2823526400 | |||
| 1264 | 2842688259 | |||
| 1265 | 2842887740 | |||
| 1266 | 2849144953 | |||
| 1267 | 2852676601 | |||
| 1268 | 2857586499 | |||
| 1269 | 2860837564 | |||
| 1270 | 2877768783 | |||
| 1271 | 2880169725 | |||
| 1272 | 2881646618 | |||
| 1273 | 2897109752 | |||
| 1274 | 2904530150 | |||
| 1275 | 2904564574 | |||
| 1276 | 2904610110 | |||
| 1277 | 2908669335 | |||
| 1278 | 2919097093 | |||
| 1279 | 2919149619 | |||
| 1280 | 2919419338 | |||
| 1281 | 2919523208 | |||
| 1282 | 2919726429 | |||
| 1283 | 2919730750 | |||
| 1284 | 2928099898 | |||
| 1285 | 2928513064 | |||
| 1286 | 2929009919 | |||
| 1287 | 2936363677 | |||
| 1288 | 2939596162 | |||
| 1289 | 2954776096 | |||
| 1290 | 2960324300 | |||
| 1291 | 2960378877 | |||
| 1292 | 2962290775 | |||
| 1293 | 2969136982 | |||
| 1294 | 2969141151 | |||
| 1295 | 2969766269 | |||
| 1296 | 2969774937 | |||
| 1297 | 2971893512 | |||
| 1298 | 2977254710 | |||
| 1299 | 2980492726 | |||
| 1300 | 2990275713 | |||
| 1301 | 3001271854 | |||
| 1302 | 3001275940 | |||
| 1303 | 3001898811 | |||
| 1304 | 3006858502 | |||
| 1305 | 3006883613 | |||
| 1306 | 3006973796 | |||
| 1307 | 3006978373 | |||
| 1308 | 3006988366 | |||
| 1309 | 3006993231 | |||
| 1310 | 8007379869 | |||
| 1311 | 8022631656 | |||
| 1312 | 8022893418 | |||
| 1313 | 8022917932 | |||
| 1314 | 8051956495 | |||
| 1315 | 8052174971 | |||
| 1316 | 8054282848 | |||
| 1317 | 8055537116 | |||
| 1318 | 8057632267 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5npm-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus | 0.9826 | 19 | 225 |
| 4v5f-assembly1.cif.gz_BC | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9764 | 5 | 225 |
| 4qg3-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus | 0.9754 | 5 | 225 |
| 4v9h-assembly1.cif.gz_BC | crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state | 0.9728 | 3 | 225 |
| 4v8y-assembly1.cif.gz_CL | cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex | 0.9727 | 3 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9896 | 16 | 226 | 3.30.190.20 |
| af_I1L5L1_126_340_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.984 | 18 | 227 | 3.30.190.20 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9825 | 74 | 159 | 3.40.50.790 |
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9713 | 16 | 226 | 3.30.190.20 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9605 | 74 | 159 | 3.40.50.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0B0HUE2-F1-model_v4 | deleted | 0.9968 | 1 | 197 |
|
| AF-Q88YW9-F1-model_v4 | Large ribosomal subunit protein uL1 (50S ribosomal protein L1) | 0.994 | 1 | 228 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A380GR85-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9939 | 1 | 228 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A523HGB8-F1-model_v4 | Ribosomal protein | 0.9936 | 36 | 224 |
GO:0003735
GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A0R2N9K1-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9934 | 1 | 228 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |