F473272

General Info

Members Datasets Scaffolds Average Seq Length
659 266 610 240

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_022371|Ga0495627_022371_291_1094
Length 267
Sequence MLFGYNSSRIERNQKRTFFGDDMVETGRLLALLDSPDQADWSRRIFALGRDQGFDRVLFGMVGSRHARLENAFVTSSYSPEWRERYDAERFAYVDPTVSHCMSSNLPIVWAPGTFNAGPQRAFYEEACGYGIRAGITLPVHGPNGEFGVLSFATDVRADARFDREVRERLAALVLIRDYAFASSQRFCGGGARHEAAPRLTRRELEVLSWVMEGKSSWEISKITNCSEATVNFHMANVRQKFNVNTRQQAVVKAIALGLVTPEDHHR

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
12 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
13 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
14 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
15 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
16 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
17 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
18 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
19 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
20 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
21 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
22 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
23 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
24 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
25 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
26 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
27 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
28 2818991450 Burkholderia sp. 604 Isolate Unclassified
29 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
30 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
31 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
32 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
33 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
34 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
35 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
36 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
37 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
38 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
39 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
40 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
41 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
42 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
43 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
46 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
49 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
50 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
51 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
54 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
55 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
56 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
57 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
58 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
59 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
60 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
61 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
62 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
63 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
137 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
155 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
261 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
262 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
263 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
264 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
265 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
266 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.35
Metatranscriptomes 1.21
Isolates 7.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.79
Nodule 2.88
Rhizoplane 2.43
Rhizosphere 81.34
Stem 0
Stem Tuber 0
Unclassified 9.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002235 3300001979 Bacteria 8840
2 JGI24739J22299_10001842 3300001989 Bacteria 8085
3 JGI24739J22299_10008386 3300001989 Bacteria 3859
4 JGI24739J22299_10027319 3300001989 Bacteria 1996
5 JGI24737J22298_10015644 3300001990 Bacteria 2454
6 JGI24737J22298_10025014 3300001990 Bacteria 1889
7 JGI24735J21928_10033472 3300002067 Bacteria 1518
8 JGI24738J21930_10001084 3300002075 Bacteria 7701
9 JGI25156J39149_1000135 3300002705 Bacteria 53930
10 JGI25156J39149_1000388 3300002705 Bacteria 27622
11 JGI25156J39149_1002524 3300002705 Bacteria 6515
12 JGI25165J46597_1001544 3300003214 Bacteria 11439
13 rootH1_10077531 3300003316 Bacteria 4567
14 rootH1_10097798 3300003316 Bacteria 3151
15 rootH2_10134206 3300003320 Bacteria 4299
16 rootL2_10009775 3300003322 Bacteria 20349
17 rootH1_10056827 3300003323 Bacteria 5254
18 rootH1_10241841 3300003323 Bacteria 1457
19 rootH1_10318495 3300003323 Bacteria 2708
20 JGI25160J50197_1000236 3300003354 Bacteria 42883
21 Ga0006556J51387_1009100 3300003479 Bacteria 1288
22 Ga0006554J51385_1007915 3300003567 Bacteria 1131
23 Ga0055533_1000094 3300003756 Bacteria 115741
24 Ga0055533_1000461 3300003756 Bacteria 15413
25 Ga0055532_1000003 3300003758 Bacteria 494004
26 Ga0055527_1000006 3300003760 Bacteria 494004
27 Ga0055535_1000003 3300003761 Bacteria 494004
28 Ga0055542_1000007 3300003762 Bacteria 494004
29 Ga0055529_1000003 3300003763 Bacteria 494004
30 Ga0065165_1004388 3300005262 Bacteria 8802
31 Ga0065714_10017574 3300005288 Bacteria 2842
32 Ga0065714_10198283 3300005288 Bacteria 904
33 Ga0070658_10024294 3300005327 Bacteria 4862
34 Ga0070660_100007686 3300005339 Bacteria 7511
35 Ga0070660_100237756 3300005339 Bacteria 1483
36 Ga0070659_100003120 3300005366 Bacteria 11795
37 Ga0070663_100096016 3300005455 Bacteria 2204
38 Ga0068855_100021533 3300005563 Bacteria 7730
39 Ga0068855_100021555 3300005563 Bacteria 7727
40 Ga0068857_100246062 3300005577 Bacteria 1638
41 Ga0068856_100229033 3300005614 Bacteria 1874
42 Ga0105251_10002663 3300009011 Bacteria 13770
43 Ga0105251_10033980 3300009011 Bacteria 2527
44 Ga0105240_10008982 3300009093 Bacteria 14205
45 Ga0105240_10197048 3300009093 Bacteria 2363
46 Ga0105240_10258901 3300009093 Bacteria 2008
47 Ga0105240_10364539 3300009093 Unclassified 1636
48 Ga0105240_10395058 3300009093 Bacteria 1559
49 Ga0105241_10077669 3300009174 Bacteria 2592
50 Ga0105241_10251721 3300009174 Bacteria 1498
51 Ga0105237_10042791 3300009545 Bacteria 4565
52 Ga0105238_10209776 3300009551 Bacteria 1924
53 Ga0105239_10006460 3300010375 Bacteria 13600
54 Ga0157373_10005758 3300013100 Bacteria 9278
55 Ga0157371_10000060 3300013102 Bacteria 170456
56 Ga0157371_10018306 3300013102 Bacteria 5181
57 Ga0157370_10007846 3300013104 Bacteria 11567
58 Ga0157370_10009653 3300013104 Bacteria 10263
59 Ga0157370_10059573 3300013104 Bacteria 3628
60 Ga0157369_10000093 3300013105 Bacteria 122566
61 Ga0157369_10000665 3300013105 Bacteria 44336
62 Ga0157369_10008647 3300013105 Bacteria 11678
63 Ga0157369_10191666 3300013105 Bacteria 2148
64 Ga0157374_10000034 3300013296 Bacteria 180660
65 Ga0157372_10001753 3300013307 Bacteria 23524
66 Ga0157372_10410143 3300013307 Bacteria 1579
67 Ga0157372_10503444 3300013307 Bacteria 1412
68 Ga0182008_10018154 3300014497 Bacteria 3644
69 Ga0182008_10021295 3300014497 Bacteria 3329
70 Ga0157376_10106251 3300014969 Bacteria 2462
71 Ga0182006_1068817 3300015261 Unclassified 1317
72 Ga0182007_10000198 3300015262 Bacteria 40280
73 Ga0183361_10002 3300016635 Bacteria 907642
74 Ga0206356_10321302 3300020070 Bacteria 1204
75 Ga0206349_1710490 3300020075 Bacteria 1515
76 Ga0206350_10168369 3300020080 Bacteria 1485
77 Ga0206354_10873154 3300020081 Bacteria 1376
78 Ga0224712_10000006 3300022467 Bacteria 30817
79 Ga0224712_10062819 3300022467 Bacteria 1485
80 Ga0209566_103344 3300025225 Bacteria 2502
81 Ga0209674_100025 3300025226 Bacteria 515942
82 Ga0209674_100144 3300025226 Bacteria 107160
83 Ga0209672_100002 3300025228 Bacteria 1733325
84 Ga0209672_100260 3300025228 Bacteria 39122
85 Ga0209147_100003 3300025229 Bacteria 1733325
86 Ga0209563_103471 3300025230 Bacteria 3244
87 Ga0207427_100538 3300025231 Bacteria 19709
88 Ga0209258_100005 3300025242 Bacteria 1087938
89 Ga0209677_112123 3300025253 Bacteria 1299
90 Ga0209148_1000006 3300025254 Bacteria 1733325
91 Ga0209759_1000008 3300025256 Bacteria 461395
92 Ga0209759_1000014 3300025256 Bacteria 396291
93 Ga0209759_1001892 3300025256 Bacteria 10308
94 Ga0209233_1000018 3300025261 Bacteria 886857
95 Ga0209455_1000003 3300025272 Bacteria 1471893
96 Ga0209130_1008952 3300025284 Bacteria 2899
97 Ga0209564_1014337 3300025295 Bacteria 3304
98 Ga0207713_1010253 3300025735 Bacteria 5200
99 Ga0207713_1042970 3300025735 Bacteria 1871
100 Ga0207647_10002184 3300025904 Bacteria 14920
101 Ga0207647_10003867 3300025904 Bacteria 11203
102 Ga0207647_10029535 3300025904 Bacteria 3547
103 Ga0207705_10001186 3300025909 Bacteria 21171
104 Ga0207695_10012270 3300025913 Bacteria 10291
105 Ga0207657_10015047 3300025919 Bacteria 7514
106 Ga0207690_10004205 3300025932 Bacteria 8511
107 Ga0207711_10073294 3300025941 Bacteria 2976
108 Ga0207711_10198614 3300025941 Bacteria 1830
109 Ga0207667_10001488 3300025949 Bacteria 29411
110 Ga0207667_10003305 3300025949 Bacteria 19888
111 Ga0207667_10003399 3300025949 Bacteria 19646
112 Ga0207678_10123219 3300026067 Bacteria 2212
113 Ga0207674_10476350 3300026116 Plasmid 1207
114 Ga0209371_1007185 3300027312 Bacteria 3934
115 Ga0265338_10000159 3300028800 Bacteria 123495
116 Ga0265331_10033825 3300031250 Bacteria 2525
117 Ga0265327_10002222 3300031251 Bacteria 21132
118 Ga0265316_10155604 3300031344 Bacteria 1711
119 Ga0307412_10000039 3300031911 Bacteria 182976
120 Ga0395899_0000023 3300037312 Bacteria 367159
121 Ga0395899_0000127 3300037312 Bacteria 119435
122 Ga0395899_0004119 3300037312 Bacteria 11447
123 Ga0395899_0181768 3300037312 Unclassified 1476
124 Ga0395900_0000019 3300037418 Bacteria 357240
125 Ga0395900_0000146 3300037418 Bacteria 118779
126 Ga0395900_0035174 3300037418 Bacteria 5160
127 Ga0395900_0040743 3300037418 Bacteria 4787
128 Ga0395900_0086576 3300037418 Bacteria 3220
129 Ga0395900_0173812 3300037418 Bacteria 2192
130 Ga0395900_0192376 3300037418 Bacteria 2069
131 Ga0395900_0928636 3300037418 Bacteria 792
132 Ga0395898_0000016 3300037466 Bacteria 435585
133 Ga0395898_0000617 3300037466 Bacteria 65254
134 Ga0395898_0081481 3300037466 Bacteria 3120
135 Ga0395898_0135579 3300037466 Plasmid 2357
136 Ga0395898_0152806 3300037466 Bacteria 2208
137 Ga0395898_0267470 3300037466 Bacteria 1630
138 Ga0395905_0000052 3300037471 Bacteria 215018
139 Ga0395901_0000004 3300038443 Bacteria 657361
140 Ga0395901_0000040 3300038443 Bacteria 204677
141 Ga0395901_0000326 3300038443 Bacteria 58686
142 Ga0395901_1106729 3300038443 Unclassified 762
143 Ga0436360_0537052 3300039438 Bacteria 961
144 Ga0436360_1359059 3300039438 Bacteria 2461
145 Ga0436361_1220172 3300039447 Bacteria 4318
146 Ga0439448_0006665 3300042005 Bacteria 3327
147 Ga0450904_002363 3300042139 Bacteria 2269
148 Ga0466969_0000202 3300044656 Bacteria 32524
149 Ga0466969_0000523 3300044656 Bacteria 21109
150 Ga0466969_0042020 3300044656 Bacteria 2284
151 Ga0466969_0078974 3300044656 Bacteria 1573
152 Ga0466969_0209318 3300044656 Unclassified 888
153 Ga0466972_0007364 3300044658 Bacteria 5530
154 Ga0466972_0077637 3300044658 Unclassified 1582
155 Ga0466972_0082589 3300044658 Unclassified 1529
156 Ga0466973_0010555 3300044659 Bacteria 8516
157 Ga0466973_0085795 3300044659 Bacteria 2735
158 Ga0466980_0348445 3300044668 Unclassified 863
159 Ga0466965_0000089 3300044683 Bacteria 26574
160 Ga0466965_0007843 3300044683 Bacteria 4921
161 Ga0466965_0103788 3300044683 Bacteria 1456
162 Ga0466966_0002709 3300044684 Bacteria 11621
163 Ga0466966_0006782 3300044684 Bacteria 7582
164 Ga0466966_0023627 3300044684 Bacteria 4024
165 Ga0466966_0033977 3300044684 Bacteria 3300
166 Ga0466966_0048965 3300044684 Bacteria 2691
167 Ga0466966_0070402 3300044684 Bacteria 2193
168 Ga0466961_0000210 3300044693 Bacteria 39137
169 Ga0466961_0000562 3300044693 Bacteria 23612
170 Ga0466961_0011985 3300044693 Bacteria 5541
171 Ga0466961_0014694 3300044693 Bacteria 5030
172 Ga0466963_0000790 3300044694 Bacteria 15752
173 Ga0466963_0001202 3300044694 Bacteria 13621
174 Ga0466964_0022094 3300044706 Unclassified 2465
175 Ga0466964_0031268 3300044706 Bacteria 2110
176 Ga0466964_0352866 3300044706 Unclassified 756
177 Ga0466971_0001563 3300044719 Bacteria 9669
178 Ga0466971_0002338 3300044719 Bacteria 8016
179 Ga0466971_0038916 3300044719 Unclassified 2134
180 Ga0466968_0065847 3300044735 Unclassified 1569
181 Ga0466970_0000982 3300044765 Bacteria 13717
182 Ga0466970_0045456 3300044765 Bacteria 2338
183 Ga0466970_0058721 3300044765 Bacteria 2059
184 Ga0466970_0117257 3300044765 Bacteria 1456
185 Ga0466957_0003063 3300044842 Bacteria 9089
186 Ga0466957_0028429 3300044842 Bacteria 3329
187 Ga0466957_0050272 3300044842 Bacteria 2536
188 Ga0466957_0067101 3300044842 Bacteria 2213
189 Ga0466959_0006591 3300045049 Bacteria 8060
190 Ga0466959_0008203 3300045049 Bacteria 7371
191 Ga0466959_0023581 3300045049 Bacteria 4553
192 Ga0466959_0040190 3300045049 Bacteria 3455
193 Ga0466959_0055074 3300045049 Bacteria 2904
194 Ga0466958_0002949 3300045836 Bacteria 8706
195 Ga0466958_0005470 3300045836 Bacteria 6843
196 Ga0466958_0009456 3300045836 Bacteria 5431
197 Ga0466958_0013548 3300045836 Bacteria 4643
198 Ga0466958_0018964 3300045836 Bacteria 3999
199 Ga0466958_0035593 3300045836 Bacteria 2975
200 Ga0466958_0140791 3300045836 Unclassified 1518
201 Ga0466958_0401920 3300045836 Unclassified 884
202 Ga0466967_1133885 3300045976 Unclassified 779
203 Ga0495617_001373 3300046452 Bacteria 10754
204 Ga0495627_022371 3300046453 Bacteria 2081
205 Ga0495592_0003298 3300046454 Bacteria 11569
206 Ga0495592_0059666 3300046454 Bacteria 2808
207 Ga0495592_0162657 3300046454 Bacteria 1534
208 Ga0495592_0228143 3300046454 Bacteria 1241
209 Ga0495603_0004911 3300046455 Bacteria 7998
210 Ga0495603_0011762 3300046455 Bacteria 5296
211 Ga0495603_0081700 3300046455 Bacteria 1893
212 Ga0495603_0216539 3300046455 Bacteria 1105
213 Ga0495603_0271170 3300046455 Bacteria 976
214 Ga0495590_0002585 3300046457 Bacteria 7479
215 Ga0495591_005284 3300046458 Bacteria 6021
216 Ga0495629_0000191 3300046459 Bacteria 55189
217 Ga0495629_0004232 3300046459 Bacteria 10764
218 Ga0495629_0006233 3300046459 Bacteria 8848
219 Ga0495629_0061798 3300046459 Bacteria 2617
220 Ga0495638_0002634 3300046460 Bacteria 14442
221 Ga0495638_0018094 3300046460 Bacteria 4685
222 Ga0495638_0124922 3300046460 Bacteria 1517
223 Ga0495638_0176911 3300046460 Bacteria 1220
224 Ga0495651_0004195 3300046462 Bacteria 11038
225 Ga0495651_0044647 3300046462 Bacteria 3434
226 Ga0495651_0112617 3300046462 Bacteria 2010
227 Ga0495651_0142049 3300046462 Bacteria 1740
228 Ga0495651_0313841 3300046462 Bacteria 1047
229 Ga0495653_0000154 3300046463 Bacteria 57214
230 Ga0495653_0003074 3300046463 Bacteria 13378
231 Ga0495653_0025956 3300046463 Bacteria 4701
232 Ga0495653_0028590 3300046463 Bacteria 4457
233 Ga0495653_0071117 3300046463 Bacteria 2602
234 Ga0495653_0173066 3300046463 Bacteria 1488
235 Ga0495650_0063550 3300046471 Bacteria 1471
236 Ga0495580_0000479 3300046472 Bacteria 33347
237 Ga0495580_0001347 3300046472 Bacteria 21636
238 Ga0495580_0003533 3300046472 Bacteria 13277
239 Ga0495580_0007361 3300046472 Bacteria 8852
240 Ga0495580_0016355 3300046472 Bacteria 5569
241 Ga0495580_0018642 3300046472 Bacteria 5164
242 Ga0495580_0033877 3300046472 Bacteria 3678
243 Ga0495582_0001992 3300046473 Bacteria 11440
244 Ga0495582_0011769 3300046473 Bacteria 4821
245 Ga0495582_0171335 3300046473 Bacteria 1236
246 Ga0495582_0218783 3300046473 Bacteria 1089
247 Ga0495582_0244996 3300046473 Bacteria 1027
248 Ga0495605_0037629 3300046474 Bacteria 2432
249 Ga0495639_0101135 3300046475 Bacteria 1361
250 Ga0495662_0051234 3300046476 Bacteria 1993
251 Ga0495664_0001641 3300046477 Bacteria 11878
252 Ga0495664_0006238 3300046477 Bacteria 6578
253 Ga0495664_0015391 3300046477 Bacteria 4347
254 Ga0495584_0000021 3300046491 Bacteria 130377
255 Ga0495584_0020273 3300046491 Bacteria 3379
256 Ga0495584_0039677 3300046491 Bacteria 2378
257 Ga0495584_0043923 3300046491 Bacteria 2256
258 Ga0495584_0054170 3300046491 Bacteria 2019
259 Ga0495584_0083239 3300046491 Bacteria 1611
260 Ga0495584_0107723 3300046491 Bacteria 1409
261 Ga0495585_0000005 3300046492 Bacteria 328103
262 Ga0495585_0000102 3300046492 Bacteria 91414
263 Ga0495585_0001377 3300046492 Bacteria 19208
264 Ga0495585_0006990 3300046492 Bacteria 6946
265 Ga0495585_0007710 3300046492 Bacteria 6561
266 Ga0495585_0020263 3300046492 Bacteria 3825
267 Ga0495585_0021656 3300046492 Bacteria 3690
268 Ga0495585_0022959 3300046492 Bacteria 3580
269 Ga0495585_0036344 3300046492 Bacteria 2779
270 Ga0495585_0057678 3300046492 Bacteria 2142
271 Ga0495585_0065103 3300046492 Bacteria 1997
272 Ga0495585_0130935 3300046492 Bacteria 1320
273 Ga0495585_0138398 3300046492 Unclassified 1276
274 Ga0495594_0030296 3300046499 Bacteria 2926
275 Ga0495596_0000354 3300046500 Bacteria 29794
276 Ga0495596_0010145 3300046500 Bacteria 4115
277 Ga0495596_0017663 3300046500 Bacteria 2950
278 Ga0495596_0029661 3300046500 Bacteria 2192
279 Ga0495607_0016994 3300046501 Bacteria 4684
280 Ga0495583_0000040 3300046506 Bacteria 236558
281 Ga0495583_0000189 3300046506 Bacteria 103518
282 Ga0495583_0004476 3300046506 Bacteria 9987
283 Ga0495583_0010015 3300046506 Bacteria 5585
284 Ga0495583_0039951 3300046506 Bacteria 2206
285 Ga0495583_0054424 3300046506 Bacteria 1812
286 Ga0495583_0171547 3300046506 Bacteria 891
287 Ga0495606_0012274 3300046507 Bacteria 6892
288 Ga0495606_0017847 3300046507 Bacteria 5344
289 Ga0495606_0025364 3300046507 Bacteria 4247
290 Ga0495606_0052228 3300046507 Bacteria 2659
291 Ga0495606_0072609 3300046507 Bacteria 2161
292 Ga0495606_0073408 3300046507 Bacteria 2147
293 Ga0495606_0086566 3300046507 Bacteria 1936
294 Ga0495606_0195819 3300046507 Bacteria 1155
295 Ga0495608_0003627 3300046511 Bacteria 11083
296 Ga0495608_0009278 3300046511 Bacteria 6879
297 Ga0495610_0000678 3300046512 Bacteria 32921
298 Ga0495616_0000897 3300046513 Bacteria 21481
299 Ga0495616_0002283 3300046513 Bacteria 12818
300 Ga0495616_0010393 3300046513 Bacteria 5390
301 Ga0495616_0020097 3300046513 Bacteria 3637
302 Ga0495616_0062501 3300046513 Bacteria 1823
303 Ga0495616_0084815 3300046513 Bacteria 1509
304 Ga0495618_0007150 3300046514 Bacteria 6756
305 Ga0495618_0033637 3300046514 Bacteria 3214
306 Ga0495618_0107173 3300046514 Bacteria 1789
307 Ga0495628_0004139 3300046516 Bacteria 12900
308 Ga0495628_0007146 3300046516 Bacteria 9671
309 Ga0495628_0028434 3300046516 Bacteria 4542
310 Ga0495630_0004616 3300046517 Bacteria 9659
311 Ga0495630_0037901 3300046517 Bacteria 3604
312 Ga0495630_0041805 3300046517 Bacteria 3423
313 Ga0495630_0046236 3300046517 Bacteria 3253
314 Ga0495630_0066501 3300046517 Bacteria 2709
315 Ga0495630_0091871 3300046517 Bacteria 2294
316 Ga0495631_0004791 3300046518 Bacteria 7133
317 Ga0495631_0021864 3300046518 Bacteria 2977
318 Ga0495631_0022848 3300046518 Bacteria 2905
319 Ga0495632_0002983 3300046519 Bacteria 12385
320 Ga0495637_0032323 3300046520 Bacteria 2306
321 Ga0495643_0000259 3300046522 Bacteria 77609
322 Ga0495643_0006407 3300046522 Bacteria 7765
323 Ga0495643_0017730 3300046522 Bacteria 4155
324 Ga0495644_0008224 3300046523 Bacteria 4015
325 Ga0495644_0018849 3300046523 Bacteria 2634
326 Ga0495644_0063721 3300046523 Bacteria 1385
327 Ga0495648_0000076 3300046524 Bacteria 129413
328 Ga0495648_0000909 3300046524 Bacteria 30910
329 Ga0495648_0028779 3300046524 Bacteria 3697
330 Ga0495648_0048141 3300046524 Bacteria 2627
331 Ga0495648_0074407 3300046524 Bacteria 1957
332 Ga0495648_0085782 3300046524 Bacteria 1777
333 Ga0495663_0006106 3300046525 Bacteria 3331
334 Ga0495663_0017111 3300046525 Bacteria 2055
335 Ga0495663_0074495 3300046525 Bacteria 1085
336 Ga0495666_0001208 3300046526 Bacteria 12475
337 Ga0495666_0003006 3300046526 Bacteria 8463
338 Ga0495666_0003329 3300046526 Bacteria 8115
339 Ga0495666_0027416 3300046526 Bacteria 2803
340 Ga0495666_0053430 3300046526 Bacteria 1938
341 Ga0495666_0057878 3300046526 Bacteria 1855
342 Ga0495642_0005022 3300046528 Bacteria 5100
343 Ga0495642_0040106 3300046528 Bacteria 1901
344 Ga0495642_0144551 3300046528 Bacteria 1027
345 Ga0495652_0021058 3300046529 Bacteria 5796
346 Ga0495652_0051703 3300046529 Bacteria 3507
347 Ga0495652_0221521 3300046529 Bacteria 1421
348 Ga0495665_0005429 3300046531 Bacteria 6869
349 Ga0495665_0006578 3300046531 Bacteria 6277
350 Ga0495665_0015735 3300046531 Bacteria 4073
351 Ga0495665_0058840 3300046531 Bacteria 2028
352 Ga0495640_0002226 3300046533 Bacteria 15531
353 Ga0495640_0014283 3300046533 Bacteria 6015
354 Ga0495640_0018136 3300046533 Bacteria 5229
355 Ga0495586_0025083 3300046535 Bacteria 3189
356 Ga0495586_0039756 3300046535 Bacteria 2529
357 Ga0495586_0041720 3300046535 Bacteria 2471
358 Ga0495586_0057128 3300046535 Bacteria 2117
359 Ga0495586_0062586 3300046535 Bacteria 2026
360 Ga0495587_0002006 3300046536 Bacteria 13579
361 Ga0495587_0003001 3300046536 Bacteria 11281
362 Ga0495587_0011305 3300046536 Bacteria 5658
363 Ga0495609_0006057 3300046538 Bacteria 6227
364 Ga0495609_0023935 3300046538 Bacteria 2803
365 Ga0495597_0000328 3300046542 Bacteria 42830
366 Ga0495597_0001101 3300046542 Bacteria 20460
367 Ga0495597_0035347 3300046542 Bacteria 2254
368 Ga0495597_0036198 3300046542 Bacteria 2224
369 Ga0495597_0044958 3300046542 Bacteria 1962
370 Ga0495597_0078688 3300046542 Bacteria 1412
371 Ga0495597_0140569 3300046542 Bacteria 996
372 Ga0495645_0002313 3300046543 Bacteria 12928
373 Ga0495622_0000140 3300046557 Bacteria 62347
374 Ga0495622_0006343 3300046557 Bacteria 5488
375 Ga0495622_0038494 3300046557 Bacteria 2227
376 Ga0495622_0044910 3300046557 Bacteria 2054
377 Ga0495622_0064833 3300046557 Bacteria 1689
378 Ga0495633_0004396 3300046558 Bacteria 8984
379 Ga0495633_0007165 3300046558 Bacteria 6465
380 Ga0495633_0011358 3300046558 Bacteria 4806
381 Ga0495633_0015475 3300046558 Bacteria 3957
382 Ga0495633_0024853 3300046558 Bacteria 2955
383 Ga0495633_0032709 3300046558 Bacteria 2511
384 Ga0495633_0038123 3300046558 Bacteria 2297
385 Ga0495667_0048375 3300046559 Bacteria 2808
386 Ga0495656_0036786 3300046615 Bacteria 2018
387 Ga0495668_0005786 3300046616 Bacteria 8265
388 Ga0495668_0009366 3300046616 Bacteria 6021
389 Ga0495668_0095072 3300046616 Bacteria 1631
390 Ga0495668_0219504 3300046616 Bacteria 1041
391 Ga0495634_0005115 3300046642 Bacteria 10126
392 Ga0495634_0084275 3300046642 Bacteria 2072
393 Ga0495634_0088086 3300046642 Bacteria 2019
394 Ga0495611_0003948 3300046648 Bacteria 6449
395 Ga0495611_0007318 3300046648 Bacteria 4690
396 Ga0495611_0036750 3300046648 Bacteria 2175
397 Ga0495611_0063750 3300046648 Bacteria 1677
398 Ga0495625_0035845 3300046660 Bacteria 3652
399 Ga0495625_0209072 3300046660 Bacteria 1283
400 Ga0495625_0306931 3300046660 Bacteria 1014
401 Ga0495625_0324327 3300046660 Bacteria 980
402 Ga0495635_0043823 3300046663 Bacteria 3086
403 Ga0495635_0045829 3300046663 Bacteria 3017
404 Ga0495635_0045937 3300046663 Bacteria 3012
405 Ga0495659_0007917 3300046664 Bacteria 3371
406 Ga0495659_0160086 3300046664 Bacteria 908
407 Ga0495661_0009539 3300046665 Bacteria 6658
408 Ga0495661_0012059 3300046665 Bacteria 5848
409 Ga0495661_0014125 3300046665 Bacteria 5351
410 Ga0495661_0035816 3300046665 Bacteria 3112
411 Ga0495661_0103728 3300046665 Bacteria 1595
412 Ga0495588_0014943 3300046674 Bacteria 3726
413 Ga0495588_0029612 3300046674 Bacteria 2747
414 Ga0495588_0044725 3300046674 Bacteria 2268
415 Ga0495588_0048747 3300046674 Bacteria 2176
416 Ga0495588_0063270 3300046674 Bacteria 1918
417 Ga0495588_0063767 3300046674 Bacteria 1911
418 Ga0495588_0071634 3300046674 Bacteria 1802
419 Ga0495657_0024654 3300046675 Bacteria 4281
420 Ga0495657_0028906 3300046675 Bacteria 3892
421 Ga0495599_0021541 3300046678 Bacteria 4022
422 Ga0495599_0098685 3300046678 Bacteria 1820
423 Ga0495599_0283904 3300046678 Bacteria 1002
424 Ga0495623_0002590 3300046679 Bacteria 11949
425 Ga0495623_0019199 3300046679 Bacteria 4419
426 Ga0495623_0043846 3300046679 Bacteria 2844
427 Ga0495623_0120140 3300046679 Bacteria 1582
428 Ga0495646_0003177 3300046680 Bacteria 10201
429 Ga0495646_0024965 3300046680 Bacteria 3760
430 Ga0495646_0041846 3300046680 Bacteria 2813
431 Ga0495646_0075907 3300046680 Bacteria 1969
432 Ga0495646_0088066 3300046680 Bacteria 1798
433 Ga0495646_0280981 3300046680 Bacteria 885
434 Ga0495669_0006284 3300046684 Bacteria 4959
435 Ga0495669_0092128 3300046684 Bacteria 1400
436 Ga0495669_0130793 3300046684 Bacteria 1181
437 Ga0495613_0002953 3300046689 Bacteria 12719
438 Ga0495613_0076686 3300046689 Bacteria 2432
439 Ga0495613_0084546 3300046689 Bacteria 2303
440 Ga0495624_0000346 3300046690 Bacteria 36774
441 Ga0495624_0031269 3300046690 Bacteria 3462
442 Ga0495624_0036576 3300046690 Bacteria 3163
443 Ga0495624_0052717 3300046690 Bacteria 2569
444 Ga0495624_0057078 3300046690 Bacteria 2455
445 Ga0495670_0023106 3300046691 Bacteria 3071
446 Ga0495670_0034321 3300046691 Bacteria 2526
447 Ga0495670_0036003 3300046691 Bacteria 2465
448 Ga0495670_0037605 3300046691 Bacteria 2412
449 Ga0495670_0161470 3300046691 Unclassified 1177
450 Ga0495671_0005035 3300046692 Bacteria 7786
451 Ga0495671_0028598 3300046692 Bacteria 2870
452 Ga0495671_0061121 3300046692 Bacteria 1859
453 Ga0495649_0017995 3300046694 Bacteria 3981
454 Ga0495649_0033335 3300046694 Bacteria 2834
455 Ga0495649_0307951 3300046694 Bacteria 805
456 Ga0495589_0006567 3300046794 Bacteria 6129
457 Ga0495589_0013422 3300046794 Bacteria 4227
458 Ga0495589_0028655 3300046794 Bacteria 2809
459 Ga0495589_0088648 3300046794 Bacteria 1502
460 Ga0495589_0101505 3300046794 Bacteria 1392
461 Ga0495589_0307969 3300046794 Bacteria 733
462 Ga0495600_0002829 3300046809 Bacteria 10093
463 Ga0495600_0009743 3300046809 Bacteria 5938
464 Ga0495660_0041299 3300046810 Bacteria 2555
465 Ga0495581_0012435 3300047315 Bacteria 4930
466 Ga0495581_0018244 3300047315 Bacteria 4075
467 Ga0495581_0018460 3300047315 Bacteria 4051
468 Ga0495581_0035360 3300047315 Bacteria 2891
469 Ga0495604_0002218 3300047317 Bacteria 15548
470 Ga0495604_0005928 3300047317 Bacteria 9691
471 Ga0495604_0014193 3300047317 Bacteria 6350
472 Ga0495604_0061509 3300047317 Bacteria 2871
473 Ga0495604_0104960 3300047317 Bacteria 2069
474 Ga0495604_0112364 3300047317 Bacteria 1985
475 Ga0495636_0006158 3300047318 Bacteria 4712
476 Ga0495636_0009942 3300047318 Bacteria 3747
477 Ga0495636_0024557 3300047318 Bacteria 2445
478 Ga0495636_0195350 3300047318 Unclassified 922
479 Ga0495636_0279258 3300047318 Bacteria 778
480 Ga0495674_0001458 3300047319 Bacteria 23159
481 Ga0495674_0014625 3300047319 Bacteria 7345
482 Ga0495674_0017546 3300047319 Bacteria 6661
483 Ga0495674_0029690 3300047319 Bacteria 4976
484 Ga0495674_0060414 3300047319 Bacteria 3307
485 Ga0495674_0070592 3300047319 Bacteria 3017
486 Ga0495674_0089959 3300047319 Bacteria 2624
487 Ga0495674_0403859 3300047319 Bacteria 1102
488 Ga0495674_0447621 3300047319 Bacteria 1038
489 Ga0495676_0021312 3300047321 Bacteria 5663
490 Ga0495676_0039941 3300047321 Bacteria 3879
491 Ga0495676_0051572 3300047321 Bacteria 3290
492 Ga0495676_0063467 3300047321 Bacteria 2879
493 Ga0495676_0070359 3300047321 Bacteria 2695
494 Ga0495676_0095184 3300047321 Bacteria 2217
495 Ga0495676_0104862 3300047321 Bacteria 2085
496 Ga0495676_0147097 3300047321 Bacteria 1681
497 Ga0495676_0155012 3300047321 Bacteria 1626
498 Ga0495680_0005876 3300047322 Bacteria 11481
499 Ga0495680_0010206 3300047322 Bacteria 8386
500 Ga0495680_0044468 3300047322 Bacteria 3511
501 Ga0495680_0116468 3300047322 Bacteria 1976
502 Ga0495683_0000549 3300047323 Bacteria 28461
503 Ga0495683_0002756 3300047323 Bacteria 10462
504 Ga0495683_0010018 3300047323 Bacteria 5026
505 Ga0495683_0022925 3300047323 Bacteria 3210
506 Ga0495683_0024533 3300047323 Bacteria 3094
507 Ga0495683_0030330 3300047323 Bacteria 2759
508 Ga0495683_0094100 3300047323 Bacteria 1448
509 Ga0495687_004930 3300047443 Bacteria 8735
510 Ga0495687_009112 3300047443 Bacteria 5589
511 Ga0495687_010989 3300047443 Bacteria 4907
512 Ga0495687_057390 3300047443 Bacteria 1619
513 Ga0495675_0003307 3300047444 Bacteria 9693
514 Ga0495675_0013522 3300047444 Bacteria 5153
515 Ga0495675_0022412 3300047444 Bacteria 4025
516 Ga0495675_0030281 3300047444 Bacteria 3453
517 Ga0495675_0039655 3300047444 Bacteria 2999
518 Ga0495675_0072819 3300047444 Bacteria 2167
519 Ga0495677_0005587 3300047445 Bacteria 4765
520 Ga0495677_0016952 3300047445 Bacteria 2641
521 Ga0495677_0045317 3300047445 Bacteria 1613
522 Ga0495677_0097227 3300047445 Bacteria 1112
523 Ga0495677_0104197 3300047445 Bacteria 1075
524 Ga0495677_0112447 3300047445 Bacteria 1036
525 Ga0495677_0205625 3300047445 Bacteria 766
526 Ga0495679_000117 3300047446 Bacteria 69653
527 Ga0495679_001746 3300047446 Bacteria 11955
528 Ga0495685_012533 3300047447 Bacteria 2872
529 Ga0495685_083809 3300047447 Bacteria 1060
530 Ga0495673_0004881 3300047469 Bacteria 8282
531 Ga0495673_0021779 3300047469 Bacteria 3156
532 Ga0495673_0105892 3300047469 Bacteria 1130
533 Ga0495681_0054376 3300047470 Bacteria 1870
534 Ga0495681_0128969 3300047470 Bacteria 1078
535 Ga0495681_0171483 3300047470 Unclassified 897
536 Ga0495684_0011315 3300047471 Bacteria 6888
537 Ga0495684_0070203 3300047471 Bacteria 2663
538 Ga0495684_0338254 3300047471 Bacteria 1072
539 Ga0495686_0057645 3300047472 Bacteria 2424
540 Ga0495686_0075182 3300047472 Bacteria 2072
541 Ga0495593_0003147 3300047673 Bacteria 9910
542 Ga0495593_0003965 3300047673 Bacteria 8836
543 Ga0495593_0006666 3300047673 Bacteria 6756
544 Ga0495593_0008366 3300047673 Bacteria 6019
545 Ga0495593_0043918 3300047673 Bacteria 2392
546 Ga0495593_0066174 3300047673 Bacteria 1883
547 Ga0495602_0003381 3300048088 Bacteria 16489
548 Ga0495602_0008250 3300048088 Bacteria 10875
549 Ga0495602_0058506 3300048088 Bacteria 3372
550 Ga0495602_0087491 3300048088 Bacteria 2597
551 Ga0495602_0090432 3300048088 Bacteria 2542
552 Ga0495602_0166379 3300048088 Bacteria 1716
553 Ga0495602_0427997 3300048088 Bacteria 938
554 Ga0495614_0004984 3300048089 Bacteria 5992
555 Ga0495614_0006264 3300048089 Bacteria 5345
556 Ga0495626_0002010 3300048091 Bacteria 14993
557 Ga0495626_0008093 3300048091 Bacteria 5799
558 Ga0495626_0014503 3300048091 Bacteria 4061
559 Ga0495626_0030351 3300048091 Bacteria 2607
560 Ga0495626_0032453 3300048091 Bacteria 2507
561 Ga0495626_0033781 3300048091 Bacteria 2449
562 Ga0495626_0055461 3300048091 Bacteria 1816
563 Ga0495626_0056171 3300048091 Bacteria 1803
564 Ga0496100_0000588 3300048903 Bacteria 17165
565 Ga0496101_0000441 3300048904 Bacteria 26552
566 Ga0496101_0036440 3300048904 Bacteria 3484
567 Ga0496102_0000113 3300048905 Bacteria 114531
568 Ga0496102_0002582 3300048905 Bacteria 15446
569 Ga0496102_0014645 3300048905 Bacteria 6817
570 Ga0496102_0137846 3300048905 Bacteria 2286
571 Ga0496103_0002188 3300048906 Bacteria 12407
572 Ga0496103_0010032 3300048906 Bacteria 5599
573 Ga0496103_0019894 3300048906 Bacteria 4031
574 Ga0496105_0234483 3300048908 Bacteria 1490
575 Ga0496106_0000001 3300048909 Bacteria 497458
576 Ga0496113_0012722 3300048916 Bacteria 5666
577 Ga0496115_0034018 3300048918 Bacteria 4027
578 Ga0496115_0113625 3300048918 Bacteria 2225
579 Ga0496116_0047977 3300048919 Bacteria 2870
580 Ga0496117_0007142 3300048920 Bacteria 11032
581 Ga0496117_0007991 3300048920 Bacteria 10150
582 Ga0496117_0035151 3300048920 Bacteria 3766
583 Ga0496117_0079507 3300048920 Bacteria 2160
584 Ga0496117_0091988 3300048920 Bacteria 1949
585 Ga0496118_0001325 3300048921 Bacteria 37547
586 Ga0496118_0003264 3300048921 Bacteria 20662
587 Ga0496118_0004335 3300048921 Bacteria 16894
588 Ga0496118_0022227 3300048921 Bacteria 5553
589 Ga0496118_0030141 3300048921 Bacteria 4534
590 Ga0496121_0001535 3300048924 Bacteria 38642
591 Ga0496121_0007027 3300048924 Bacteria 13673
592 Ga0496121_0007607 3300048924 Bacteria 13034
593 Ga0496121_0030658 3300048924 Bacteria 4934
594 Ga0496121_0075247 3300048924 Bacteria 2698
595 Ga0496122_0050977 3300048925 Bacteria 3151
596 Ga0496124_0009171 3300048927 Bacteria 10217
597 Ga0496124_0058637 3300048927 Bacteria 3237
598 Ga0496125_0090299 3300048928 Bacteria 2300
599 Ga0496126_0002361 3300048929 Bacteria 25765
600 Ga0496126_0003259 3300048929 Bacteria 20738
601 Ga0496126_0005490 3300048929 Bacteria 14449
602 Ga0496126_0102574 3300048929 Bacteria 2501
603 Ga0466983_0482747 3300048986 Unclassified 861
604 Ga0495682_0003997 3300049460 Bacteria 6423
605 Ga0495682_0008798 3300049460 Bacteria 3968
606 Ga0495682_0021444 3300049460 Bacteria 2420
607 Ga0495682_0054661 3300049460 Bacteria 1449
608 Ga0466962_0002680 3300061719 Bacteria 8474
609 Ga0466962_0003392 3300061719 Bacteria 7584
610 Ga0466962_0006178 3300061719 Bacteria 5754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0078974 Ga0466969_0078974_40_630 196
2 3300044706 Ga0466964_0352866 Ga0466964_0352866_79_669 196
3 3300037418 Ga0395900_0928636 Ga0395900_0928636_27_674 200
4 3300047445 Ga0495677_0205625 Ga0495677_0205625_16_681 213
5 3300047318 Ga0495636_0279258 Ga0495636_0279258_73_741 214
6 3300038443 Ga0395901_0000004 Ga0395901_0000004_544288_545016 215
7 3300046794 Ga0495589_0307969 Ga0495589_0307969_31_702 215
8 3300037312 Ga0395899_0004119 Ga0395899_0004119_10308_11012 219
9 3300037466 Ga0395898_0267470 Ga0395898_0267470_838_1542 219
10 3300038443 Ga0395901_0000326 Ga0395901_0000326_41815_42519 219
11 3300048905 Ga0496102_0000113 Ga0496102_0000113_62635_63366 219
12 3300001989 JGI24739J22299_10027319 JGI24739J22299_100273193 220
13 3300005327 Ga0070658_10024294 Ga0070658_100242946 220
14 3300005366 Ga0070659_100003120 Ga0070659_10000312013 220
15 3300005455 Ga0070663_100096016 Ga0070663_1000960163 220
16 3300005563 Ga0068855_100021555 Ga0068855_1000215558 220
17 3300009093 Ga0105240_10258901 Ga0105240_102589013 220
18 3300009093 Ga0105240_10364539 Ga0105240_103645393 220
19 3300009174 Ga0105241_10251721 Ga0105241_102517212 220
20 3300009545 Ga0105237_10042791 Ga0105237_100427912 220
21 3300009551 Ga0105238_10209776 Ga0105238_102097763 220
22 3300013104 Ga0157370_10009653 Ga0157370_100096539 220
23 3300013104 Ga0157370_10059573 Ga0157370_100595734 220
24 3300013105 Ga0157369_10000093 Ga0157369_1000009342 220
25 3300013307 Ga0157372_10503444 Ga0157372_105034443 220
26 3300020070 Ga0206356_10321302 Ga0206356_103213022 220
27 3300020075 Ga0206349_1710490 Ga0206349_17104902 220
28 3300020080 Ga0206350_10168369 Ga0206350_101683692 220
29 3300022467 Ga0224712_10000006 Ga0224712_1000000611 220
30 3300025909 Ga0207705_10001186 Ga0207705_100011867 220
31 3300025932 Ga0207690_10004205 Ga0207690_100042057 220
32 3300025949 Ga0207667_10001488 Ga0207667_1000148831 220
33 3300025949 Ga0207667_10003305 Ga0207667_100033056 220
34 3300026067 Ga0207678_10123219 Ga0207678_101232193 220
35 3300046674 Ga0495588_0063270 Ga0495588_0063270_964_1671 227
36 iso_pu_bacteria 2501025504 2501411991 227
37 3300046454 Ga0495592_0228143 Ga0495592_0228143_380_1072 230
38 3300046463 Ga0495653_0025956 Ga0495653_0025956_3152_3844 230
39 3300046680 Ga0495646_0088066 Ga0495646_0088066_885_1577 230
40 3300048088 Ga0495602_0003381 Ga0495602_0003381_10754_11446 230
41 iso_pu_bacteria 2501025502 2501085865 230
42 iso_pu_bacteria 2510065045 2510248648 230
43 iso_pu_bacteria 2510917013 2511088403 230
44 iso_pu_bacteria 2510917014 2511100986 230
45 iso_pu_bacteria 2510917015 2511107268 230
46 iso_pu_bacteria 2512047030 2512349242 230
47 iso_pu_bacteria 2513237166 2514053681 230
48 iso_pu_bacteria 2515154122 2515680074 230
49 iso_pu_bacteria 2718217991 2719642925 230
50 iso_pu_bacteria 2751185846 2753571575 230
51 iso_pu_bacteria 2818991450 2819619402 230
52 iso_pu_bacteria 2842324504 2842326660 230
53 iso_pu_bacteria 2885270888 2885278203 230
54 iso_pu_bacteria 2902682994 2902688081 230
55 iso_pu_bacteria 2928108538 2928111574 230
56 iso_pu_bacteria 2928135762 2928138376 230
57 iso_pu_bacteria 2928503688 2928504815 230
58 iso_pu_bacteria 642555112 642596192 230
59 iso_pu_bacteria 642555113 642615371 230
60 3300003320 rootH2_10134206 rootH2_101342063 231
61 3300003323 rootH1_10056827 rootH1_100568274 231
62 3300003323 rootH1_10318495 rootH1_103184952 231
63 3300025941 Ga0207711_10073294 Ga0207711_100732943 231
64 3300025941 Ga0207711_10198614 Ga0207711_101986142 231
65 3300046674 Ga0495588_0063767 Ga0495588_0063767_616_1332 231
66 3300048906 Ga0496103_0019894 Ga0496103_0019894_1943_2665 231
67 3300042139 Ga0450904_002363 Ga0450904_002363_444_1172 232
68 3300037418 Ga0395900_0000146 Ga0395900_0000146_16583_17311 233
69 3300001989 JGI24739J22299_10001842 JGI24739J22299_100018427 234
70 3300001990 JGI24737J22298_10015644 JGI24737J22298_100156443 234
71 3300002705 JGI25156J39149_1000388 JGI25156J39149_100038823 234
72 3300003316 rootH1_10097798 rootH1_100977983 234
73 3300003322 rootL2_10009775 rootL2_1000977518 234
74 3300003354 JGI25160J50197_1000236 JGI25160J50197_100023610 234
75 3300005262 Ga0065165_1004388 Ga0065165_10043885 234
76 3300009011 Ga0105251_10002663 Ga0105251_1000266312 234
77 3300009011 Ga0105251_10033980 Ga0105251_100339802 234
78 3300009093 Ga0105240_10395058 Ga0105240_103950582 234
79 3300013105 Ga0157369_10191666 Ga0157369_101916662 234
80 3300014969 Ga0157376_10106251 Ga0157376_101062511 234
81 3300015262 Ga0182007_10000198 Ga0182007_1000019816 234
82 3300016635 Ga0183361_10002 Ga0183361_10002471 234
83 3300025225 Ga0209566_103344 Ga0209566_1033444 234
84 3300025230 Ga0209563_103471 Ga0209563_1034714 234
85 3300025253 Ga0209677_112123 Ga0209677_1121232 234
86 3300025284 Ga0209130_1008952 Ga0209130_10089523 234
87 3300025295 Ga0209564_1014337 Ga0209564_10143374 234
88 3300025735 Ga0207713_1010253 Ga0207713_10102534 234
89 3300025735 Ga0207713_1042970 Ga0207713_10429701 234
90 3300025904 Ga0207647_10029535 Ga0207647_100295353 234
91 3300027312 Ga0209371_1007185 Ga0209371_10071854 234
92 3300031250 Ga0265331_10033825 Ga0265331_100338251 234
93 3300037312 Ga0395899_0000127 Ga0395899_0000127_105062_105793 234
94 3300037471 Ga0395905_0000052 Ga0395905_0000052_120164_120868 234
95 3300038443 Ga0395901_1106729 Ga0395901_1106729_17_721 234
96 3300039438 Ga0436360_0537052 Ga0436360_0537052_92_796 234
97 3300039438 Ga0436360_1359059 Ga0436360_1359059_373_1077 234
98 3300039447 Ga0436361_1220172 Ga0436361_1220172_204_908 234
99 3300044656 Ga0466969_0000523 Ga0466969_0000523_10903_11607 234
100 3300044658 Ga0466972_0007364 Ga0466972_0007364_3430_4134 234
101 3300044659 Ga0466973_0010555 Ga0466973_0010555_4868_5572 234
102 3300044683 Ga0466965_0007843 Ga0466965_0007843_1819_2523 234
103 3300044684 Ga0466966_0002709 Ga0466966_0002709_7524_8228 234
104 3300044684 Ga0466966_0023627 Ga0466966_0023627_1271_1975 234
105 3300044693 Ga0466961_0000562 Ga0466961_0000562_15392_16096 234
106 3300044693 Ga0466961_0014694 Ga0466961_0014694_1633_2337 234
107 3300044694 Ga0466963_0001202 Ga0466963_0001202_6236_6940 234
108 3300044706 Ga0466964_0031268 Ga0466964_0031268_464_1168 234
109 3300044719 Ga0466971_0002338 Ga0466971_0002338_1552_2256 234
110 3300044765 Ga0466970_0000982 Ga0466970_0000982_12844_13548 234
111 3300044842 Ga0466957_0050272 Ga0466957_0050272_12_716 234
112 3300044842 Ga0466957_0067101 Ga0466957_0067101_424_1128 234
113 3300045049 Ga0466959_0006591 Ga0466959_0006591_1904_2608 234
114 3300045049 Ga0466959_0040190 Ga0466959_0040190_1567_2271 234
115 3300045836 Ga0466958_0009456 Ga0466958_0009456_2909_3613 234
116 3300045836 Ga0466958_0018964 Ga0466958_0018964_566_1270 234
117 3300046454 Ga0495592_0003298 Ga0495592_0003298_4650_5354 234
118 3300046454 Ga0495592_0162657 Ga0495592_0162657_597_1301 234
119 3300046455 Ga0495603_0004911 Ga0495603_0004911_3078_3782 234
120 3300046455 Ga0495603_0011762 Ga0495603_0011762_3931_4635 234
121 3300046455 Ga0495603_0271170 Ga0495603_0271170_212_916 234
122 3300046458 Ga0495591_005284 Ga0495591_005284_204_908 234
123 3300046459 Ga0495629_0004232 Ga0495629_0004232_8213_8917 234
124 3300046459 Ga0495629_0006233 Ga0495629_0006233_656_1360 234
125 3300046460 Ga0495638_0002634 Ga0495638_0002634_294_998 234
126 3300046462 Ga0495651_0004195 Ga0495651_0004195_3369_4073 234
127 3300046462 Ga0495651_0044647 Ga0495651_0044647_2520_3224 234
128 3300046462 Ga0495651_0112617 Ga0495651_0112617_812_1516 234
129 3300046462 Ga0495651_0142049 Ga0495651_0142049_224_928 234
130 3300046463 Ga0495653_0003074 Ga0495653_0003074_62_766 234
131 3300046463 Ga0495653_0071117 Ga0495653_0071117_1390_2094 234
132 3300046463 Ga0495653_0173066 Ga0495653_0173066_586_1290 234
133 3300046472 Ga0495580_0000479 Ga0495580_0000479_30940_31644 234
134 3300046472 Ga0495580_0001347 Ga0495580_0001347_17883_18587 234
135 3300046472 Ga0495580_0003533 Ga0495580_0003533_3075_3779 234
136 3300046472 Ga0495580_0016355 Ga0495580_0016355_3574_4278 234
137 3300046472 Ga0495580_0018642 Ga0495580_0018642_2577_3281 234
138 3300046473 Ga0495582_0001992 Ga0495582_0001992_9844_10548 234
139 3300046473 Ga0495582_0171335 Ga0495582_0171335_216_920 234
140 3300046477 Ga0495664_0001641 Ga0495664_0001641_2735_3439 234
141 3300046477 Ga0495664_0006238 Ga0495664_0006238_5752_6456 234
142 3300046491 Ga0495584_0107723 Ga0495584_0107723_416_1120 234
143 3300046500 Ga0495596_0010145 Ga0495596_0010145_2844_3548 234
144 3300046506 Ga0495583_0000189 Ga0495583_0000189_51716_52444 234
145 3300046506 Ga0495583_0010015 Ga0495583_0010015_65_769 234
146 3300046506 Ga0495583_0039951 Ga0495583_0039951_1406_2110 234
147 3300046507 Ga0495606_0025364 Ga0495606_0025364_2421_3125 234
148 3300046507 Ga0495606_0052228 Ga0495606_0052228_1009_1713 234
149 3300046507 Ga0495606_0073408 Ga0495606_0073408_98_802 234
150 3300046511 Ga0495608_0003627 Ga0495608_0003627_9791_10495 234
151 3300046512 Ga0495610_0000678 Ga0495610_0000678_29554_30258 234
152 3300046513 Ga0495616_0010393 Ga0495616_0010393_429_1133 234
153 3300046514 Ga0495618_0033637 Ga0495618_0033637_678_1382 234
154 3300046514 Ga0495618_0107173 Ga0495618_0107173_277_981 234
155 3300046516 Ga0495628_0007146 Ga0495628_0007146_7738_8442 234
156 3300046516 Ga0495628_0028434 Ga0495628_0028434_3323_4027 234
157 3300046517 Ga0495630_0004616 Ga0495630_0004616_8415_9119 234
158 3300046517 Ga0495630_0037901 Ga0495630_0037901_14_718 234
159 3300046517 Ga0495630_0041805 Ga0495630_0041805_89_793 234
160 3300046517 Ga0495630_0066501 Ga0495630_0066501_1789_2493 234
161 3300046524 Ga0495648_0000909 Ga0495648_0000909_3257_3961 234
162 3300046524 Ga0495648_0074407 Ga0495648_0074407_246_950 234
163 3300046524 Ga0495648_0085782 Ga0495648_0085782_97_801 234
164 3300046526 Ga0495666_0001208 Ga0495666_0001208_8442_9146 234
165 3300046526 Ga0495666_0003006 Ga0495666_0003006_7065_7769 234
166 3300046526 Ga0495666_0003329 Ga0495666_0003329_493_1197 234
167 3300046528 Ga0495642_0040106 Ga0495642_0040106_557_1261 234
168 3300046529 Ga0495652_0051703 Ga0495652_0051703_853_1557 234
169 3300046529 Ga0495652_0221521 Ga0495652_0221521_441_1145 234
170 3300046531 Ga0495665_0005429 Ga0495665_0005429_3566_4270 234
171 3300046533 Ga0495640_0002226 Ga0495640_0002226_880_1584 234
172 3300046533 Ga0495640_0014283 Ga0495640_0014283_562_1266 234
173 3300046535 Ga0495586_0057128 Ga0495586_0057128_562_1266 234
174 3300046536 Ga0495587_0002006 Ga0495587_0002006_8415_9119 234
175 3300046536 Ga0495587_0003001 Ga0495587_0003001_2401_3105 234
176 3300046542 Ga0495597_0044958 Ga0495597_0044958_1125_1829 234
177 3300046543 Ga0495645_0002313 Ga0495645_0002313_2711_3415 234
178 3300046557 Ga0495622_0000140 Ga0495622_0000140_26227_26931 234
179 3300046559 Ga0495667_0048375 Ga0495667_0048375_112_816 234
180 3300046616 Ga0495668_0005786 Ga0495668_0005786_1291_2019 234
181 3300046642 Ga0495634_0005115 Ga0495634_0005115_991_1695 234
182 3300046642 Ga0495634_0084275 Ga0495634_0084275_1119_1823 234
183 3300046648 Ga0495611_0007318 Ga0495611_0007318_2120_2824 234
184 3300046660 Ga0495625_0306931 Ga0495625_0306931_119_823 234
185 3300046663 Ga0495635_0043823 Ga0495635_0043823_1457_2161 234
186 3300046665 Ga0495661_0009539 Ga0495661_0009539_5197_5901 234
187 3300046665 Ga0495661_0014125 Ga0495661_0014125_3450_4154 234
188 3300046675 Ga0495657_0024654 Ga0495657_0024654_822_1526 234
189 3300046678 Ga0495599_0021541 Ga0495599_0021541_863_1567 234
190 3300046678 Ga0495599_0098685 Ga0495599_0098685_614_1318 234
191 3300046679 Ga0495623_0002590 Ga0495623_0002590_11143_11847 234
192 3300046679 Ga0495623_0019199 Ga0495623_0019199_3283_3987 234
193 3300046679 Ga0495623_0120140 Ga0495623_0120140_378_1082 234
194 3300046680 Ga0495646_0024965 Ga0495646_0024965_2255_2959 234
195 3300046680 Ga0495646_0041846 Ga0495646_0041846_2092_2796 234
196 3300046680 Ga0495646_0075907 Ga0495646_0075907_1031_1735 234
197 3300046680 Ga0495646_0280981 Ga0495646_0280981_161_865 234
198 3300046684 Ga0495669_0092128 Ga0495669_0092128_126_830 234
199 3300046689 Ga0495613_0002953 Ga0495613_0002953_3451_4155 234
200 3300046689 Ga0495613_0084546 Ga0495613_0084546_943_1647 234
201 3300046690 Ga0495624_0000346 Ga0495624_0000346_2317_3021 234
202 3300046690 Ga0495624_0052717 Ga0495624_0052717_1628_2332 234
203 3300046692 Ga0495671_0005035 Ga0495671_0005035_4978_5682 234
204 3300046692 Ga0495671_0028598 Ga0495671_0028598_500_1204 234
205 3300046692 Ga0495671_0061121 Ga0495671_0061121_14_718 234
206 3300046694 Ga0495649_0033335 Ga0495649_0033335_25_729 234
207 3300046794 Ga0495589_0006567 Ga0495589_0006567_899_1603 234
208 3300046794 Ga0495589_0088648 Ga0495589_0088648_735_1439 234
209 3300046794 Ga0495589_0101505 Ga0495589_0101505_244_948 234
210 3300046809 Ga0495600_0002829 Ga0495600_0002829_656_1360 234
211 3300047315 Ga0495581_0018244 Ga0495581_0018244_2570_3274 234
212 3300047317 Ga0495604_0002218 Ga0495604_0002218_14391_15095 234
213 3300047317 Ga0495604_0005928 Ga0495604_0005928_6017_6721 234
214 3300047317 Ga0495604_0014193 Ga0495604_0014193_4365_5069 234
215 3300047317 Ga0495604_0104960 Ga0495604_0104960_316_1020 234
216 3300047319 Ga0495674_0014625 Ga0495674_0014625_6538_7242 234
217 3300047319 Ga0495674_0029690 Ga0495674_0029690_1884_2588 234
218 3300047319 Ga0495674_0060414 Ga0495674_0060414_364_1068 234
219 3300047319 Ga0495674_0089959 Ga0495674_0089959_217_921 234
220 3300047319 Ga0495674_0403859 Ga0495674_0403859_250_954 234
221 3300047321 Ga0495676_0021312 Ga0495676_0021312_454_1158 234
222 3300047321 Ga0495676_0063467 Ga0495676_0063467_461_1165 234
223 3300047321 Ga0495676_0070359 Ga0495676_0070359_1062_1766 234
224 3300047322 Ga0495680_0005876 Ga0495680_0005876_9746_10450 234
225 3300047322 Ga0495680_0044468 Ga0495680_0044468_173_877 234
226 3300047322 Ga0495680_0116468 Ga0495680_0116468_98_802 234
227 3300047323 Ga0495683_0010018 Ga0495683_0010018_2872_3576 234
228 3300047443 Ga0495687_004930 Ga0495687_004930_3408_4112 234
229 3300047443 Ga0495687_010989 Ga0495687_010989_4068_4772 234
230 3300047443 Ga0495687_057390 Ga0495687_057390_479_1183 234
231 3300047444 Ga0495675_0003307 Ga0495675_0003307_1823_2527 234
232 3300047444 Ga0495675_0022412 Ga0495675_0022412_3108_3812 234
233 3300047444 Ga0495675_0030281 Ga0495675_0030281_178_882 234
234 3300047444 Ga0495675_0072819 Ga0495675_0072819_969_1673 234
235 3300047446 Ga0495679_000117 Ga0495679_000117_41414_42118 234
236 3300047446 Ga0495679_001746 Ga0495679_001746_1237_1941 234
237 3300047469 Ga0495673_0004881 Ga0495673_0004881_4643_5347 234
238 3300047469 Ga0495673_0021779 Ga0495673_0021779_313_1017 234
239 3300047469 Ga0495673_0105892 Ga0495673_0105892_138_842 234
240 3300047470 Ga0495681_0128969 Ga0495681_0128969_132_836 234
241 3300047471 Ga0495684_0011315 Ga0495684_0011315_63_767 234
242 3300047471 Ga0495684_0070203 Ga0495684_0070203_378_1082 234
243 3300047673 Ga0495593_0003147 Ga0495593_0003147_1051_1755 234
244 3300047673 Ga0495593_0003965 Ga0495593_0003965_822_1526 234
245 3300048088 Ga0495602_0008250 Ga0495602_0008250_1087_1791 234
246 3300048088 Ga0495602_0058506 Ga0495602_0058506_1476_2180 234
247 3300048088 Ga0495602_0090432 Ga0495602_0090432_65_769 234
248 3300048089 Ga0495614_0004984 Ga0495614_0004984_4059_4763 234
249 3300048091 Ga0495626_0014503 Ga0495626_0014503_2689_3393 234
250 3300048091 Ga0495626_0030351 Ga0495626_0030351_248_952 234
251 3300048903 Ga0496100_0000588 Ga0496100_0000588_4700_5404 234
252 3300048904 Ga0496101_0000441 Ga0496101_0000441_982_1686 234
253 3300048904 Ga0496101_0036440 Ga0496101_0036440_2066_2770 234
254 3300048905 Ga0496102_0002582 Ga0496102_0002582_7649_8353 234
255 3300048906 Ga0496103_0002188 Ga0496103_0002188_11473_12177 234
256 3300048908 Ga0496105_0234483 Ga0496105_0234483_716_1420 234
257 3300048916 Ga0496113_0012722 Ga0496113_0012722_3716_4420 234
258 3300048919 Ga0496116_0047977 Ga0496116_0047977_356_1060 234
259 3300048920 Ga0496117_0007142 Ga0496117_0007142_4931_5635 234
260 3300048920 Ga0496117_0035151 Ga0496117_0035151_225_929 234
261 3300048920 Ga0496117_0079507 Ga0496117_0079507_922_1626 234
262 3300048921 Ga0496118_0003264 Ga0496118_0003264_11487_12191 234
263 3300048921 Ga0496118_0004335 Ga0496118_0004335_5952_6656 234
264 3300048921 Ga0496118_0030141 Ga0496118_0030141_2721_3425 234
265 3300048924 Ga0496121_0001535 Ga0496121_0001535_3024_3728 234
266 3300048924 Ga0496121_0007027 Ga0496121_0007027_1237_1941 234
267 3300048924 Ga0496121_0075247 Ga0496121_0075247_1951_2655 234
268 3300048925 Ga0496122_0050977 Ga0496122_0050977_1224_1928 234
269 3300048927 Ga0496124_0058637 Ga0496124_0058637_2131_2835 234
270 3300048928 Ga0496125_0090299 Ga0496125_0090299_531_1235 234
271 3300048929 Ga0496126_0002361 Ga0496126_0002361_24681_25385 234
272 3300048929 Ga0496126_0102574 Ga0496126_0102574_865_1569 234
273 3300048986 Ga0466983_0482747 Ga0466983_0482747_39_743 234
274 3300049460 Ga0495682_0008798 Ga0495682_0008798_120_824 234
275 3300049460 Ga0495682_0054661 Ga0495682_0054661_159_863 234
276 3300061719 Ga0466962_0006178 Ga0466962_0006178_4730_5434 234
277 3300046460 Ga0495638_0018094 Ga0495638_0018094_1765_2499 235
278 3300046491 Ga0495584_0039677 Ga0495584_0039677_1253_1987 235
279 3300046492 Ga0495585_0006990 Ga0495585_0006990_796_1530 235
280 3300046501 Ga0495607_0016994 Ga0495607_0016994_1058_1792 235
281 3300046513 Ga0495616_0020097 Ga0495616_0020097_1043_1777 235
282 3300046519 Ga0495632_0002983 Ga0495632_0002983_10551_11285 235
283 3300046525 Ga0495663_0017111 Ga0495663_0017111_1153_1908 235
284 3300046525 Ga0495663_0074495 Ga0495663_0074495_276_1010 235
285 3300046528 Ga0495642_0005022 Ga0495642_0005022_1924_2658 235
286 3300046542 Ga0495597_0000328 Ga0495597_0000328_25326_26060 235
287 3300046616 Ga0495668_0009366 Ga0495668_0009366_4322_5056 235
288 3300046648 Ga0495611_0003948 Ga0495611_0003948_5388_6122 235
289 3300046660 Ga0495625_0209072 Ga0495625_0209072_458_1192 235
290 3300046665 Ga0495661_0103728 Ga0495661_0103728_794_1528 235
291 3300046794 Ga0495589_0013422 Ga0495589_0013422_2478_3212 235
292 3300047318 Ga0495636_0006158 Ga0495636_0006158_1183_1938 235
293 3300047323 Ga0495683_0022925 Ga0495683_0022925_1437_2171 235
294 3300047445 Ga0495677_0005587 Ga0495677_0005587_1755_2489 235
295 3300047447 Ga0495685_012533 Ga0495685_012533_1059_1793 235
296 3300047447 Ga0495685_083809 Ga0495685_083809_75_830 235
297 3300047470 Ga0495681_0054376 Ga0495681_0054376_772_1506 235
298 3300047472 Ga0495686_0057645 Ga0495686_0057645_20_754 235
299 3300048091 Ga0495626_0055461 Ga0495626_0055461_1009_1743 235
300 3300048918 Ga0496115_0113625 Ga0496115_0113625_98_832 235
301 3300049460 Ga0495682_0003997 Ga0495682_0003997_2625_3359 235
302 3300005288 Ga0065714_10017574 Ga0065714_100175742 236
303 3300005288 Ga0065714_10198283 Ga0065714_101982831 236
304 3300013307 Ga0157372_10410143 Ga0157372_104101432 236
305 3300046452 Ga0495617_001373 Ga0495617_001373_6304_7041 236
306 3300046460 Ga0495638_0124922 Ga0495638_0124922_577_1311 236
307 3300046460 Ga0495638_0176911 Ga0495638_0176911_219_956 236
308 3300046474 Ga0495605_0037629 Ga0495605_0037629_173_907 236
309 3300046475 Ga0495639_0101135 Ga0495639_0101135_14_748 236
310 3300046491 Ga0495584_0000021 Ga0495584_0000021_73278_74015 236
311 3300046491 Ga0495584_0043923 Ga0495584_0043923_1140_1877 236
312 3300046491 Ga0495584_0054170 Ga0495584_0054170_990_1727 236
313 3300046491 Ga0495584_0083239 Ga0495584_0083239_150_887 236
314 3300046492 Ga0495585_0000005 Ga0495585_0000005_103296_104033 236
315 3300046492 Ga0495585_0000102 Ga0495585_0000102_87608_88345 236
316 3300046492 Ga0495585_0001377 Ga0495585_0001377_17063_17800 236
317 3300046492 Ga0495585_0007710 Ga0495585_0007710_1778_2515 236
318 3300046492 Ga0495585_0020263 Ga0495585_0020263_2619_3356 236
319 3300046492 Ga0495585_0021656 Ga0495585_0021656_1895_2644 236
320 3300046492 Ga0495585_0022959 Ga0495585_0022959_2787_3524 236
321 3300046492 Ga0495585_0057678 Ga0495585_0057678_715_1452 236
322 3300046492 Ga0495585_0130935 Ga0495585_0130935_135_872 236
323 3300046492 Ga0495585_0138398 Ga0495585_0138398_355_1104 236
324 3300046500 Ga0495596_0000354 Ga0495596_0000354_27647_28384 236
325 3300046500 Ga0495596_0017663 Ga0495596_0017663_848_1585 236
326 3300046506 Ga0495583_0004476 Ga0495583_0004476_7973_8707 236
327 3300046506 Ga0495583_0171547 Ga0495583_0171547_85_819 236
328 3300046507 Ga0495606_0072609 Ga0495606_0072609_90_827 236
329 3300046513 Ga0495616_0000897 Ga0495616_0000897_1124_1858 236
330 3300046513 Ga0495616_0002283 Ga0495616_0002283_1757_2494 236
331 3300046513 Ga0495616_0062501 Ga0495616_0062501_1048_1785 236
332 3300046513 Ga0495616_0084815 Ga0495616_0084815_292_1029 236
333 3300046517 Ga0495630_0091871 Ga0495630_0091871_886_1623 236
334 3300046520 Ga0495637_0032323 Ga0495637_0032323_1276_2010 236
335 3300046522 Ga0495643_0000259 Ga0495643_0000259_1053_1787 236
336 3300046522 Ga0495643_0006407 Ga0495643_0006407_6043_6780 236
337 3300046523 Ga0495644_0008224 Ga0495644_0008224_3257_3994 236
338 3300046523 Ga0495644_0018849 Ga0495644_0018849_502_1239 236
339 3300046523 Ga0495644_0063721 Ga0495644_0063721_594_1325 236
340 3300046524 Ga0495648_0000076 Ga0495648_0000076_25404_26141 236
341 3300046524 Ga0495648_0028779 Ga0495648_0028779_1115_1852 236
342 3300046524 Ga0495648_0048141 Ga0495648_0048141_603_1340 236
343 3300046525 Ga0495663_0006106 Ga0495663_0006106_1765_2502 236
344 3300046526 Ga0495666_0053430 Ga0495666_0053430_10_747 236
345 3300046528 Ga0495642_0144551 Ga0495642_0144551_61_798 236
346 3300046531 Ga0495665_0006578 Ga0495665_0006578_754_1491 236
347 3300046535 Ga0495586_0039756 Ga0495586_0039756_1748_2497 236
348 3300046535 Ga0495586_0041720 Ga0495586_0041720_681_1418 236
349 3300046536 Ga0495587_0011305 Ga0495587_0011305_1538_2275 236
350 3300046538 Ga0495609_0006057 Ga0495609_0006057_3005_3742 236
351 3300046538 Ga0495609_0023935 Ga0495609_0023935_1231_1968 236
352 3300046542 Ga0495597_0036198 Ga0495597_0036198_1016_1750 236
353 3300046542 Ga0495597_0078688 Ga0495597_0078688_168_905 236
354 3300046542 Ga0495597_0140569 Ga0495597_0140569_40_777 236
355 3300046557 Ga0495622_0006343 Ga0495622_0006343_4080_4817 236
356 3300046557 Ga0495622_0038494 Ga0495622_0038494_353_1090 236
357 3300046558 Ga0495633_0004396 Ga0495633_0004396_7289_8038 236
358 3300046558 Ga0495633_0007165 Ga0495633_0007165_728_1465 236
359 3300046558 Ga0495633_0011358 Ga0495633_0011358_3773_4510 236
360 3300046558 Ga0495633_0015475 Ga0495633_0015475_1859_2596 236
361 3300046615 Ga0495656_0036786 Ga0495656_0036786_257_994 236
362 3300046616 Ga0495668_0095072 Ga0495668_0095072_139_876 236
363 3300046616 Ga0495668_0219504 Ga0495668_0219504_108_839 236
364 3300046660 Ga0495625_0035845 Ga0495625_0035845_1998_2735 236
365 3300046660 Ga0495625_0324327 Ga0495625_0324327_219_956 236
366 3300046663 Ga0495635_0045829 Ga0495635_0045829_1098_1847 236
367 3300046664 Ga0495659_0007917 Ga0495659_0007917_1600_2337 236
368 3300046664 Ga0495659_0160086 Ga0495659_0160086_127_864 236
369 3300046665 Ga0495661_0012059 Ga0495661_0012059_651_1382 236
370 3300046665 Ga0495661_0035816 Ga0495661_0035816_469_1218 236
371 3300046674 Ga0495588_0014943 Ga0495588_0014943_2376_3113 236
372 3300046674 Ga0495588_0029612 Ga0495588_0029612_890_1627 236
373 3300046674 Ga0495588_0044725 Ga0495588_0044725_761_1498 236
374 3300046674 Ga0495588_0048747 Ga0495588_0048747_681_1418 236
375 3300046674 Ga0495588_0071634 Ga0495588_0071634_750_1487 236
376 3300046684 Ga0495669_0006284 Ga0495669_0006284_2945_3682 236
377 3300046684 Ga0495669_0130793 Ga0495669_0130793_226_963 236
378 3300046690 Ga0495624_0057078 Ga0495624_0057078_12_749 236
379 3300046691 Ga0495670_0023106 Ga0495670_0023106_683_1420 236
380 3300046691 Ga0495670_0034321 Ga0495670_0034321_1113_1862 236
381 3300046691 Ga0495670_0161470 Ga0495670_0161470_424_1161 236
382 3300047315 Ga0495581_0018460 Ga0495581_0018460_1660_2397 236
383 3300047315 Ga0495581_0035360 Ga0495581_0035360_1674_2423 236
384 3300047317 Ga0495604_0112364 Ga0495604_0112364_702_1439 236
385 3300047318 Ga0495636_0195350 Ga0495636_0195350_41_778 236
386 3300047319 Ga0495674_0447621 Ga0495674_0447621_214_951 236
387 3300047321 Ga0495676_0051572 Ga0495676_0051572_171_908 236
388 3300047321 Ga0495676_0155012 Ga0495676_0155012_540_1277 236
389 3300047323 Ga0495683_0000549 Ga0495683_0000549_24989_25726 236
390 3300047323 Ga0495683_0030330 Ga0495683_0030330_1726_2463 236
391 3300047323 Ga0495683_0094100 Ga0495683_0094100_566_1303 236
392 3300047444 Ga0495675_0013522 Ga0495675_0013522_341_1090 236
393 3300047445 Ga0495677_0045317 Ga0495677_0045317_38_775 236
394 3300047445 Ga0495677_0097227 Ga0495677_0097227_225_962 236
395 3300047445 Ga0495677_0104197 Ga0495677_0104197_321_1058 236
396 3300047470 Ga0495681_0171483 Ga0495681_0171483_131_868 236
397 3300047471 Ga0495684_0338254 Ga0495684_0338254_170_907 236
398 3300047673 Ga0495593_0008366 Ga0495593_0008366_2091_2840 236
399 3300047673 Ga0495593_0066174 Ga0495593_0066174_1070_1807 236
400 3300048088 Ga0495602_0166379 Ga0495602_0166379_882_1619 236
401 3300048091 Ga0495626_0002010 Ga0495626_0002010_6978_7712 236
402 3300048091 Ga0495626_0008093 Ga0495626_0008093_1245_1979 236
403 3300048091 Ga0495626_0032453 Ga0495626_0032453_493_1230 236
404 3300048091 Ga0495626_0033781 Ga0495626_0033781_1334_2071 236
405 3300048905 Ga0496102_0137846 Ga0496102_0137846_1329_2066 236
406 3300048918 Ga0496115_0034018 Ga0496115_0034018_2268_3005 236
407 3300045836 Ga0466958_0005470 Ga0466958_0005470_5934_6656 237
408 3300047318 Ga0495636_0009942 Ga0495636_0009942_1301_2062 237
409 3300047319 Ga0495674_0001458 Ga0495674_0001458_6846_7586 237
410 3300047445 Ga0495677_0112447 Ga0495677_0112447_144_905 237
411 3300048927 Ga0496124_0009171 Ga0496124_0009171_6605_7345 237
412 3300046455 Ga0495603_0216539 Ga0495603_0216539_113_868 238
413 3300046526 Ga0495666_0057878 Ga0495666_0057878_857_1624 238
414 3300046531 Ga0495665_0015735 Ga0495665_0015735_1311_2078 238
415 3300046535 Ga0495586_0062586 Ga0495586_0062586_902_1669 238
416 3300046557 Ga0495622_0064833 Ga0495622_0064833_12_779 238
417 3300047321 Ga0495676_0095184 Ga0495676_0095184_612_1379 238
418 iso_pu_bacteria 2508501125 2509126513 238
419 iso_pu_bacteria 2513237082 2513557293 238
420 iso_pu_bacteria 2513237083 2513564936 238
421 iso_pu_bacteria 2513237151 2513958258 238
422 iso_pu_bacteria 2515154123 2515687765 238
423 iso_pu_bacteria 2515154189 2516022045 238
424 iso_pu_bacteria 2526164713 2527077224 238
425 iso_pu_bacteria 2600255067 2600811185 238
426 iso_pu_bacteria 2711768613 2713475756 238
427 iso_pu_bacteria 2791355137 2792838817 238
428 iso_pu_bacteria 2842348783 2842350264 238
429 iso_pu_bacteria 2842454564 2842456964 238
430 iso_pu_bacteria 2883087390 2883089452 238
431 iso_pu_bacteria 2904483920 2904486870 238
432 iso_pu_bacteria 2904615490 2904625196 238
433 iso_pu_bacteria 2919527303 2919528202 238
434 iso_pu_bacteria 2921643360 2921647920 238
435 iso_pu_bacteria 8003955200 8003960420 238
436 iso_pu_bacteria 8055301274 8055304889 238
437 3300013102 Ga0157371_10000060 Ga0157371_1000006024 239
438 3300014497 Ga0182008_10021295 Ga0182008_100212953 239
439 3300046506 Ga0495583_0000040 Ga0495583_0000040_69342_70124 239
440 3300031344 Ga0265316_10155604 Ga0265316_101556042 240
441 3300049460 Ga0495682_0021444 Ga0495682_0021444_542_1270 240
442 3300037418 Ga0395900_0086576 Ga0395900_0086576_1669_2439 241
443 3300002067 JGI24735J21928_10033472 JGI24735J21928_100334722 242
444 3300002705 JGI25156J39149_1000135 JGI25156J39149_100013513 242
445 3300002705 JGI25156J39149_1002524 JGI25156J39149_10025246 242
446 3300003214 JGI25165J46597_1001544 JGI25165J46597_10015444 242
447 3300003316 rootH1_10077531 rootH1_100775312 242
448 3300003323 rootH1_10241841 rootH1_102418413 242
449 3300003479 Ga0006556J51387_1009100 Ga0006556J51387_10091002 242
450 3300003567 Ga0006554J51385_1007915 Ga0006554J51385_10079152 242
451 3300003756 Ga0055533_1000094 Ga0055533_100009425 242
452 3300003756 Ga0055533_1000461 Ga0055533_10004617 242
453 3300003758 Ga0055532_1000003 Ga0055532_1000003216 242
454 3300003760 Ga0055527_1000006 Ga0055527_1000006239 242
455 3300003761 Ga0055535_1000003 Ga0055535_1000003216 242
456 3300003762 Ga0055542_1000007 Ga0055542_1000007216 242
457 3300003763 Ga0055529_1000003 Ga0055529_1000003239 242
458 3300005339 Ga0070660_100007686 Ga0070660_1000076863 242
459 3300005563 Ga0068855_100021533 Ga0068855_1000215333 242
460 3300005577 Ga0068857_100246062 Ga0068857_1002460622 242
461 3300005614 Ga0068856_100229033 Ga0068856_1002290333 242
462 3300009093 Ga0105240_10008982 Ga0105240_100089824 242
463 3300009093 Ga0105240_10197048 Ga0105240_101970483 242
464 3300009174 Ga0105241_10077669 Ga0105241_100776692 242
465 3300010375 Ga0105239_10006460 Ga0105239_1000646011 242
466 3300013100 Ga0157373_10005758 Ga0157373_100057583 242
467 3300013102 Ga0157371_10018306 Ga0157371_100183062 242
468 3300013104 Ga0157370_10007846 Ga0157370_100078463 242
469 3300013105 Ga0157369_10000665 Ga0157369_1000066511 242
470 3300013105 Ga0157369_10008647 Ga0157369_100086474 242
471 3300013296 Ga0157374_10000034 Ga0157374_100000343 242
472 3300013307 Ga0157372_10001753 Ga0157372_100017533 242
473 3300015261 Ga0182006_1068817 Ga0182006_10688172 242
474 3300020081 Ga0206354_10873154 Ga0206354_108731543 242
475 3300022467 Ga0224712_10062819 Ga0224712_100628193 242
476 3300025226 Ga0209674_100025 Ga0209674_100025209 242
477 3300025226 Ga0209674_100144 Ga0209674_10014490 242
478 3300025228 Ga0209672_100002 Ga0209672_1000021113 242
479 3300025228 Ga0209672_100260 Ga0209672_1002604 242
480 3300025229 Ga0209147_100003 Ga0209147_1000031113 242
481 3300025231 Ga0207427_100538 Ga0207427_10053813 242
482 3300025242 Ga0209258_100005 Ga0209258_100005755 242
483 3300025254 Ga0209148_1000006 Ga0209148_10000061113 242
484 3300025256 Ga0209759_1000008 Ga0209759_100000817 242
485 3300025256 Ga0209759_1000014 Ga0209759_1000014243 242
486 3300025256 Ga0209759_1001892 Ga0209759_100189210 242
487 3300025261 Ga0209233_1000018 Ga0209233_1000018241 242
488 3300025272 Ga0209455_1000003 Ga0209455_10000031113 242
489 3300025904 Ga0207647_10002184 Ga0207647_100021843 242
490 3300025913 Ga0207695_10012270 Ga0207695_100122704 242
491 3300025919 Ga0207657_10015047 Ga0207657_100150477 242
492 3300025949 Ga0207667_10003399 Ga0207667_100033995 242
493 3300026116 Ga0207674_10476350 Ga0207674_104763502 242
494 3300031251 Ga0265327_10002222 Ga0265327_1000222221 242
495 3300037312 Ga0395899_0000023 Ga0395899_0000023_91816_92544 242
496 3300037312 Ga0395899_0181768 Ga0395899_0181768_44_772 242
497 3300037418 Ga0395900_0000019 Ga0395900_0000019_274616_275344 242
498 3300037418 Ga0395900_0035174 Ga0395900_0035174_1920_2648 242
499 3300037418 Ga0395900_0040743 Ga0395900_0040743_3386_4114 242
500 3300037418 Ga0395900_0173812 Ga0395900_0173812_1114_1842 242
501 3300037418 Ga0395900_0192376 Ga0395900_0192376_423_1151 242
502 3300037466 Ga0395898_0000016 Ga0395898_0000016_269765_270493 242
503 3300037466 Ga0395898_0000617 Ga0395898_0000617_20508_21236 242
504 3300037466 Ga0395898_0081481 Ga0395898_0081481_1903_2631 242
505 3300037466 Ga0395898_0135579 Ga0395898_0135579_473_1201 242
506 3300037466 Ga0395898_0152806 Ga0395898_0152806_1443_2171 242
507 3300038443 Ga0395901_0000040 Ga0395901_0000040_46359_47087 242
508 3300042005 Ga0439448_0006665 Ga0439448_0006665_689_1417 242
509 3300044656 Ga0466969_0000202 Ga0466969_0000202_13811_14539 242
510 3300044656 Ga0466969_0042020 Ga0466969_0042020_670_1398 242
511 3300044656 Ga0466969_0209318 Ga0466969_0209318_55_783 242
512 3300044658 Ga0466972_0077637 Ga0466972_0077637_450_1178 242
513 3300044658 Ga0466972_0082589 Ga0466972_0082589_150_878 242
514 3300044659 Ga0466973_0085795 Ga0466973_0085795_1880_2608 242
515 3300044668 Ga0466980_0348445 Ga0466980_0348445_42_770 242
516 3300044683 Ga0466965_0000089 Ga0466965_0000089_19747_20475 242
517 3300044683 Ga0466965_0103788 Ga0466965_0103788_279_1007 242
518 3300044684 Ga0466966_0006782 Ga0466966_0006782_2494_3222 242
519 3300044684 Ga0466966_0033977 Ga0466966_0033977_1704_2432 242
520 3300044684 Ga0466966_0048965 Ga0466966_0048965_1846_2574 242
521 3300044684 Ga0466966_0070402 Ga0466966_0070402_873_1601 242
522 3300044693 Ga0466961_0000210 Ga0466961_0000210_19076_19804 242
523 3300044693 Ga0466961_0011985 Ga0466961_0011985_4788_5516 242
524 3300044694 Ga0466963_0000790 Ga0466963_0000790_10146_10874 242
525 3300044706 Ga0466964_0022094 Ga0466964_0022094_1692_2420 242
526 3300044719 Ga0466971_0001563 Ga0466971_0001563_3938_4666 242
527 3300044719 Ga0466971_0038916 Ga0466971_0038916_384_1112 242
528 3300044735 Ga0466968_0065847 Ga0466968_0065847_243_971 242
529 3300044765 Ga0466970_0045456 Ga0466970_0045456_872_1600 242
530 3300044765 Ga0466970_0058721 Ga0466970_0058721_187_915 242
531 3300044765 Ga0466970_0117257 Ga0466970_0117257_390_1118 242
532 3300044842 Ga0466957_0003063 Ga0466957_0003063_1346_2074 242
533 3300044842 Ga0466957_0028429 Ga0466957_0028429_2386_3114 242
534 3300045049 Ga0466959_0008203 Ga0466959_0008203_6101_6829 242
535 3300045049 Ga0466959_0023581 Ga0466959_0023581_1661_2389 242
536 3300045049 Ga0466959_0055074 Ga0466959_0055074_790_1518 242
537 3300045836 Ga0466958_0002949 Ga0466958_0002949_3617_4345 242
538 3300045836 Ga0466958_0013548 Ga0466958_0013548_1174_1902 242
539 3300045836 Ga0466958_0035593 Ga0466958_0035593_1987_2715 242
540 3300045836 Ga0466958_0140791 Ga0466958_0140791_737_1465 242
541 3300045836 Ga0466958_0401920 Ga0466958_0401920_118_846 242
542 3300045976 Ga0466967_1133885 Ga0466967_1133885_14_742 242
543 3300046453 Ga0495627_022371 Ga0495627_022371_291_1094 242
544 3300046454 Ga0495592_0059666 Ga0495592_0059666_1907_2635 242
545 3300046457 Ga0495590_0002585 Ga0495590_0002585_6498_7226 242
546 3300046459 Ga0495629_0061798 Ga0495629_0061798_614_1342 242
547 3300046462 Ga0495651_0313841 Ga0495651_0313841_141_869 242
548 3300046463 Ga0495653_0028590 Ga0495653_0028590_754_1482 242
549 3300046471 Ga0495650_0063550 Ga0495650_0063550_271_999 242
550 3300046472 Ga0495580_0033877 Ga0495580_0033877_806_1534 242
551 3300046473 Ga0495582_0011769 Ga0495582_0011769_271_999 242
552 3300046476 Ga0495662_0051234 Ga0495662_0051234_1248_1976 242
553 3300046477 Ga0495664_0015391 Ga0495664_0015391_1459_2187 242
554 3300046491 Ga0495584_0020273 Ga0495584_0020273_594_1397 242
555 3300046507 Ga0495606_0012274 Ga0495606_0012274_3041_3769 242
556 3300046507 Ga0495606_0086566 Ga0495606_0086566_482_1285 242
557 3300046507 Ga0495606_0195819 Ga0495606_0195819_38_766 242
558 3300046511 Ga0495608_0009278 Ga0495608_0009278_2413_3141 242
559 3300046514 Ga0495618_0007150 Ga0495618_0007150_2771_3499 242
560 3300046517 Ga0495630_0046236 Ga0495630_0046236_277_1005 242
561 3300046518 Ga0495631_0022848 Ga0495631_0022848_609_1412 242
562 3300046526 Ga0495666_0027416 Ga0495666_0027416_1322_2050 242
563 3300046529 Ga0495652_0021058 Ga0495652_0021058_615_1343 242
564 3300046531 Ga0495665_0058840 Ga0495665_0058840_152_880 242
565 3300046533 Ga0495640_0018136 Ga0495640_0018136_50_778 242
566 3300046535 Ga0495586_0025083 Ga0495586_0025083_196_924 242
567 3300046542 Ga0495597_0001101 Ga0495597_0001101_5282_6085 242
568 3300046558 Ga0495633_0024853 Ga0495633_0024853_683_1486 242
569 3300046642 Ga0495634_0088086 Ga0495634_0088086_424_1152 242
570 3300046648 Ga0495611_0063750 Ga0495611_0063750_117_920 242
571 3300046663 Ga0495635_0045937 Ga0495635_0045937_177_905 242
572 3300046675 Ga0495657_0028906 Ga0495657_0028906_50_778 242
573 3300046678 Ga0495599_0283904 Ga0495599_0283904_181_909 242
574 3300046679 Ga0495623_0043846 Ga0495623_0043846_841_1569 242
575 3300046690 Ga0495624_0031269 Ga0495624_0031269_754_1482 242
576 3300046691 Ga0495670_0036003 Ga0495670_0036003_1023_1826 242
577 3300046694 Ga0495649_0017995 Ga0495649_0017995_2206_2934 242
578 3300046694 Ga0495649_0307951 Ga0495649_0307951_21_749 242
579 3300046794 Ga0495589_0028655 Ga0495589_0028655_1377_2180 242
580 3300046809 Ga0495600_0009743 Ga0495600_0009743_348_1076 242
581 3300046810 Ga0495660_0041299 Ga0495660_0041299_1776_2504 242
582 3300047315 Ga0495581_0012435 Ga0495581_0012435_2713_3441 242
583 3300047317 Ga0495604_0061509 Ga0495604_0061509_995_1723 242
584 3300047319 Ga0495674_0070592 Ga0495674_0070592_2138_2866 242
585 3300047321 Ga0495676_0147097 Ga0495676_0147097_367_1095 242
586 3300047322 Ga0495680_0010206 Ga0495680_0010206_624_1352 242
587 3300047323 Ga0495683_0002756 Ga0495683_0002756_9494_10222 242
588 3300047443 Ga0495687_009112 Ga0495687_009112_3229_3957 242
589 3300047444 Ga0495675_0039655 Ga0495675_0039655_1277_2005 242
590 3300047445 Ga0495677_0016952 Ga0495677_0016952_967_1770 242
591 3300047472 Ga0495686_0075182 Ga0495686_0075182_966_1694 242
592 3300047673 Ga0495593_0043918 Ga0495593_0043918_175_903 242
593 3300048088 Ga0495602_0087491 Ga0495602_0087491_1503_2231 242
594 3300048088 Ga0495602_0427997 Ga0495602_0427997_23_751 242
595 3300048089 Ga0495614_0006264 Ga0495614_0006264_199_927 242
596 3300048091 Ga0495626_0056171 Ga0495626_0056171_913_1641 242
597 3300048909 Ga0496106_0000001 Ga0496106_0000001_51548_52276 242
598 3300048924 Ga0496121_0007607 Ga0496121_0007607_6747_7475 242
599 3300048924 Ga0496121_0030658 Ga0496121_0030658_1302_2030 242
600 3300048929 Ga0496126_0003259 Ga0496126_0003259_14703_15431 242
601 3300048929 Ga0496126_0005490 Ga0496126_0005490_10500_11228 242
602 3300061719 Ga0466962_0002680 Ga0466962_0002680_4941_5669 242
603 3300061719 Ga0466962_0003392 Ga0466962_0003392_2748_3476 242
604 3300046455 Ga0495603_0081700 Ga0495603_0081700_978_1745 243
605 3300046473 Ga0495582_0244996 Ga0495582_0244996_214_981 243
606 3300046492 Ga0495585_0036344 Ga0495585_0036344_1467_2234 243
607 3300046499 Ga0495594_0030296 Ga0495594_0030296_1869_2636 243
608 3300046518 Ga0495631_0021864 Ga0495631_0021864_1029_1796 243
609 3300046557 Ga0495622_0044910 Ga0495622_0044910_592_1359 243
610 3300046558 Ga0495633_0038123 Ga0495633_0038123_1052_1819 243
611 3300046691 Ga0495670_0037605 Ga0495670_0037605_706_1473 243
612 3300047318 Ga0495636_0024557 Ga0495636_0024557_1374_2141 243
613 3300047321 Ga0495676_0104862 Ga0495676_0104862_315_1082 243
614 3300046492 Ga0495585_0065103 Ga0495585_0065103_419_1216 246
615 3300046506 Ga0495583_0054424 Ga0495583_0054424_199_996 246
616 3300046507 Ga0495606_0017847 Ga0495606_0017847_2950_3747 246
617 3300046518 Ga0495631_0004791 Ga0495631_0004791_5541_6338 246
618 3300046542 Ga0495597_0035347 Ga0495597_0035347_396_1193 246
619 3300046558 Ga0495633_0032709 Ga0495633_0032709_894_1691 246
620 3300046648 Ga0495611_0036750 Ga0495611_0036750_568_1365 246
621 3300028800 Ga0265338_10000159 Ga0265338_1000015956 247
622 iso_pu_bacteria 2744054901 2746096633 247
623 3300046459 Ga0495629_0000191 Ga0495629_0000191_52262_53047 249
624 3300046463 Ga0495653_0000154 Ga0495653_0000154_52288_53073 249
625 3300046472 Ga0495580_0007361 Ga0495580_0007361_1884_2669 249
626 3300046473 Ga0495582_0218783 Ga0495582_0218783_79_864 249
627 3300046516 Ga0495628_0004139 Ga0495628_0004139_3372_4157 249
628 3300046680 Ga0495646_0003177 Ga0495646_0003177_6519_7304 249
629 3300046689 Ga0495613_0076686 Ga0495613_0076686_120_905 249
630 3300046690 Ga0495624_0036576 Ga0495624_0036576_2141_2926 249
631 3300047319 Ga0495674_0017546 Ga0495674_0017546_1884_2669 249
632 3300047321 Ga0495676_0039941 Ga0495676_0039941_972_1757 249
633 3300047673 Ga0495593_0006666 Ga0495593_0006666_2143_2928 249
634 3300048905 Ga0496102_0014645 Ga0496102_0014645_5946_6704 251
635 3300048906 Ga0496103_0010032 Ga0496103_0010032_227_985 251
636 3300048920 Ga0496117_0007991 Ga0496117_0007991_3596_4354 251
637 3300048921 Ga0496118_0001325 Ga0496118_0001325_5510_6268 251
638 iso_pu_bacteria 2738541296 2738819369 251
639 iso_pu_bacteria 2738541298 2738831848 251
640 iso_pu_bacteria 2738541306 2738873376 251
641 iso_pu_bacteria 2738543002 2739185006 251
642 iso_pu_bacteria 2738543008 2739219975 251
643 iso_pu_bacteria 2945934425 2945940383 251
644 iso_pu_bacteria 2990703756 2990707511 251
645 iso_pu_bacteria 641736151 642423952 251
646 3300001979 JGI24740J21852_10002235 JGI24740J21852_100022357 255
647 3300001989 JGI24739J22299_10008386 JGI24739J22299_100083864 255
648 3300001990 JGI24737J22298_10025014 JGI24737J22298_100250142 255
649 3300002075 JGI24738J21930_10001084 JGI24738J21930_100010843 255
650 3300005339 Ga0070660_100237756 Ga0070660_1002377562 255
651 3300014497 Ga0182008_10018154 Ga0182008_100181543 255
652 3300025904 Ga0207647_10003867 Ga0207647_100038675 255
653 3300031911 Ga0307412_10000039 Ga0307412_100000397 255
654 3300046500 Ga0495596_0029661 Ga0495596_0029661_174_941 255
655 3300046522 Ga0495643_0017730 Ga0495643_0017730_3206_3973 255
656 3300047323 Ga0495683_0024533 Ga0495683_0024533_2030_2797 255
657 3300048920 Ga0496117_0091988 Ga0496117_0091988_1157_1924 255
658 3300048921 Ga0496118_0022227 Ga0496118_0022227_4179_4946 255
659 iso_pu_bacteria 8055266321 8055272086 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

198

254

0.97

PF03472

Autoind_bind

Autoinducer binding domain

37

183

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9847 192 253
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9659 192 253
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9596 191 247
6mvn-assembly1.cif.gz_A lasr lbd l130f:3oc10hsl complex 0.9495 25 178
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9476 192 252
ID Description Score Start End Superfamily
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.985 192 252 1.10.10.10
1fseC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9847 192 253 1.10.10.10
4hyeA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9825 192 252 1.10.10.10
3sztA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9809 191 253 1.10.10.10
6cc0B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9796 191 253 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1I3PYS4-F1-model_v4 LuxR family transcriptional regulator, quorum-sensing transcription factor LasR 0.9478 11 194
AF-A0A5B0H807-F1-model_v4 LuxR family transcriptional regulator 0.9363 22 255 GO:0003677
GO:0006355
AF-A0A5B0H807-F1-model_v4 LuxR family transcriptional regulator 0.9325 22 255 GO:0003677
GO:0006355
AF-A0A7Y9WR86-F1-model_v4 LuxR family quorum-sensing transcriptional regulator LasR 0.9319 22 255 GO:0003677
GO:0006355
AF-A0A7Y9WR86-F1-model_v4 LuxR family quorum-sensing transcriptional regulator LasR 0.9282 22 255 GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
91.27 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map