F473244
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 659 | 348 | 595 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10205582|Ga0157369_102055822 |
| Length | 403 |
| Sequence | VPARLASFVLLAASATVAHAADEAASTPGADATPEKAWSFALTAYPTAVRGGEDYTSAIATADRASLHLEARYNYESIGARSAYVGWTFAGGASLALAQGKLKVAAVYTVPVEQQWVSRIHKALNEAKGRGEIEYVFSEKVANADYERVMREFAEKGNQLIVGESFAVEAAARKVAKDYPKTAFLMGSSGKPQAPNFAVFDNYIQEPAYLTGMIAGGMTKTNRIGMVGGYPIPEVNRLMHAFMAGARDVNPNVQFTVTFIGSWFDPPKAKEAAFAMIEKGADVLYAERFGVSDAAKERGKLAIGNVIDTQKDYPNTVVASALWNMEPTIDRAIAAVKSNTFKAEDYGQYSLMKNKGSELAPLGTFASKVPADLQAKVKAKEKDILDGKLKVAVVETEPKSTTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 3 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 4 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 5 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 6 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 7 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 8 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 9 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 10 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 11 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 12 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 13 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 14 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 15 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 16 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 17 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 18 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 19 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 20 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 21 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 22 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 23 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 24 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 25 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 26 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 27 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 28 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 29 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 30 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 31 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 32 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 33 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 34 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 35 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 36 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 37 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 38 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 39 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 40 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 41 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 42 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 43 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 44 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 45 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 46 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 47 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 48 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 49 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 50 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 51 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 52 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 53 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 54 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 55 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 56 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 57 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 58 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 59 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 60 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 61 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 62 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 63 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 64 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 65 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 66 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 67 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 68 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 69 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 70 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 71 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 72 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 73 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 74 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 75 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 76 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 80 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 82 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 83 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 86 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 89 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 90 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 91 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 92 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 99 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 101 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 103 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 112 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 123 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 124 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 125 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 127 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 132 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 134 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 135 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 136 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 138 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 139 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 140 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 141 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 142 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 143 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 144 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 145 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 146 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 147 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 148 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 149 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 150 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 151 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 152 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 153 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 154 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 156 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 157 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 158 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 159 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 161 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 162 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 175 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 186 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 189 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 190 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 192 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 197 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 198 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 200 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 209 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 268 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 274 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 275 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 276 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 277 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 278 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 279 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 280 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 281 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 282 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 283 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 284 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 285 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 286 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 287 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 288 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 289 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 290 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 291 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 292 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 293 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 295 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 296 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 297 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 300 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 301 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 302 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 303 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 304 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 305 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 306 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 307 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 308 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 333 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 340 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 345 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 347 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 348 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.29 |
| Metatranscriptomes | 0 |
| Isolates | 9.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.88 |
| Nodule | 1.21 |
| Rhizoplane | 2.73 |
| Rhizosphere | 63.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3784724 | 2162886007 | Bacteria | 1193 |
| 2 | JGI24752J21851_1012623 | 3300001976 | Bacteria | 1105 |
| 3 | JGI24744J21845_10010624 | 3300002077 | Bacteria | 1885 |
| 4 | JGI24742J22300_10017095 | 3300002244 | Bacteria | 1225 |
| 5 | JGI24751J29686_10011003 | 3300002459 | Bacteria | 1865 |
| 6 | JGI25155J39150_1000002 | 3300002704 | Bacteria | 292156 |
| 7 | JGI25156J39149_1000003 | 3300002705 | Bacteria | 305434 |
| 8 | JGI25154J39366_1000009 | 3300002738 | Bacteria | 305408 |
| 9 | JGI25157J39369_1000002 | 3300002741 | Bacteria | 305434 |
| 10 | JGI25159J45721_1006315 | 3300002987 | Bacteria | 3567 |
| 11 | JGI25151J46595_10000556 | 3300003187 | Bacteria | 33939 |
| 12 | JGI25151J46595_10001070 | 3300003187 | Bacteria | 20411 |
| 13 | JGI25151J46595_10009742 | 3300003187 | Bacteria | 4526 |
| 14 | JGI25151J46595_10010218 | 3300003187 | Bacteria | 4377 |
| 15 | JGI25153J46596_10001768 | 3300003215 | Bacteria | 12822 |
| 16 | JGI25153J46596_10016831 | 3300003215 | Bacteria | 2909 |
| 17 | JGI25160J50197_1000123 | 3300003354 | Bacteria | 70031 |
| 18 | JGI25160J50197_1004001 | 3300003354 | Bacteria | 6433 |
| 19 | JGI25160J50197_1010348 | 3300003354 | Bacteria | 3379 |
| 20 | JGI25161J50226_1000032 | 3300003374 | Bacteria | 138440 |
| 21 | JGI25161J50226_1005856 | 3300003374 | Bacteria | 2307 |
| 22 | Ga0055535_1001386 | 3300003761 | Bacteria | 12574 |
| 23 | Ga0055542_1000021 | 3300003762 | Bacteria | 331499 |
| 24 | Ga0055526_1002671 | 3300003771 | Bacteria | 11909 |
| 25 | Ga0055526_1009970 | 3300003771 | Bacteria | 4487 |
| 26 | Ga0055537_1001952 | 3300003773 | Bacteria | 7365 |
| 27 | Ga0055524_1000012 | 3300003775 | Bacteria | 260384 |
| 28 | Ga0055524_1000987 | 3300003775 | Bacteria | 17754 |
| 29 | Ga0055524_1010495 | 3300003775 | Bacteria | 3682 |
| 30 | Ga0055536_1000657 | 3300003781 | Bacteria | 23356 |
| 31 | Ga0055536_1001022 | 3300003781 | Bacteria | 17664 |
| 32 | Ga0055534_1001022 | 3300003784 | Bacteria | 12273 |
| 33 | Ga0055534_1005386 | 3300003784 | Bacteria | 3434 |
| 34 | Ga0055528_1007069 | 3300003790 | Bacteria | 5016 |
| 35 | Ga0055530_10000453 | 3300003791 | Bacteria | 36520 |
| 36 | Ga0055530_10000793 | 3300003791 | Bacteria | 26295 |
| 37 | Ga0055540_1000012 | 3300003792 | Bacteria | 262667 |
| 38 | Ga0055540_1003742 | 3300003792 | Bacteria | 7190 |
| 39 | Ga0055531_10002524 | 3300003794 | Bacteria | 12183 |
| 40 | Ga0055543_1000294 | 3300004625 | Bacteria | 35881 |
| 41 | Ga0065165_1018453 | 3300005262 | Bacteria | 2524 |
| 42 | Ga0065165_1028107 | 3300005262 | Bacteria | 1821 |
| 43 | Ga0065704_10079326 | 3300005289 | Bacteria | 4194 |
| 44 | Ga0065704_10169162 | 3300005289 | Bacteria | 1302 |
| 45 | Ga0065712_10207832 | 3300005290 | Bacteria | 1082 |
| 46 | Ga0065715_10281030 | 3300005293 | Bacteria | 1086 |
| 47 | Ga0070658_10196826 | 3300005327 | Bacteria | 1699 |
| 48 | Ga0070658_10345218 | 3300005327 | Bacteria | 1273 |
| 49 | Ga0070676_10009016 | 3300005328 | Bacteria | 5397 |
| 50 | Ga0070676_10057247 | 3300005328 | Bacteria | 2306 |
| 51 | Ga0070683_100016058 | 3300005329 | Bacteria | 6590 |
| 52 | Ga0070683_100038041 | 3300005329 | Bacteria | 4409 |
| 53 | Ga0070690_100106265 | 3300005330 | Bacteria | 1867 |
| 54 | Ga0070690_100194951 | 3300005330 | Bacteria | 1406 |
| 55 | Ga0070670_100007028 | 3300005331 | Bacteria | 9536 |
| 56 | Ga0070670_100008068 | 3300005331 | Bacteria | 8956 |
| 57 | Ga0070677_10013807 | 3300005333 | Bacteria | 2833 |
| 58 | Ga0068869_100006883 | 3300005334 | Bacteria | 7233 |
| 59 | Ga0068869_100009675 | 3300005334 | Bacteria | 6258 |
| 60 | Ga0068869_100014498 | 3300005334 | Bacteria | 5266 |
| 61 | Ga0070666_10036543 | 3300005335 | Bacteria | 3261 |
| 62 | Ga0068868_100080157 | 3300005338 | Bacteria | 2616 |
| 63 | Ga0068868_100105100 | 3300005338 | Bacteria | 2289 |
| 64 | Ga0068868_100112968 | 3300005338 | Bacteria | 2208 |
| 65 | Ga0068868_100184182 | 3300005338 | Bacteria | 1734 |
| 66 | Ga0070660_100024939 | 3300005339 | Bacteria | 4440 |
| 67 | Ga0070689_100108410 | 3300005340 | Bacteria | 2206 |
| 68 | Ga0070689_100307199 | 3300005340 | Bacteria | 1322 |
| 69 | Ga0070661_100052808 | 3300005344 | Bacteria | 2974 |
| 70 | Ga0070661_100317260 | 3300005344 | Bacteria | 1217 |
| 71 | Ga0070692_10024699 | 3300005345 | Bacteria | 2956 |
| 72 | Ga0070668_100037769 | 3300005347 | Bacteria | 3690 |
| 73 | Ga0070668_100060654 | 3300005347 | Bacteria | 2930 |
| 74 | Ga0070669_100018890 | 3300005353 | Bacteria | 4927 |
| 75 | Ga0070669_100079455 | 3300005353 | Bacteria | 2439 |
| 76 | Ga0070669_100091165 | 3300005353 | Bacteria | 2285 |
| 77 | Ga0070669_100117767 | 3300005353 | Bacteria | 2022 |
| 78 | Ga0070675_100001733 | 3300005354 | Bacteria | 16097 |
| 79 | Ga0070675_100014312 | 3300005354 | Bacteria | 6254 |
| 80 | Ga0070675_100028703 | 3300005354 | Bacteria | 4479 |
| 81 | Ga0070671_100004476 | 3300005355 | Bacteria | 11061 |
| 82 | Ga0070671_100013333 | 3300005355 | Bacteria | 6626 |
| 83 | Ga0070671_100068661 | 3300005355 | Bacteria | 2956 |
| 84 | Ga0070674_100005616 | 3300005356 | Bacteria | 7265 |
| 85 | Ga0070674_100057946 | 3300005356 | Bacteria | 2691 |
| 86 | Ga0070674_100126153 | 3300005356 | Bacteria | 1901 |
| 87 | Ga0070674_100206818 | 3300005356 | Bacteria | 1519 |
| 88 | Ga0070673_100009444 | 3300005364 | Bacteria | 6546 |
| 89 | Ga0070688_100046408 | 3300005365 | Bacteria | 2690 |
| 90 | Ga0070659_100085438 | 3300005366 | Bacteria | 2523 |
| 91 | Ga0070659_100228912 | 3300005366 | Bacteria | 1536 |
| 92 | Ga0070667_100016492 | 3300005367 | Bacteria | 6113 |
| 93 | Ga0070667_100241592 | 3300005367 | Bacteria | 1613 |
| 94 | Ga0070667_100276296 | 3300005367 | Bacteria | 1507 |
| 95 | Ga0070709_10247758 | 3300005434 | Bacteria | 1282 |
| 96 | Ga0070701_10016695 | 3300005438 | Bacteria | 3418 |
| 97 | Ga0070711_100224782 | 3300005439 | Bacteria | 1461 |
| 98 | Ga0070705_100220159 | 3300005440 | Bacteria | 1314 |
| 99 | Ga0070700_100012190 | 3300005441 | Bacteria | 4788 |
| 100 | Ga0070663_100010823 | 3300005455 | Bacteria | 5698 |
| 101 | Ga0070678_100008501 | 3300005456 | Bacteria | 6149 |
| 102 | Ga0070678_100013926 | 3300005456 | Bacteria | 5057 |
| 103 | Ga0070678_100068917 | 3300005456 | Bacteria | 2639 |
| 104 | Ga0070678_100081283 | 3300005456 | Bacteria | 2456 |
| 105 | Ga0070678_100176557 | 3300005456 | Bacteria | 1745 |
| 106 | Ga0070662_100007540 | 3300005457 | Bacteria | 7060 |
| 107 | Ga0070662_100016060 | 3300005457 | Bacteria | 5022 |
| 108 | Ga0070662_100071446 | 3300005457 | Bacteria | 2559 |
| 109 | Ga0070681_10036162 | 3300005458 | Bacteria | 4961 |
| 110 | Ga0068867_100005155 | 3300005459 | Bacteria | 9226 |
| 111 | Ga0068867_100021447 | 3300005459 | Bacteria | 4609 |
| 112 | Ga0068867_100068017 | 3300005459 | Bacteria | 2657 |
| 113 | Ga0070685_10008963 | 3300005466 | Bacteria | 5159 |
| 114 | Ga0070684_100005497 | 3300005535 | Bacteria | 9714 |
| 115 | Ga0068853_100096607 | 3300005539 | Bacteria | 2607 |
| 116 | Ga0068853_100354329 | 3300005539 | Bacteria | 1366 |
| 117 | Ga0070672_100004667 | 3300005543 | Bacteria | 8984 |
| 118 | Ga0070672_100010425 | 3300005543 | Bacteria | 6449 |
| 119 | Ga0070695_100177467 | 3300005545 | Bacteria | 1507 |
| 120 | Ga0070693_100047331 | 3300005547 | Bacteria | 2447 |
| 121 | Ga0070665_100203426 | 3300005548 | Bacteria | 1980 |
| 122 | Ga0068855_100140928 | 3300005563 | Bacteria | 2748 |
| 123 | Ga0070664_100005648 | 3300005564 | Bacteria | 10071 |
| 124 | Ga0070664_100203650 | 3300005564 | Bacteria | 1767 |
| 125 | Ga0068857_100051888 | 3300005577 | Bacteria | 3640 |
| 126 | Ga0068857_100133759 | 3300005577 | Bacteria | 2238 |
| 127 | Ga0068854_100013238 | 3300005578 | Bacteria | 5407 |
| 128 | Ga0068856_100107344 | 3300005614 | Bacteria | 2787 |
| 129 | Ga0070702_100032707 | 3300005615 | Bacteria | 2855 |
| 130 | Ga0068852_100043337 | 3300005616 | Bacteria | 3816 |
| 131 | Ga0068852_100162799 | 3300005616 | Bacteria | 2084 |
| 132 | Ga0068859_100046409 | 3300005617 | Bacteria | 4362 |
| 133 | Ga0068859_100291338 | 3300005617 | Bacteria | 1725 |
| 134 | Ga0068864_100002200 | 3300005618 | Bacteria | 16087 |
| 135 | Ga0068864_100045661 | 3300005618 | Bacteria | 3758 |
| 136 | Ga0068864_100059378 | 3300005618 | Bacteria | 3309 |
| 137 | Ga0068864_100089148 | 3300005618 | Bacteria | 2717 |
| 138 | Ga0068864_100153517 | 3300005618 | Bacteria | 2088 |
| 139 | Ga0068864_100242456 | 3300005618 | Bacteria | 1670 |
| 140 | Ga0068866_10031509 | 3300005718 | Bacteria | 2555 |
| 141 | Ga0068861_100002547 | 3300005719 | Bacteria | 11913 |
| 142 | Ga0068861_100095858 | 3300005719 | Bacteria | 2350 |
| 143 | Ga0068861_100265810 | 3300005719 | Bacteria | 1471 |
| 144 | Ga0068870_10150193 | 3300005840 | Bacteria | 1371 |
| 145 | Ga0068863_100002680 | 3300005841 | Bacteria | 17598 |
| 146 | Ga0068863_100022184 | 3300005841 | Bacteria | 6061 |
| 147 | Ga0068863_100054985 | 3300005841 | Bacteria | 3770 |
| 148 | Ga0068858_100018789 | 3300005842 | Bacteria | 6466 |
| 149 | Ga0068858_100057687 | 3300005842 | Bacteria | 3588 |
| 150 | Ga0068858_100108207 | 3300005842 | Bacteria | 2595 |
| 151 | Ga0068860_100004285 | 3300005843 | Bacteria | 14582 |
| 152 | Ga0068860_100100333 | 3300005843 | Bacteria | 2762 |
| 153 | Ga0068860_100102229 | 3300005843 | Bacteria | 2735 |
| 154 | Ga0068860_100145104 | 3300005843 | Bacteria | 2283 |
| 155 | Ga0068860_100235221 | 3300005843 | Bacteria | 1781 |
| 156 | Ga0068862_100011044 | 3300005844 | Bacteria | 7459 |
| 157 | Ga0068862_100011483 | 3300005844 | Bacteria | 7312 |
| 158 | Ga0068862_100038440 | 3300005844 | Bacteria | 4059 |
| 159 | Ga0068862_100072612 | 3300005844 | Bacteria | 2973 |
| 160 | Ga0068862_100090846 | 3300005844 | Bacteria | 2659 |
| 161 | Ga0068862_100250020 | 3300005844 | Bacteria | 1615 |
| 162 | Ga0068862_100326014 | 3300005844 | Bacteria | 1419 |
| 163 | Ga0081455_10128564 | 3300005937 | Bacteria | 1984 |
| 164 | Ga0081455_10236012 | 3300005937 | Bacteria | 1346 |
| 165 | Ga0075368_10074870 | 3300006042 | Bacteria | 1372 |
| 166 | Ga0075363_100006291 | 3300006048 | Bacteria | 5378 |
| 167 | Ga0070712_100014780 | 3300006175 | Bacteria | 5015 |
| 168 | Ga0075362_10018253 | 3300006177 | Bacteria | 2899 |
| 169 | Ga0075362_10050113 | 3300006177 | Bacteria | 1866 |
| 170 | Ga0075367_10002951 | 3300006178 | Bacteria | 7945 |
| 171 | Ga0075366_10008599 | 3300006195 | Bacteria | 5684 |
| 172 | Ga0075366_10018117 | 3300006195 | Bacteria | 4066 |
| 173 | Ga0075366_10073340 | 3300006195 | Bacteria | 2040 |
| 174 | Ga0097621_100017078 | 3300006237 | Bacteria | 5504 |
| 175 | Ga0097621_100074079 | 3300006237 | Bacteria | 2819 |
| 176 | Ga0097621_100108313 | 3300006237 | Bacteria | 2345 |
| 177 | Ga0097621_100135946 | 3300006237 | Bacteria | 2097 |
| 178 | Ga0075370_10000581 | 3300006353 | Bacteria | 14080 |
| 179 | Ga0075370_10003631 | 3300006353 | Bacteria | 7384 |
| 180 | Ga0075370_10007859 | 3300006353 | Bacteria | 5457 |
| 181 | Ga0075370_10011390 | 3300006353 | Bacteria | 4670 |
| 182 | Ga0075370_10028017 | 3300006353 | Bacteria | 3129 |
| 183 | Ga0075370_10029780 | 3300006353 | Bacteria | 3042 |
| 184 | Ga0075370_10127413 | 3300006353 | Bacteria | 1484 |
| 185 | Ga0068871_100005755 | 3300006358 | Bacteria | 8703 |
| 186 | Ga0068871_100011783 | 3300006358 | Bacteria | 6425 |
| 187 | Ga0068871_100032087 | 3300006358 | Bacteria | 4145 |
| 188 | Ga0068871_100063833 | 3300006358 | Bacteria | 3013 |
| 189 | Ga0068871_100086507 | 3300006358 | Bacteria | 2604 |
| 190 | Ga0075434_100369756 | 3300006871 | Bacteria | 1455 |
| 191 | Ga0068865_100020605 | 3300006881 | Bacteria | 4277 |
| 192 | Ga0068865_100023958 | 3300006881 | Bacteria | 4001 |
| 193 | Ga0097620_100046408 | 3300006931 | Bacteria | 4362 |
| 194 | Ga0097620_100189034 | 3300006931 | Bacteria | 2143 |
| 195 | Ga0097620_100291337 | 3300006931 | Bacteria | 1725 |
| 196 | Ga0099826_10000027 | 3300006948 | Bacteria | 140533 |
| 197 | Ga0099794_10020874 | 3300007265 | Bacteria | 2969 |
| 198 | Ga0105251_10024824 | 3300009011 | Bacteria | 3074 |
| 199 | Ga0105244_10000965 | 3300009036 | Bacteria | 24157 |
| 200 | Ga0105240_10013158 | 3300009093 | Bacteria | 11383 |
| 201 | Ga0105240_10356268 | 3300009093 | Bacteria | 1659 |
| 202 | Ga0105240_10440104 | 3300009093 | Bacteria | 1461 |
| 203 | Ga0111539_10033508 | 3300009094 | Bacteria | 6237 |
| 204 | Ga0105245_10012088 | 3300009098 | Bacteria | 7507 |
| 205 | Ga0105245_10037607 | 3300009098 | Bacteria | 4303 |
| 206 | Ga0105247_10198224 | 3300009101 | Bacteria | 1347 |
| 207 | Ga0105243_10001233 | 3300009148 | Bacteria | 23051 |
| 208 | Ga0105243_10004695 | 3300009148 | Bacteria | 10755 |
| 209 | Ga0105243_10017874 | 3300009148 | Bacteria | 5365 |
| 210 | Ga0105243_10093995 | 3300009148 | Bacteria | 2475 |
| 211 | Ga0105243_10152568 | 3300009148 | Bacteria | 1983 |
| 212 | Ga0105243_10226000 | 3300009148 | Bacteria | 1657 |
| 213 | Ga0105241_10010537 | 3300009174 | Bacteria | 6782 |
| 214 | Ga0105242_10025996 | 3300009176 | Bacteria | 4636 |
| 215 | Ga0105242_10121024 | 3300009176 | Bacteria | 2246 |
| 216 | Ga0105248_10022102 | 3300009177 | Bacteria | 7049 |
| 217 | Ga0105248_10083235 | 3300009177 | Bacteria | 3599 |
| 218 | Ga0105248_10404995 | 3300009177 | Bacteria | 1536 |
| 219 | Ga0105237_10001628 | 3300009545 | Bacteria | 29150 |
| 220 | Ga0105237_10011624 | 3300009545 | Bacteria | 9318 |
| 221 | Ga0105237_10014335 | 3300009545 | Bacteria | 8297 |
| 222 | Ga0105237_10063747 | 3300009545 | Bacteria | 3683 |
| 223 | Ga0105237_10080165 | 3300009545 | Bacteria | 3255 |
| 224 | Ga0105237_10454120 | 3300009545 | Bacteria | 1287 |
| 225 | Ga0105249_10009786 | 3300009553 | Bacteria | 8399 |
| 226 | Ga0105033_100704 | 3300009986 | Bacteria | 2590 |
| 227 | Ga0105239_10001684 | 3300010375 | Bacteria | 29148 |
| 228 | Ga0105239_10094552 | 3300010375 | Bacteria | 3301 |
| 229 | Ga0105239_10194616 | 3300010375 | Bacteria | 2270 |
| 230 | Ga0105239_10231109 | 3300010375 | Bacteria | 2075 |
| 231 | Ga0105239_10483842 | 3300010375 | Bacteria | 1406 |
| 232 | Ga0157373_10027700 | 3300013100 | Bacteria | 4088 |
| 233 | Ga0157373_10042400 | 3300013100 | Bacteria | 3252 |
| 234 | Ga0157371_10037766 | 3300013102 | Bacteria | 3456 |
| 235 | Ga0157371_10086060 | 3300013102 | Bacteria | 2226 |
| 236 | Ga0157369_10002311 | 3300013105 | Bacteria | 22944 |
| 237 | Ga0157369_10205582 | 3300013105 | Bacteria | 2065 |
| 238 | Ga0157374_10133683 | 3300013296 | Bacteria | 2402 |
| 239 | Ga0157378_10004470 | 3300013297 | Bacteria | 12280 |
| 240 | Ga0157378_10011046 | 3300013297 | Bacteria | 7903 |
| 241 | Ga0157378_10014904 | 3300013297 | Bacteria | 6802 |
| 242 | Ga0163162_10008437 | 3300013306 | Bacteria | 10048 |
| 243 | Ga0163162_10239580 | 3300013306 | Bacteria | 1945 |
| 244 | Ga0157375_10020725 | 3300013308 | Bacteria | 6014 |
| 245 | Ga0157375_10073262 | 3300013308 | Bacteria | 3444 |
| 246 | Ga0157375_10085470 | 3300013308 | Bacteria | 3204 |
| 247 | Ga0157375_10316262 | 3300013308 | Bacteria | 1726 |
| 248 | Ga0163163_10009364 | 3300014325 | Bacteria | 8742 |
| 249 | Ga0163163_10010625 | 3300014325 | Bacteria | 8294 |
| 250 | Ga0163163_10096759 | 3300014325 | Bacteria | 2973 |
| 251 | Ga0163163_10436417 | 3300014325 | Bacteria | 1369 |
| 252 | Ga0157380_10039361 | 3300014326 | Bacteria | 3676 |
| 253 | Ga0157380_10087180 | 3300014326 | Bacteria | 2566 |
| 254 | Ga0157380_10087811 | 3300014326 | Bacteria | 2557 |
| 255 | Ga0157380_10120306 | 3300014326 | Bacteria | 2223 |
| 256 | Ga0157380_10158652 | 3300014326 | Bacteria | 1963 |
| 257 | Ga0182008_10022139 | 3300014497 | Bacteria | 3255 |
| 258 | Ga0182008_10026570 | 3300014497 | Bacteria | 2936 |
| 259 | Ga0157379_10006962 | 3300014968 | Bacteria | 9778 |
| 260 | Ga0157379_10011595 | 3300014968 | Bacteria | 7697 |
| 261 | Ga0157379_10017722 | 3300014968 | Bacteria | 6274 |
| 262 | Ga0157379_10056850 | 3300014968 | Bacteria | 3496 |
| 263 | Ga0157376_10008524 | 3300014969 | Bacteria | 7404 |
| 264 | Ga0157376_10079954 | 3300014969 | Bacteria | 2803 |
| 265 | Ga0182006_1001032 | 3300015261 | Bacteria | 18152 |
| 266 | Ga0182007_10000366 | 3300015262 | Bacteria | 28535 |
| 267 | Ga0163161_10001014 | 3300017792 | Bacteria | 21406 |
| 268 | Ga0163161_10013132 | 3300017792 | Bacteria | 5757 |
| 269 | Ga0163161_10016219 | 3300017792 | Bacteria | 5199 |
| 270 | Ga0163161_10268497 | 3300017792 | Bacteria | 1334 |
| 271 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 272 | Ga0209436_105668 | 3300025208 | Bacteria | 2831 |
| 273 | Ga0209147_101220 | 3300025229 | Bacteria | 10252 |
| 274 | Ga0209258_100058 | 3300025242 | Bacteria | 331567 |
| 275 | Ga0207425_1002090 | 3300025245 | Bacteria | 7399 |
| 276 | Ga0207425_1008428 | 3300025245 | Bacteria | 2639 |
| 277 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 278 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 279 | Ga0209148_1000071 | 3300025254 | Bacteria | 331551 |
| 280 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 281 | Ga0209129_1005627 | 3300025258 | Bacteria | 4355 |
| 282 | Ga0209129_1006005 | 3300025258 | Bacteria | 4078 |
| 283 | Ga0209129_1006848 | 3300025258 | Bacteria | 3557 |
| 284 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 285 | Ga0209565_1000840 | 3300025263 | Bacteria | 17373 |
| 286 | Ga0209565_1005531 | 3300025263 | Bacteria | 3653 |
| 287 | Ga0209565_1006363 | 3300025263 | Bacteria | 3320 |
| 288 | Ga0209673_1000066 | 3300025273 | Bacteria | 250037 |
| 289 | Ga0209673_1000074 | 3300025273 | Bacteria | 233552 |
| 290 | Ga0209130_1000050 | 3300025284 | Bacteria | 222092 |
| 291 | Ga0209130_1000082 | 3300025284 | Bacteria | 164441 |
| 292 | Ga0209130_1000625 | 3300025284 | Bacteria | 33527 |
| 293 | Ga0209130_1000816 | 3300025284 | Bacteria | 26299 |
| 294 | Ga0209130_1004224 | 3300025284 | Bacteria | 5591 |
| 295 | Ga0207673_1001090 | 3300025290 | Bacteria | 2926 |
| 296 | Ga0209675_1001153 | 3300025291 | Bacteria | 16079 |
| 297 | Ga0209675_1001253 | 3300025291 | Bacteria | 15226 |
| 298 | Ga0209675_1006841 | 3300025291 | Bacteria | 4495 |
| 299 | Ga0209675_1008946 | 3300025291 | Bacteria | 3600 |
| 300 | Ga0209675_1026318 | 3300025291 | Bacteria | 1449 |
| 301 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 302 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 303 | Ga0209676_1007573 | 3300025292 | Bacteria | 5055 |
| 304 | Ga0209025_1000351 | 3300025294 | Bacteria | 99585 |
| 305 | Ga0209025_1000750 | 3300025294 | Bacteria | 54523 |
| 306 | Ga0209025_1000766 | 3300025294 | Bacteria | 53411 |
| 307 | Ga0209025_1001156 | 3300025294 | Bacteria | 37386 |
| 308 | Ga0209025_1002301 | 3300025294 | Bacteria | 20715 |
| 309 | Ga0209025_1003418 | 3300025294 | Bacteria | 15061 |
| 310 | Ga0209025_1014059 | 3300025294 | Bacteria | 4967 |
| 311 | Ga0209025_1017671 | 3300025294 | Bacteria | 4098 |
| 312 | Ga0209025_1039234 | 3300025294 | Bacteria | 2069 |
| 313 | Ga0209564_1000090 | 3300025295 | Bacteria | 249298 |
| 314 | Ga0209564_1001244 | 3300025295 | Bacteria | 28537 |
| 315 | Ga0209564_1001617 | 3300025295 | Bacteria | 21862 |
| 316 | Ga0209758_1000249 | 3300025297 | Bacteria | 110026 |
| 317 | Ga0209758_1008491 | 3300025297 | Bacteria | 6631 |
| 318 | Ga0209758_1025030 | 3300025297 | Bacteria | 2635 |
| 319 | Ga0209758_1057641 | 3300025297 | Bacteria | 1304 |
| 320 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 321 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 322 | Ga0209050_1004456 | 3300025298 | Bacteria | 9447 |
| 323 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 324 | Ga0209256_1000022 | 3300025299 | Bacteria | 481843 |
| 325 | Ga0209256_1000127 | 3300025299 | Bacteria | 164393 |
| 326 | Ga0209256_1001660 | 3300025299 | Bacteria | 21630 |
| 327 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 328 | Ga0207426_1000071 | 3300025302 | Bacteria | 329539 |
| 329 | Ga0207426_1000336 | 3300025302 | Bacteria | 88370 |
| 330 | Ga0207426_1002464 | 3300025302 | Bacteria | 11778 |
| 331 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 332 | Ga0209051_1000036 | 3300025303 | Bacteria | 339863 |
| 333 | Ga0209051_1000542 | 3300025303 | Bacteria | 46577 |
| 334 | Ga0209051_1011223 | 3300025303 | Bacteria | 4444 |
| 335 | Ga0209051_1031858 | 3300025303 | Bacteria | 2022 |
| 336 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 337 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 338 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 339 | Ga0209257_1011452 | 3300025304 | Bacteria | 4269 |
| 340 | Ga0207697_10000857 | 3300025315 | Bacteria | 17209 |
| 341 | Ga0207697_10030381 | 3300025315 | Bacteria | 2211 |
| 342 | Ga0207697_10072477 | 3300025315 | Bacteria | 1444 |
| 343 | Ga0207656_10005144 | 3300025321 | Bacteria | 4598 |
| 344 | Ga0207656_10007254 | 3300025321 | Bacteria | 4027 |
| 345 | Ga0207655_1008917 | 3300025728 | Bacteria | 6296 |
| 346 | Ga0207682_10000120 | 3300025893 | Bacteria | 36172 |
| 347 | Ga0207682_10043131 | 3300025893 | Bacteria | 1845 |
| 348 | Ga0207642_10020166 | 3300025899 | Bacteria | 2597 |
| 349 | Ga0207688_10120342 | 3300025901 | Bacteria | 1532 |
| 350 | Ga0207680_10065967 | 3300025903 | Bacteria | 2224 |
| 351 | Ga0207680_10068843 | 3300025903 | Bacteria | 2185 |
| 352 | Ga0207645_10001475 | 3300025907 | Bacteria | 19229 |
| 353 | Ga0207645_10080294 | 3300025907 | Bacteria | 2091 |
| 354 | Ga0207643_10000681 | 3300025908 | Bacteria | 21214 |
| 355 | Ga0207643_10002912 | 3300025908 | Bacteria | 9244 |
| 356 | Ga0207705_10030042 | 3300025909 | Bacteria | 3876 |
| 357 | Ga0207654_10066265 | 3300025911 | Bacteria | 2129 |
| 358 | Ga0207707_10043109 | 3300025912 | Bacteria | 3937 |
| 359 | Ga0207695_10020847 | 3300025913 | Bacteria | 7492 |
| 360 | Ga0207695_10318030 | 3300025913 | Bacteria | 1446 |
| 361 | Ga0207695_10328361 | 3300025913 | Bacteria | 1418 |
| 362 | Ga0207671_10001800 | 3300025914 | Bacteria | 23963 |
| 363 | Ga0207671_10035768 | 3300025914 | Bacteria | 3683 |
| 364 | Ga0207671_10143976 | 3300025914 | Bacteria | 1838 |
| 365 | Ga0207660_10142588 | 3300025917 | Bacteria | 1833 |
| 366 | Ga0207662_10004254 | 3300025918 | Bacteria | 7509 |
| 367 | Ga0207657_10005234 | 3300025919 | Bacteria | 13591 |
| 368 | Ga0207649_10021763 | 3300025920 | Bacteria | 3697 |
| 369 | Ga0207649_10215899 | 3300025920 | Bacteria | 1363 |
| 370 | Ga0207681_10023616 | 3300025923 | Bacteria | 3935 |
| 371 | Ga0207681_10061746 | 3300025923 | Bacteria | 2577 |
| 372 | Ga0207650_10002722 | 3300025925 | Bacteria | 12201 |
| 373 | Ga0207650_10003389 | 3300025925 | Bacteria | 10964 |
| 374 | Ga0207650_10009669 | 3300025925 | Bacteria | 6592 |
| 375 | Ga0207650_10029364 | 3300025925 | Bacteria | 3953 |
| 376 | Ga0207650_10071477 | 3300025925 | Bacteria | 2610 |
| 377 | Ga0207659_10000256 | 3300025926 | Bacteria | 32624 |
| 378 | Ga0207659_10009618 | 3300025926 | Bacteria | 6047 |
| 379 | Ga0207659_10073521 | 3300025926 | Bacteria | 2503 |
| 380 | Ga0207687_10053653 | 3300025927 | Bacteria | 2817 |
| 381 | Ga0207687_10163090 | 3300025927 | Bacteria | 1712 |
| 382 | Ga0207687_10185564 | 3300025927 | Bacteria | 1614 |
| 383 | Ga0207644_10004912 | 3300025931 | Bacteria | 8716 |
| 384 | Ga0207644_10008335 | 3300025931 | Bacteria | 6792 |
| 385 | Ga0207644_10021303 | 3300025931 | Bacteria | 4414 |
| 386 | Ga0207644_10094604 | 3300025931 | Bacteria | 2232 |
| 387 | Ga0207644_10252643 | 3300025931 | Bacteria | 1407 |
| 388 | Ga0207706_10000850 | 3300025933 | Bacteria | 31426 |
| 389 | Ga0207706_10005242 | 3300025933 | Bacteria | 12091 |
| 390 | Ga0207706_10170700 | 3300025933 | Bacteria | 1911 |
| 391 | Ga0207686_10059632 | 3300025934 | Bacteria | 2412 |
| 392 | Ga0207686_10171067 | 3300025934 | Bacteria | 1532 |
| 393 | Ga0207686_10314153 | 3300025934 | Bacteria | 1168 |
| 394 | Ga0207709_10003703 | 3300025935 | Bacteria | 9001 |
| 395 | Ga0207709_10011257 | 3300025935 | Bacteria | 4935 |
| 396 | Ga0207709_10047480 | 3300025935 | Bacteria | 2611 |
| 397 | Ga0207709_10093251 | 3300025935 | Bacteria | 1974 |
| 398 | Ga0207709_10121303 | 3300025935 | Bacteria | 1765 |
| 399 | Ga0207670_10051220 | 3300025936 | Bacteria | 2771 |
| 400 | Ga0207669_10008390 | 3300025937 | Bacteria | 4847 |
| 401 | Ga0207669_10055448 | 3300025937 | Bacteria | 2400 |
| 402 | Ga0207704_10018726 | 3300025938 | Bacteria | 3621 |
| 403 | Ga0207704_10040711 | 3300025938 | Bacteria | 2718 |
| 404 | Ga0207704_10084488 | 3300025938 | Bacteria | 2063 |
| 405 | Ga0207691_10000360 | 3300025940 | Bacteria | 45895 |
| 406 | Ga0207691_10000773 | 3300025940 | Bacteria | 31657 |
| 407 | Ga0207691_10009293 | 3300025940 | Bacteria | 9434 |
| 408 | Ga0207691_10020172 | 3300025940 | Bacteria | 6305 |
| 409 | Ga0207711_10066931 | 3300025941 | Bacteria | 3108 |
| 410 | Ga0207689_10000307 | 3300025942 | Bacteria | 45007 |
| 411 | Ga0207689_10001301 | 3300025942 | Bacteria | 24043 |
| 412 | Ga0207689_10009368 | 3300025942 | Bacteria | 8462 |
| 413 | Ga0207661_10017959 | 3300025944 | Bacteria | 5248 |
| 414 | Ga0207661_10275474 | 3300025944 | Bacteria | 1502 |
| 415 | Ga0207679_10009175 | 3300025945 | Bacteria | 6325 |
| 416 | Ga0207679_10015100 | 3300025945 | Bacteria | 5093 |
| 417 | Ga0207679_10019703 | 3300025945 | Bacteria | 4539 |
| 418 | Ga0207651_10023043 | 3300025960 | Bacteria | 3821 |
| 419 | Ga0207651_10118548 | 3300025960 | Bacteria | 2002 |
| 420 | Ga0207712_10010255 | 3300025961 | Bacteria | 5944 |
| 421 | Ga0207668_10009980 | 3300025972 | Bacteria | 5714 |
| 422 | Ga0207668_10096144 | 3300025972 | Bacteria | 2188 |
| 423 | Ga0207640_10067975 | 3300025981 | Bacteria | 2386 |
| 424 | Ga0207640_10078491 | 3300025981 | Bacteria | 2247 |
| 425 | Ga0207658_10090649 | 3300025986 | Bacteria | 2370 |
| 426 | Ga0207658_10092294 | 3300025986 | Bacteria | 2351 |
| 427 | Ga0207658_10130220 | 3300025986 | Bacteria | 2020 |
| 428 | Ga0207677_10057250 | 3300026023 | Bacteria | 2675 |
| 429 | Ga0207677_10069942 | 3300026023 | Bacteria | 2471 |
| 430 | Ga0207677_10090162 | 3300026023 | Bacteria | 2227 |
| 431 | Ga0207677_10243055 | 3300026023 | Bacteria | 1457 |
| 432 | Ga0207703_10026771 | 3300026035 | Bacteria | 4543 |
| 433 | Ga0207703_10128445 | 3300026035 | Bacteria | 2185 |
| 434 | Ga0207639_10107710 | 3300026041 | Bacteria | 2264 |
| 435 | Ga0207639_10181887 | 3300026041 | Bacteria | 1789 |
| 436 | Ga0207678_10001655 | 3300026067 | Bacteria | 20422 |
| 437 | Ga0207708_10000529 | 3300026075 | Bacteria | 29463 |
| 438 | Ga0207702_10246674 | 3300026078 | Bacteria | 1675 |
| 439 | Ga0207641_10008475 | 3300026088 | Bacteria | 8497 |
| 440 | Ga0207641_10063711 | 3300026088 | Bacteria | 3149 |
| 441 | Ga0207648_10002743 | 3300026089 | Bacteria | 18714 |
| 442 | Ga0207648_10003420 | 3300026089 | Bacteria | 16668 |
| 443 | Ga0207648_10009516 | 3300026089 | Bacteria | 9298 |
| 444 | Ga0207648_10010728 | 3300026089 | Bacteria | 8661 |
| 445 | Ga0207648_10023605 | 3300026089 | Bacteria | 5506 |
| 446 | Ga0207648_10099845 | 3300026089 | Bacteria | 2542 |
| 447 | Ga0207676_10018219 | 3300026095 | Bacteria | 5100 |
| 448 | Ga0207676_10037987 | 3300026095 | Bacteria | 3673 |
| 449 | Ga0207676_10062352 | 3300026095 | Bacteria | 2957 |
| 450 | Ga0207676_10082436 | 3300026095 | Bacteria | 2616 |
| 451 | Ga0207676_10267560 | 3300026095 | Bacteria | 1546 |
| 452 | Ga0207674_10003249 | 3300026116 | Bacteria | 20002 |
| 453 | Ga0207674_10020383 | 3300026116 | Bacteria | 7164 |
| 454 | Ga0207674_10050112 | 3300026116 | Bacteria | 4267 |
| 455 | Ga0207674_10093743 | 3300026116 | Bacteria | 2990 |
| 456 | Ga0207675_100008033 | 3300026118 | Bacteria | 9941 |
| 457 | Ga0207675_100024821 | 3300026118 | Bacteria | 5578 |
| 458 | Ga0207675_100058990 | 3300026118 | Bacteria | 3582 |
| 459 | Ga0207675_100331927 | 3300026118 | Bacteria | 1487 |
| 460 | Ga0207683_10002951 | 3300026121 | Bacteria | 14839 |
| 461 | Ga0207683_10010884 | 3300026121 | Bacteria | 7760 |
| 462 | Ga0207683_10036681 | 3300026121 | Bacteria | 4270 |
| 463 | Ga0207683_10041187 | 3300026121 | Bacteria | 4032 |
| 464 | Ga0207683_10045801 | 3300026121 | Bacteria | 3826 |
| 465 | Ga0207683_10062761 | 3300026121 | Bacteria | 3273 |
| 466 | Ga0207698_10016839 | 3300026142 | Bacteria | 4940 |
| 467 | Ga0209282_1000069 | 3300027666 | Bacteria | 85661 |
| 468 | Ga0209282_1089479 | 3300027666 | Bacteria | 1617 |
| 469 | Ga0209588_1067968 | 3300027671 | Bacteria | 1151 |
| 470 | Ga0209813_10007684 | 3300027866 | Bacteria | 2693 |
| 471 | Ga0268266_10127158 | 3300028379 | Bacteria | 2275 |
| 472 | Ga0268266_10211875 | 3300028379 | Bacteria | 1777 |
| 473 | Ga0268265_10015157 | 3300028380 | Bacteria | 5268 |
| 474 | Ga0268265_10046919 | 3300028380 | Bacteria | 3232 |
| 475 | Ga0268265_10083964 | 3300028380 | Bacteria | 2523 |
| 476 | Ga0268265_10168443 | 3300028380 | Bacteria | 1869 |
| 477 | Ga0268265_10307731 | 3300028380 | Bacteria | 1429 |
| 478 | Ga0268264_10017548 | 3300028381 | Bacteria | 5862 |
| 479 | Ga0268264_10022650 | 3300028381 | Bacteria | 5126 |
| 480 | Ga0268264_10124353 | 3300028381 | Bacteria | 2277 |
| 481 | Ga0268264_10129384 | 3300028381 | Bacteria | 2236 |
| 482 | Ga0268264_10129464 | 3300028381 | Bacteria | 2235 |
| 483 | Ga0307515_10000267 | 3300028794 | Bacteria | 128554 |
| 484 | Ga0307515_10000283 | 3300028794 | Bacteria | 124822 |
| 485 | Ga0307515_10102505 | 3300028794 | Bacteria | 3441 |
| 486 | Ga0307515_10156619 | 3300028794 | Bacteria | 2347 |
| 487 | Ga0307515_10182241 | 3300028794 | Bacteria | 2045 |
| 488 | Ga0307515_10201866 | 3300028794 | Bacteria | 1861 |
| 489 | Ga0307512_10051832 | 3300030522 | Bacteria | 3279 |
| 490 | Ga0316176_1111959 | 3300030732 | Bacteria | 1865 |
| 491 | Ga0314311_1018953 | 3300030733 | Bacteria | 4042 |
| 492 | Ga0316183_1163725 | 3300030742 | Bacteria | 4721 |
| 493 | Ga0316181_1083351 | 3300030744 | Bacteria | 6292 |
| 494 | Ga0307513_10000019 | 3300031456 | Bacteria | 231194 |
| 495 | Ga0307513_10000051 | 3300031456 | Bacteria | 149733 |
| 496 | Ga0307513_10013784 | 3300031456 | Bacteria | 9912 |
| 497 | Ga0307513_10210027 | 3300031456 | Bacteria | 1779 |
| 498 | Ga0307513_10324869 | 3300031456 | Bacteria | 1295 |
| 499 | Ga0307408_100036080 | 3300031548 | Bacteria | 3473 |
| 500 | Ga0307408_100112537 | 3300031548 | Bacteria | 2093 |
| 501 | Ga0307508_10000876 | 3300031616 | Bacteria | 35008 |
| 502 | Ga0307508_10001111 | 3300031616 | Bacteria | 31133 |
| 503 | Ga0307508_10016840 | 3300031616 | Bacteria | 6650 |
| 504 | Ga0307514_10000806 | 3300031649 | Bacteria | 51095 |
| 505 | Ga0307516_10037208 | 3300031730 | Bacteria | 4866 |
| 506 | Ga0307410_10016709 | 3300031852 | Bacteria | 4386 |
| 507 | Ga0307406_10006998 | 3300031901 | Bacteria | 6244 |
| 508 | Ga0307407_10134193 | 3300031903 | Bacteria | 1588 |
| 509 | Ga0307412_10008248 | 3300031911 | Bacteria | 5939 |
| 510 | Ga0307412_10085387 | 3300031911 | Bacteria | 2193 |
| 511 | Ga0307416_100031041 | 3300032002 | Bacteria | 4018 |
| 512 | Ga0307414_10011968 | 3300032004 | Bacteria | 5115 |
| 513 | Ga0307414_10115575 | 3300032004 | Bacteria | 2052 |
| 514 | Ga0307411_10015798 | 3300032005 | Bacteria | 4253 |
| 515 | Ga0307507_10050320 | 3300033179 | Bacteria | 4024 |
| 516 | Ga0307507_10066708 | 3300033179 | Bacteria | 3296 |
| 517 | Ga0373954_0107382 | 3300035118 | Bacteria | 1349 |
| 518 | Ga0373955_0213183 | 3300035172 | Bacteria | 1152 |
| 519 | Ga0373927_0046506 | 3300035695 | Bacteria | 2808 |
| 520 | Ga0373933_0092230 | 3300035724 | Bacteria | 1871 |
| 521 | Ga0373947_0148886 | 3300035725 | Bacteria | 1506 |
| 522 | Ga0373937_0245753 | 3300036401 | Bacteria | 1686 |
| 523 | Ga0373925_0003621 | 3300037068 | Bacteria | 11900 |
| 524 | Ga0439436_0013301 | 3300041404 | Bacteria | 2490 |
| 525 | Ga0439465_0000905 | 3300041413 | Bacteria | 9390 |
| 526 | Ga0439445_0000950 | 3300042004 | Bacteria | 6171 |
| 527 | Ga0439449_0000923 | 3300042007 | Bacteria | 11452 |
| 528 | Ga0439457_002549 | 3300042014 | Bacteria | 5168 |
| 529 | Ga0450898_012118 | 3300042134 | Bacteria | 1421 |
| 530 | Ga0453683_0004388 | 3300044673 | Bacteria | 10027 |
| 531 | Ga0453684_0004147 | 3300044712 | Bacteria | 31361 |
| 532 | Ga0451576_0003846 | 3300045051 | Bacteria | 20162 |
| 533 | Ga0451576_0388790 | 3300045051 | Bacteria | 1462 |
| 534 | Ga0495650_0015317 | 3300046471 | Bacteria | 3938 |
| 535 | Ga0495607_0000280 | 3300046501 | Bacteria | 54943 |
| 536 | Ga0495643_0102073 | 3300046522 | Bacteria | 1469 |
| 537 | Ga0495586_0053114 | 3300046535 | Bacteria | 2195 |
| 538 | Ga0495621_0026542 | 3300046539 | Bacteria | 1955 |
| 539 | Ga0495597_0007306 | 3300046542 | Bacteria | 5628 |
| 540 | Ga0495668_0089218 | 3300046616 | Bacteria | 1690 |
| 541 | Ga0495625_0000807 | 3300046660 | Bacteria | 43441 |
| 542 | Ga0495625_0013304 | 3300046660 | Bacteria | 6616 |
| 543 | Ga0495647_0003910 | 3300046681 | Bacteria | 4806 |
| 544 | Ga0495658_0009897 | 3300046683 | Bacteria | 4755 |
| 545 | Ga0495660_0022664 | 3300046810 | Bacteria | 3584 |
| 546 | Ga0495687_000196 | 3300047443 | Bacteria | 87053 |
| 547 | Ga0496100_0015028 | 3300048903 | Bacteria | 4513 |
| 548 | Ga0496101_0003644 | 3300048904 | Bacteria | 9612 |
| 549 | Ga0496101_0020827 | 3300048904 | Bacteria | 4498 |
| 550 | Ga0496102_0061675 | 3300048905 | Bacteria | 3432 |
| 551 | Ga0496103_0015705 | 3300048906 | Bacteria | 4513 |
| 552 | Ga0496104_0050519 | 3300048907 | Bacteria | 3923 |
| 553 | Ga0496106_0173091 | 3300048909 | Bacteria | 1712 |
| 554 | Ga0496106_0339859 | 3300048909 | Bacteria | 1206 |
| 555 | Ga0496108_0015385 | 3300048911 | Bacteria | 6241 |
| 556 | Ga0496108_0078227 | 3300048911 | Bacteria | 2799 |
| 557 | Ga0496109_0005385 | 3300048912 | Bacteria | 10697 |
| 558 | Ga0496110_0055926 | 3300048913 | Bacteria | 3472 |
| 559 | Ga0496114_0106841 | 3300048917 | Bacteria | 2395 |
| 560 | Ga0496114_0106912 | 3300048917 | Bacteria | 2394 |
| 561 | Ga0496116_0076715 | 3300048919 | Bacteria | 2092 |
| 562 | Ga0496118_0010875 | 3300048921 | Bacteria | 8954 |
| 563 | Ga0496118_0171653 | 3300048921 | Bacteria | 1324 |
| 564 | Ga0496119_0013228 | 3300048922 | Bacteria | 6596 |
| 565 | Ga0496122_0000217 | 3300048925 | Bacteria | 128502 |
| 566 | Ga0496122_0000669 | 3300048925 | Bacteria | 68904 |
| 567 | Ga0496123_0000057 | 3300048926 | Bacteria | 228608 |
| 568 | Ga0496123_0000603 | 3300048926 | Bacteria | 61111 |
| 569 | Ga0496123_0011878 | 3300048926 | Bacteria | 7486 |
| 570 | Ga0496124_0000103 | 3300048927 | Bacteria | 179162 |
| 571 | Ga0496124_0068992 | 3300048927 | Bacteria | 2936 |
| 572 | Ga0496125_0000168 | 3300048928 | Bacteria | 146364 |
| 573 | Ga0496125_0001023 | 3300048928 | Bacteria | 43458 |
| 574 | Ga0496125_0032129 | 3300048928 | Bacteria | 4666 |
| 575 | Ga0496125_0046771 | 3300048928 | Bacteria | 3626 |
| 576 | Ga0496125_0079823 | 3300048928 | Bacteria | 2507 |
| 577 | Ga0496126_0020831 | 3300048929 | Bacteria | 6418 |
| 578 | nmdc:mga00v17_573_c1 | 3300050491 | Bacteria | 20549 |
| 579 | nmdc:mga0k408_117992_c1 | 3300050493 | Bacteria | 1571 |
| 580 | nmdc:mga0k408_1222_c2 | 3300050493 | Bacteria | 3149 |
| 581 | nmdc:mga0k408_122491_c1 | 3300050493 | Bacteria | 1541 |
| 582 | nmdc:mga0k408_130522_c1 | 3300050493 | Bacteria | 1492 |
| 583 | nmdc:mga0k408_49253_c1 | 3300050493 | Bacteria | 2439 |
| 584 | nmdc:mga0k408_8612_c1 | 3300050493 | Bacteria | 5481 |
| 585 | nmdc:mga04h51_8957_c1 | 3300050495 | Bacteria | 2693 |
| 586 | nmdc:mga07m45_22579_c1 | 3300050496 | Bacteria | 3436 |
| 587 | nmdc:mga07m45_308_c1 | 3300050496 | Bacteria | 19736 |
| 588 | nmdc:mga07m45_6054_c1 | 3300050496 | Bacteria | 6090 |
| 589 | nmdc:mga07m45_69134_c1 | 3300050496 | Bacteria | 2008 |
| 590 | nmdc:mga08y16_169739_c1 | 3300050511 | Bacteria | 2266 |
| 591 | nmdc:mga0sz30_43116_c1 | 3300050516 | Bacteria | 1899 |
| 592 | Ga0500643_009420 | 3300053087 | Bacteria | 3735 |
| 593 | Ga0500658_0001486 | 3300053134 | Bacteria | 9378 |
| 594 | Ga0500645_000198 | 3300053730 | Bacteria | 46701 |
| 595 | Ga0500645_002382 | 3300053730 | Bacteria | 8455 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_10004695 | Ga0105243_100046959 | 313 |
| 2 | 3300013102 | Ga0157371_10037766 | Ga0157371_100377662 | 314 |
| 3 | 3300048922 | Ga0496119_0013228 | Ga0496119_0013228_913_1947 | 314 |
| 4 | 3300048926 | Ga0496123_0011878 | Ga0496123_0011878_5285_6319 | 314 |
| 5 | 3300048927 | Ga0496124_0068992 | Ga0496124_0068992_735_1769 | 314 |
| 6 | 3300048928 | Ga0496125_0000168 | Ga0496125_0000168_101651_102685 | 314 |
| 7 | 3300048929 | Ga0496126_0020831 | Ga0496126_0020831_2336_3370 | 314 |
| 8 | 3300048903 | Ga0496100_0015028 | Ga0496100_0015028_236_1294 | 315 |
| 9 | 3300048904 | Ga0496101_0003644 | Ga0496101_0003644_4986_6044 | 315 |
| 10 | 3300048907 | Ga0496104_0050519 | Ga0496104_0050519_2440_3498 | 315 |
| 11 | 3300048917 | Ga0496114_0106841 | Ga0496114_0106841_1327_2385 | 315 |
| 12 | 3300005347 | Ga0070668_100060654 | Ga0070668_1000606541 | 321 |
| 13 | 3300005354 | Ga0070675_100014312 | Ga0070675_1000143122 | 321 |
| 14 | 3300005364 | Ga0070673_100009444 | Ga0070673_1000094441 | 321 |
| 15 | 3300005457 | Ga0070662_100016060 | Ga0070662_1000160602 | 321 |
| 16 | 3300005543 | Ga0070672_100004667 | Ga0070672_1000046678 | 321 |
| 17 | 3300005618 | Ga0068864_100045661 | Ga0068864_1000456612 | 321 |
| 18 | 3300005843 | Ga0068860_100235221 | Ga0068860_1002352212 | 321 |
| 19 | 3300013308 | Ga0157375_10073262 | Ga0157375_100732622 | 321 |
| 20 | 3300014326 | Ga0157380_10039361 | Ga0157380_100393613 | 321 |
| 21 | 3300025315 | Ga0207697_10030381 | Ga0207697_100303811 | 321 |
| 22 | 3300025903 | Ga0207680_10068843 | Ga0207680_100688431 | 321 |
| 23 | 3300025940 | Ga0207691_10000773 | Ga0207691_1000077311 | 321 |
| 24 | 3300025972 | Ga0207668_10096144 | Ga0207668_100961441 | 321 |
| 25 | 3300026118 | Ga0207675_100024821 | Ga0207675_1000248212 | 321 |
| 26 | 3300028381 | Ga0268264_10022650 | Ga0268264_100226502 | 321 |
| 27 | iso_pu_bacteria | 2846952575 | 2846958082 | 321 |
| 28 | 3300005334 | Ga0068869_100014498 | Ga0068869_1000144982 | 322 |
| 29 | 3300005617 | Ga0068859_100046409 | Ga0068859_1000464092 | 322 |
| 30 | 3300005842 | Ga0068858_100057687 | Ga0068858_1000576873 | 322 |
| 31 | 3300006195 | Ga0075366_10073340 | Ga0075366_100733402 | 322 |
| 32 | 3300006931 | Ga0097620_100046408 | Ga0097620_1000464082 | 322 |
| 33 | 3300025294 | Ga0209025_1039234 | Ga0209025_10392342 | 322 |
| 34 | 3300025926 | Ga0207659_10073521 | Ga0207659_100735213 | 322 |
| 35 | 3300025942 | Ga0207689_10001301 | Ga0207689_1000130116 | 322 |
| 36 | 3300026023 | Ga0207677_10057250 | Ga0207677_100572502 | 322 |
| 37 | 3300026035 | Ga0207703_10128445 | Ga0207703_101284452 | 322 |
| 38 | 3300048925 | Ga0496122_0000669 | Ga0496122_0000669_12116_13273 | 322 |
| 39 | 3300048926 | Ga0496123_0000603 | Ga0496123_0000603_41853_43010 | 322 |
| 40 | 3300048928 | Ga0496125_0046771 | Ga0496125_0046771_1356_2513 | 322 |
| 41 | 3300050493 | nmdc:mga0k408_1222_c2 | nmdc:mga0k408_1222_c2_1804_2793 | 322 |
| 42 | iso_pu_bacteria | 2643221654 | 2644303763 | 322 |
| 43 | iso_pu_bacteria | 2821443989 | 2821444107 | 322 |
| 44 | 3300003187 | JGI25151J46595_10010218 | JGI25151J46595_100102182 | 323 |
| 45 | 3300003354 | JGI25160J50197_1004001 | JGI25160J50197_10040013 | 323 |
| 46 | 3300005459 | Ga0068867_100068017 | Ga0068867_1000680172 | 323 |
| 47 | 3300005844 | Ga0068862_100011483 | Ga0068862_1000114832 | 323 |
| 48 | 3300005937 | Ga0081455_10128564 | Ga0081455_101285642 | 323 |
| 49 | 3300006048 | Ga0075363_100006291 | Ga0075363_1000062915 | 323 |
| 50 | 3300006177 | Ga0075362_10050113 | Ga0075362_100501133 | 323 |
| 51 | 3300006178 | Ga0075367_10002951 | Ga0075367_100029513 | 323 |
| 52 | 3300006195 | Ga0075366_10018117 | Ga0075366_100181172 | 323 |
| 53 | 3300006353 | Ga0075370_10000581 | Ga0075370_100005815 | 323 |
| 54 | 3300009986 | Ga0105033_100704 | Ga0105033_1007042 | 323 |
| 55 | 3300013100 | Ga0157373_10042400 | Ga0157373_100424003 | 323 |
| 56 | 3300014497 | Ga0182008_10026570 | Ga0182008_100265703 | 323 |
| 57 | 3300025284 | Ga0209130_1000625 | Ga0209130_100062522 | 323 |
| 58 | 3300025294 | Ga0209025_1000750 | Ga0209025_100075064 | 323 |
| 59 | 3300025297 | Ga0209758_1008491 | Ga0209758_10084913 | 323 |
| 60 | 3300025302 | Ga0207426_1000336 | Ga0207426_100033634 | 323 |
| 61 | 3300025901 | Ga0207688_10120342 | Ga0207688_101203422 | 323 |
| 62 | 3300026041 | Ga0207639_10181887 | Ga0207639_101818872 | 323 |
| 63 | 3300026118 | Ga0207675_100331927 | Ga0207675_1003319272 | 323 |
| 64 | 3300027866 | Ga0209813_10007684 | Ga0209813_100076843 | 323 |
| 65 | 3300028380 | Ga0268265_10307731 | Ga0268265_103077312 | 323 |
| 66 | 3300028794 | Ga0307515_10000283 | Ga0307515_10000283100 | 323 |
| 67 | 3300048921 | Ga0496118_0171653 | Ga0496118_0171653_18_1010 | 323 |
| 68 | 3300050493 | nmdc:mga0k408_117992_c1 | nmdc:mga0k408_117992_c1_30_1022 | 323 |
| 69 | 3300050493 | nmdc:mga0k408_130522_c1 | nmdc:mga0k408_130522_c1_310_1302 | 323 |
| 70 | 3300050495 | nmdc:mga04h51_8957_c1 | nmdc:mga04h51_8957_c1_1623_2615 | 323 |
| 71 | 3300050496 | nmdc:mga07m45_308_c1 | nmdc:mga07m45_308_c1_1583_2575 | 323 |
| 72 | 3300050496 | nmdc:mga07m45_69134_c1 | nmdc:mga07m45_69134_c1_411_1403 | 323 |
| 73 | 3300050516 | nmdc:mga0sz30_43116_c1 | nmdc:mga0sz30_43116_c1_557_1549 | 323 |
| 74 | 3300053087 | Ga0500643_009420 | Ga0500643_009420_1646_2647 | 323 |
| 75 | iso_pu_bacteria | 2844533157 | 2844539473 | 323 |
| 76 | iso_pu_bacteria | 2894023352 | 2894027686 | 323 |
| 77 | 3300006353 | Ga0075370_10029780 | Ga0075370_100297802 | 324 |
| 78 | 3300007265 | Ga0099794_10020874 | Ga0099794_100208742 | 324 |
| 79 | 3300009177 | Ga0105248_10022102 | Ga0105248_100221025 | 324 |
| 80 | 3300010375 | Ga0105239_10194616 | Ga0105239_101946161 | 324 |
| 81 | 3300013308 | Ga0157375_10316262 | Ga0157375_103162621 | 324 |
| 82 | 3300014325 | Ga0163163_10436417 | Ga0163163_104364172 | 324 |
| 83 | 3300014969 | Ga0157376_10008524 | Ga0157376_100085245 | 324 |
| 84 | 3300017792 | Ga0163161_10013132 | Ga0163161_100131325 | 324 |
| 85 | 3300027671 | Ga0209588_1067968 | Ga0209588_10679681 | 324 |
| 86 | 3300028794 | Ga0307515_10201866 | Ga0307515_102018662 | 324 |
| 87 | 3300031456 | Ga0307513_10324869 | Ga0307513_103248691 | 324 |
| 88 | 3300031616 | Ga0307508_10016840 | Ga0307508_100168406 | 324 |
| 89 | 3300042134 | Ga0450898_012118 | Ga0450898_012118_73_1146 | 324 |
| 90 | iso_pu_bacteria | 2904479285 | 2904481054 | 324 |
| 91 | 3300005843 | Ga0068860_100102229 | Ga0068860_1001022292 | 325 |
| 92 | 3300006931 | Ga0097620_100189034 | Ga0097620_1001890341 | 325 |
| 93 | 3300009545 | Ga0105237_10080165 | Ga0105237_100801652 | 325 |
| 94 | 3300009553 | Ga0105249_10009786 | Ga0105249_100097865 | 325 |
| 95 | 3300013297 | Ga0157378_10004470 | Ga0157378_100044707 | 325 |
| 96 | 3300013297 | Ga0157378_10014904 | Ga0157378_100149046 | 325 |
| 97 | 3300013306 | Ga0163162_10008437 | Ga0163162_100084373 | 325 |
| 98 | 3300014968 | Ga0157379_10006962 | Ga0157379_100069629 | 325 |
| 99 | 3300025914 | Ga0207671_10035768 | Ga0207671_100357682 | 325 |
| 100 | 3300028381 | Ga0268264_10124353 | Ga0268264_101243532 | 325 |
| 101 | 3300028794 | Ga0307515_10156619 | Ga0307515_101566193 | 325 |
| 102 | 3300031616 | Ga0307508_10001111 | Ga0307508_1000111128 | 325 |
| 103 | 3300033179 | Ga0307507_10050320 | Ga0307507_100503202 | 325 |
| 104 | 3300044712 | Ga0453684_0004147 | Ga0453684_0004147_7155_8153 | 325 |
| 105 | 3300045051 | Ga0451576_0388790 | Ga0451576_0388790_433_1425 | 325 |
| 106 | 3300046522 | Ga0495643_0102073 | Ga0495643_0102073_143_1141 | 325 |
| 107 | iso_pu_bacteria | 2545555834 | 2545678243 | 325 |
| 108 | iso_pu_bacteria | 641522639 | 641643379 | 325 |
| 109 | 3300003215 | JGI25153J46596_10001768 | JGI25153J46596_100017687 | 326 |
| 110 | 3300005333 | Ga0070677_10013807 | Ga0070677_100138073 | 326 |
| 111 | 3300005353 | Ga0070669_100018890 | Ga0070669_1000188904 | 326 |
| 112 | 3300005356 | Ga0070674_100057946 | Ga0070674_1000579463 | 326 |
| 113 | 3300005456 | Ga0070678_100008501 | Ga0070678_1000085011 | 326 |
| 114 | 3300005459 | Ga0068867_100005155 | Ga0068867_1000051558 | 326 |
| 115 | 3300005719 | Ga0068861_100002547 | Ga0068861_1000025478 | 326 |
| 116 | 3300005843 | Ga0068860_100004285 | Ga0068860_1000042857 | 326 |
| 117 | 3300005843 | Ga0068860_100100333 | Ga0068860_1001003332 | 326 |
| 118 | 3300005844 | Ga0068862_100038440 | Ga0068862_1000384403 | 326 |
| 119 | 3300005844 | Ga0068862_100250020 | Ga0068862_1002500201 | 326 |
| 120 | 3300005937 | Ga0081455_10236012 | Ga0081455_102360121 | 326 |
| 121 | 3300006358 | Ga0068871_100063833 | Ga0068871_1000638332 | 326 |
| 122 | 3300006881 | Ga0068865_100023958 | Ga0068865_1000239582 | 326 |
| 123 | 3300009148 | Ga0105243_10152568 | Ga0105243_101525682 | 326 |
| 124 | 3300014968 | Ga0157379_10056850 | Ga0157379_100568502 | 326 |
| 125 | 3300017792 | Ga0163161_10016219 | Ga0163161_100162194 | 326 |
| 126 | 3300025297 | Ga0209758_1000249 | Ga0209758_100024961 | 326 |
| 127 | 3300025893 | Ga0207682_10043131 | Ga0207682_100431312 | 326 |
| 128 | 3300025907 | Ga0207645_10080294 | Ga0207645_100802942 | 326 |
| 129 | 3300025927 | Ga0207687_10163090 | Ga0207687_101630902 | 326 |
| 130 | 3300025931 | Ga0207644_10252643 | Ga0207644_102526431 | 326 |
| 131 | 3300025935 | Ga0207709_10047480 | Ga0207709_100474802 | 326 |
| 132 | 3300025935 | Ga0207709_10093251 | Ga0207709_100932512 | 326 |
| 133 | 3300025937 | Ga0207669_10055448 | Ga0207669_100554482 | 326 |
| 134 | 3300025938 | Ga0207704_10084488 | Ga0207704_100844882 | 326 |
| 135 | 3300025940 | Ga0207691_10009293 | Ga0207691_100092932 | 326 |
| 136 | 3300025961 | Ga0207712_10010255 | Ga0207712_100102552 | 326 |
| 137 | 3300025986 | Ga0207658_10130220 | Ga0207658_101302202 | 326 |
| 138 | 3300026089 | Ga0207648_10009516 | Ga0207648_100095163 | 326 |
| 139 | 3300026118 | Ga0207675_100008033 | Ga0207675_1000080337 | 326 |
| 140 | 3300026121 | Ga0207683_10045801 | Ga0207683_100458012 | 326 |
| 141 | 3300028380 | Ga0268265_10083964 | Ga0268265_100839643 | 326 |
| 142 | 3300028380 | Ga0268265_10168443 | Ga0268265_101684432 | 326 |
| 143 | 3300028381 | Ga0268264_10017548 | Ga0268264_100175484 | 326 |
| 144 | 3300028794 | Ga0307515_10182241 | Ga0307515_101822412 | 326 |
| 145 | 3300035118 | Ga0373954_0107382 | Ga0373954_0107382_226_1209 | 326 |
| 146 | 3300035695 | Ga0373927_0046506 | Ga0373927_0046506_1370_2365 | 326 |
| 147 | 3300036401 | Ga0373937_0245753 | Ga0373937_0245753_455_1441 | 326 |
| 148 | 3300037068 | Ga0373925_0003621 | Ga0373925_0003621_5681_6676 | 326 |
| 149 | 3300046471 | Ga0495650_0015317 | Ga0495650_0015317_1952_2941 | 326 |
| 150 | 3300046535 | Ga0495586_0053114 | Ga0495586_0053114_876_1874 | 326 |
| 151 | 3300046681 | Ga0495647_0003910 | Ga0495647_0003910_411_1397 | 326 |
| 152 | 3300046683 | Ga0495658_0009897 | Ga0495658_0009897_2298_3284 | 326 |
| 153 | 3300048925 | Ga0496122_0000217 | Ga0496122_0000217_87527_88528 | 326 |
| 154 | 3300048926 | Ga0496123_0000057 | Ga0496123_0000057_15689_16690 | 326 |
| 155 | 3300050493 | nmdc:mga0k408_49253_c1 | nmdc:mga0k408_49253_c1_1115_2110 | 326 |
| 156 | iso_pu_bacteria | 2585428062 | 2587757174 | 326 |
| 157 | iso_pu_bacteria | 2597490356 | 2599101936 | 326 |
| 158 | iso_pu_bacteria | 2848858292 | 2848864856 | 326 |
| 159 | iso_pu_bacteria | 2897803580 | 2897805879 | 326 |
| 160 | 3300005456 | Ga0070678_100013926 | Ga0070678_1000139265 | 327 |
| 161 | 3300005457 | Ga0070662_100007540 | Ga0070662_1000075405 | 327 |
| 162 | 3300005577 | Ga0068857_100051888 | Ga0068857_1000518883 | 327 |
| 163 | 3300006042 | Ga0075368_10074870 | Ga0075368_100748702 | 327 |
| 164 | 3300006177 | Ga0075362_10018253 | Ga0075362_100182532 | 327 |
| 165 | 3300006353 | Ga0075370_10028017 | Ga0075370_100280174 | 327 |
| 166 | 3300009036 | Ga0105244_10000965 | Ga0105244_1000096515 | 327 |
| 167 | 3300009093 | Ga0105240_10013158 | Ga0105240_100131587 | 327 |
| 168 | 3300009093 | Ga0105240_10356268 | Ga0105240_103562682 | 327 |
| 169 | 3300009148 | Ga0105243_10001233 | Ga0105243_100012332 | 327 |
| 170 | 3300009545 | Ga0105237_10001628 | Ga0105237_1000162821 | 327 |
| 171 | 3300009545 | Ga0105237_10014335 | Ga0105237_100143355 | 327 |
| 172 | 3300010375 | Ga0105239_10001684 | Ga0105239_1000168421 | 327 |
| 173 | 3300010375 | Ga0105239_10094552 | Ga0105239_100945522 | 327 |
| 174 | 3300013100 | Ga0157373_10027700 | Ga0157373_100277004 | 327 |
| 175 | 3300013105 | Ga0157369_10002311 | Ga0157369_1000231115 | 327 |
| 176 | 3300014497 | Ga0182008_10022139 | Ga0182008_100221393 | 327 |
| 177 | 3300015261 | Ga0182006_1001032 | Ga0182006_10010322 | 327 |
| 178 | 3300015262 | Ga0182007_10000366 | Ga0182007_1000036614 | 327 |
| 179 | 3300025913 | Ga0207695_10020847 | Ga0207695_100208475 | 327 |
| 180 | 3300025913 | Ga0207695_10318030 | Ga0207695_103180301 | 327 |
| 181 | 3300025914 | Ga0207671_10001800 | Ga0207671_100018007 | 327 |
| 182 | 3300025914 | Ga0207671_10143976 | Ga0207671_101439762 | 327 |
| 183 | 3300025933 | Ga0207706_10005242 | Ga0207706_100052422 | 327 |
| 184 | 3300025935 | Ga0207709_10011257 | Ga0207709_100112575 | 327 |
| 185 | 3300026116 | Ga0207674_10020383 | Ga0207674_100203833 | 327 |
| 186 | 3300028794 | Ga0307515_10102505 | Ga0307515_101025052 | 327 |
| 187 | 3300030522 | Ga0307512_10051832 | Ga0307512_100518322 | 327 |
| 188 | 3300031456 | Ga0307513_10210027 | Ga0307513_102100271 | 327 |
| 189 | 3300031616 | Ga0307508_10000876 | Ga0307508_1000087624 | 327 |
| 190 | 3300031730 | Ga0307516_10037208 | Ga0307516_100372081 | 327 |
| 191 | 3300032004 | Ga0307414_10115575 | Ga0307414_101155752 | 327 |
| 192 | 3300033179 | Ga0307507_10066708 | Ga0307507_100667082 | 327 |
| 193 | 3300046542 | Ga0495597_0007306 | Ga0495597_0007306_4103_5107 | 327 |
| 194 | 3300046616 | Ga0495668_0089218 | Ga0495668_0089218_31_1035 | 327 |
| 195 | 3300046660 | Ga0495625_0000807 | Ga0495625_0000807_10992_11996 | 327 |
| 196 | 3300046660 | Ga0495625_0013304 | Ga0495625_0013304_4208_5212 | 327 |
| 197 | 3300046810 | Ga0495660_0022664 | Ga0495660_0022664_736_1740 | 327 |
| 198 | 3300047443 | Ga0495687_000196 | Ga0495687_000196_34990_35994 | 327 |
| 199 | 3300048919 | Ga0496116_0076715 | Ga0496116_0076715_118_1101 | 327 |
| 200 | 3300048921 | Ga0496118_0010875 | Ga0496118_0010875_4900_5883 | 327 |
| 201 | 3300050493 | nmdc:mga0k408_122491_c1 | nmdc:mga0k408_122491_c1_61_1149 | 327 |
| 202 | 3300050496 | nmdc:mga07m45_22579_c1 | nmdc:mga07m45_22579_c1_382_1407 | 327 |
| 203 | 3300053134 | Ga0500658_0001486 | Ga0500658_0001486_5700_6704 | 327 |
| 204 | 3300002704 | JGI25155J39150_1000002 | JGI25155J39150_100000286 | 328 |
| 205 | 3300002705 | JGI25156J39149_1000003 | JGI25156J39149_1000003219 | 328 |
| 206 | 3300002738 | JGI25154J39366_1000009 | JGI25154J39366_100000986 | 328 |
| 207 | 3300002741 | JGI25157J39369_1000002 | JGI25157J39369_100000286 | 328 |
| 208 | 3300002987 | JGI25159J45721_1006315 | JGI25159J45721_10063152 | 328 |
| 209 | 3300003775 | Ga0055524_1000012 | Ga0055524_100001258 | 328 |
| 210 | 3300003790 | Ga0055528_1007069 | Ga0055528_10070693 | 328 |
| 211 | 3300003791 | Ga0055530_10000793 | Ga0055530_100007939 | 328 |
| 212 | 3300003792 | Ga0055540_1000012 | Ga0055540_1000012177 | 328 |
| 213 | 3300005327 | Ga0070658_10196826 | Ga0070658_101968261 | 328 |
| 214 | 3300005328 | Ga0070676_10057247 | Ga0070676_100572472 | 328 |
| 215 | 3300005338 | Ga0068868_100080157 | Ga0068868_1000801572 | 328 |
| 216 | 3300005338 | Ga0068868_100184182 | Ga0068868_1001841821 | 328 |
| 217 | 3300005344 | Ga0070661_100317260 | Ga0070661_1003172601 | 328 |
| 218 | 3300005353 | Ga0070669_100079455 | Ga0070669_1000794552 | 328 |
| 219 | 3300005354 | Ga0070675_100001733 | Ga0070675_10000173310 | 328 |
| 220 | 3300005355 | Ga0070671_100004476 | Ga0070671_1000044764 | 328 |
| 221 | 3300005356 | Ga0070674_100005616 | Ga0070674_1000056165 | 328 |
| 222 | 3300005367 | Ga0070667_100016492 | Ga0070667_1000164924 | 328 |
| 223 | 3300005456 | Ga0070678_100176557 | Ga0070678_1001765572 | 328 |
| 224 | 3300005459 | Ga0068867_100021447 | Ga0068867_1000214473 | 328 |
| 225 | 3300005539 | Ga0068853_100354329 | Ga0068853_1003543291 | 328 |
| 226 | 3300005616 | Ga0068852_100162799 | Ga0068852_1001627992 | 328 |
| 227 | 3300005618 | Ga0068864_100153517 | Ga0068864_1001535172 | 328 |
| 228 | 3300005718 | Ga0068866_10031509 | Ga0068866_100315092 | 328 |
| 229 | 3300005719 | Ga0068861_100265810 | Ga0068861_1002658103 | 328 |
| 230 | 3300005840 | Ga0068870_10150193 | Ga0068870_101501933 | 328 |
| 231 | 3300005841 | Ga0068863_100054985 | Ga0068863_1000549854 | 328 |
| 232 | 3300005844 | Ga0068862_100326014 | Ga0068862_1003260141 | 328 |
| 233 | 3300006358 | Ga0068871_100032087 | Ga0068871_1000320872 | 328 |
| 234 | 3300006871 | Ga0075434_100369756 | Ga0075434_1003697561 | 328 |
| 235 | 3300009098 | Ga0105245_10012088 | Ga0105245_100120884 | 328 |
| 236 | 3300009101 | Ga0105247_10198224 | Ga0105247_101982242 | 328 |
| 237 | 3300009148 | Ga0105243_10226000 | Ga0105243_102260002 | 328 |
| 238 | 3300009177 | Ga0105248_10083235 | Ga0105248_100832353 | 328 |
| 239 | 3300009177 | Ga0105248_10404995 | Ga0105248_104049951 | 328 |
| 240 | 3300009545 | Ga0105237_10454120 | Ga0105237_104541201 | 328 |
| 241 | 3300010375 | Ga0105239_10483842 | Ga0105239_104838421 | 328 |
| 242 | 3300013306 | Ga0163162_10239580 | Ga0163162_102395802 | 328 |
| 243 | 3300013308 | Ga0157375_10020725 | Ga0157375_100207254 | 328 |
| 244 | 3300014325 | Ga0163163_10096759 | Ga0163163_100967593 | 328 |
| 245 | 3300014326 | Ga0157380_10087811 | Ga0157380_100878112 | 328 |
| 246 | 3300014326 | Ga0157380_10158652 | Ga0157380_101586522 | 328 |
| 247 | 3300014968 | Ga0157379_10017722 | Ga0157379_100177223 | 328 |
| 248 | 3300025206 | Ga0209435_100001 | Ga0209435_100001630 | 328 |
| 249 | 3300025245 | Ga0207425_1008428 | Ga0207425_10084283 | 328 |
| 250 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001999 | 328 |
| 251 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003630 | 328 |
| 252 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001630 | 328 |
| 253 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004577 | 328 |
| 254 | 3300025273 | Ga0209673_1000074 | Ga0209673_1000074205 | 328 |
| 255 | 3300025284 | Ga0209130_1000082 | Ga0209130_1000082107 | 328 |
| 256 | 3300025291 | Ga0209675_1001253 | Ga0209675_100125315 | 328 |
| 257 | 3300025292 | Ga0209676_1000029 | Ga0209676_1000029326 | 328 |
| 258 | 3300025294 | Ga0209025_1014059 | Ga0209025_10140594 | 328 |
| 259 | 3300025295 | Ga0209564_1001244 | Ga0209564_100124412 | 328 |
| 260 | 3300025297 | Ga0209758_1057641 | Ga0209758_10576412 | 328 |
| 261 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003388 | 328 |
| 262 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001390 | 328 |
| 263 | 3300025302 | Ga0207426_1002464 | Ga0207426_10024644 | 328 |
| 264 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003388 | 328 |
| 265 | 3300025304 | Ga0209257_1000018 | Ga0209257_1000018388 | 328 |
| 266 | 3300025315 | Ga0207697_10072477 | Ga0207697_100724772 | 328 |
| 267 | 3300025899 | Ga0207642_10020166 | Ga0207642_100201662 | 328 |
| 268 | 3300025923 | Ga0207681_10061746 | Ga0207681_100617462 | 328 |
| 269 | 3300025925 | Ga0207650_10002722 | Ga0207650_1000272211 | 328 |
| 270 | 3300025926 | Ga0207659_10000256 | Ga0207659_1000025632 | 328 |
| 271 | 3300025927 | Ga0207687_10053653 | Ga0207687_100536532 | 328 |
| 272 | 3300025927 | Ga0207687_10185564 | Ga0207687_101855642 | 328 |
| 273 | 3300025931 | Ga0207644_10021303 | Ga0207644_100213032 | 328 |
| 274 | 3300025933 | Ga0207706_10170700 | Ga0207706_101707002 | 328 |
| 275 | 3300025934 | Ga0207686_10171067 | Ga0207686_101710671 | 328 |
| 276 | 3300025938 | Ga0207704_10040711 | Ga0207704_100407112 | 328 |
| 277 | 3300025940 | Ga0207691_10000360 | Ga0207691_1000036045 | 328 |
| 278 | 3300025960 | Ga0207651_10023043 | Ga0207651_100230433 | 328 |
| 279 | 3300025986 | Ga0207658_10090649 | Ga0207658_100906492 | 328 |
| 280 | 3300026023 | Ga0207677_10069942 | Ga0207677_100699422 | 328 |
| 281 | 3300026023 | Ga0207677_10243055 | Ga0207677_102430552 | 328 |
| 282 | 3300026089 | Ga0207648_10003420 | Ga0207648_100034206 | 328 |
| 283 | 3300026089 | Ga0207648_10023605 | Ga0207648_100236052 | 328 |
| 284 | 3300026089 | Ga0207648_10099845 | Ga0207648_100998452 | 328 |
| 285 | 3300026095 | Ga0207676_10062352 | Ga0207676_100623521 | 328 |
| 286 | 3300026095 | Ga0207676_10082436 | Ga0207676_100824361 | 328 |
| 287 | 3300026121 | Ga0207683_10002951 | Ga0207683_1000295111 | 328 |
| 288 | 3300026121 | Ga0207683_10036681 | Ga0207683_100366814 | 328 |
| 289 | 3300028379 | Ga0268266_10211875 | Ga0268266_102118751 | 328 |
| 290 | 3300028381 | Ga0268264_10129384 | Ga0268264_101293842 | 328 |
| 291 | 3300031456 | Ga0307513_10000019 | Ga0307513_100000194 | 328 |
| 292 | 3300031456 | Ga0307513_10000051 | Ga0307513_10000051123 | 328 |
| 293 | 3300031852 | Ga0307410_10016709 | Ga0307410_100167091 | 328 |
| 294 | 3300031901 | Ga0307406_10006998 | Ga0307406_100069981 | 328 |
| 295 | 3300031903 | Ga0307407_10134193 | Ga0307407_101341931 | 328 |
| 296 | 3300031911 | Ga0307412_10008248 | Ga0307412_100082485 | 328 |
| 297 | 3300032004 | Ga0307414_10011968 | Ga0307414_100119682 | 328 |
| 298 | 3300032005 | Ga0307411_10015798 | Ga0307411_100157982 | 328 |
| 299 | 3300041404 | Ga0439436_0013301 | Ga0439436_0013301_1201_2187 | 328 |
| 300 | 3300044673 | Ga0453683_0004388 | Ga0453683_0004388_5571_6572 | 328 |
| 301 | 3300045051 | Ga0451576_0003846 | Ga0451576_0003846_16875_17876 | 328 |
| 302 | 3300048909 | Ga0496106_0339859 | Ga0496106_0339859_89_1093 | 328 |
| 303 | 3300050493 | nmdc:mga0k408_8612_c1 | nmdc:mga0k408_8612_c1_1002_1988 | 328 |
| 304 | 3300053730 | Ga0500645_000198 | Ga0500645_000198_19124_20122 | 328 |
| 305 | 3300053730 | Ga0500645_002382 | Ga0500645_002382_4373_5371 | 328 |
| 306 | iso_pu_bacteria | 2857542790 | 2857543433 | 328 |
| 307 | iso_pu_bacteria | 2928115317 | 2928119630 | 328 |
| 308 | 3300003187 | JGI25151J46595_10009742 | JGI25151J46595_100097424 | 329 |
| 309 | 3300003354 | JGI25160J50197_1000123 | JGI25160J50197_100012335 | 329 |
| 310 | 3300003374 | JGI25161J50226_1000032 | JGI25161J50226_100003240 | 329 |
| 311 | 3300003792 | Ga0055540_1003742 | Ga0055540_10037424 | 329 |
| 312 | 3300003794 | Ga0055531_10002524 | Ga0055531_100025244 | 329 |
| 313 | 3300004625 | Ga0055543_1000294 | Ga0055543_100029434 | 329 |
| 314 | 3300005262 | Ga0065165_1018453 | Ga0065165_10184531 | 329 |
| 315 | 3300005262 | Ga0065165_1028107 | Ga0065165_10281071 | 329 |
| 316 | 3300005289 | Ga0065704_10079326 | Ga0065704_100793263 | 329 |
| 317 | 3300005330 | Ga0070690_100106265 | Ga0070690_1001062652 | 329 |
| 318 | 3300005331 | Ga0070670_100008068 | Ga0070670_1000080682 | 329 |
| 319 | 3300005334 | Ga0068869_100009675 | Ga0068869_1000096755 | 329 |
| 320 | 3300005340 | Ga0070689_100307199 | Ga0070689_1003071992 | 329 |
| 321 | 3300005353 | Ga0070669_100117767 | Ga0070669_1001177671 | 329 |
| 322 | 3300005354 | Ga0070675_100028703 | Ga0070675_1000287032 | 329 |
| 323 | 3300005356 | Ga0070674_100206818 | Ga0070674_1002068182 | 329 |
| 324 | 3300005367 | Ga0070667_100241592 | Ga0070667_1002415922 | 329 |
| 325 | 3300005440 | Ga0070705_100220159 | Ga0070705_1002201591 | 329 |
| 326 | 3300005456 | Ga0070678_100068917 | Ga0070678_1000689172 | 329 |
| 327 | 3300005458 | Ga0070681_10036162 | Ga0070681_100361623 | 329 |
| 328 | 3300005539 | Ga0068853_100096607 | Ga0068853_1000966072 | 329 |
| 329 | 3300005543 | Ga0070672_100010425 | Ga0070672_1000104254 | 329 |
| 330 | 3300005545 | Ga0070695_100177467 | Ga0070695_1001774671 | 329 |
| 331 | 3300005548 | Ga0070665_100203426 | Ga0070665_1002034262 | 329 |
| 332 | 3300005618 | Ga0068864_100002200 | Ga0068864_1000022004 | 329 |
| 333 | 3300005618 | Ga0068864_100089148 | Ga0068864_1000891482 | 329 |
| 334 | 3300005618 | Ga0068864_100242456 | Ga0068864_1002424563 | 329 |
| 335 | 3300005841 | Ga0068863_100002680 | Ga0068863_1000026805 | 329 |
| 336 | 3300005841 | Ga0068863_100022184 | Ga0068863_1000221841 | 329 |
| 337 | 3300005844 | Ga0068862_100090846 | Ga0068862_1000908463 | 329 |
| 338 | 3300006237 | Ga0097621_100017078 | Ga0097621_1000170782 | 329 |
| 339 | 3300006237 | Ga0097621_100074079 | Ga0097621_1000740791 | 329 |
| 340 | 3300006358 | Ga0068871_100005755 | Ga0068871_1000057556 | 329 |
| 341 | 3300006358 | Ga0068871_100011783 | Ga0068871_1000117836 | 329 |
| 342 | 3300009093 | Ga0105240_10440104 | Ga0105240_104401041 | 329 |
| 343 | 3300009148 | Ga0105243_10093995 | Ga0105243_100939951 | 329 |
| 344 | 3300009174 | Ga0105241_10010537 | Ga0105241_100105373 | 329 |
| 345 | 3300009176 | Ga0105242_10025996 | Ga0105242_100259964 | 329 |
| 346 | 3300009545 | Ga0105237_10011624 | Ga0105237_100116242 | 329 |
| 347 | 3300010375 | Ga0105239_10231109 | Ga0105239_102311092 | 329 |
| 348 | 3300013308 | Ga0157375_10085470 | Ga0157375_100854702 | 329 |
| 349 | 3300014325 | Ga0163163_10009364 | Ga0163163_100093648 | 329 |
| 350 | 3300014326 | Ga0157380_10087180 | Ga0157380_100871801 | 329 |
| 351 | 3300025245 | Ga0207425_1002090 | Ga0207425_10020907 | 329 |
| 352 | 3300025258 | Ga0209129_1006848 | Ga0209129_10068483 | 329 |
| 353 | 3300025284 | Ga0209130_1000050 | Ga0209130_1000050220 | 329 |
| 354 | 3300025292 | Ga0209676_1007573 | Ga0209676_10075733 | 329 |
| 355 | 3300025298 | Ga0209050_1004456 | Ga0209050_10044563 | 329 |
| 356 | 3300025302 | Ga0207426_1000071 | Ga0207426_100007136 | 329 |
| 357 | 3300025303 | Ga0209051_1000542 | Ga0209051_100054227 | 329 |
| 358 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012607 | 329 |
| 359 | 3300025908 | Ga0207643_10002912 | Ga0207643_100029124 | 329 |
| 360 | 3300025911 | Ga0207654_10066265 | Ga0207654_100662652 | 329 |
| 361 | 3300025912 | Ga0207707_10043109 | Ga0207707_100431092 | 329 |
| 362 | 3300025913 | Ga0207695_10328361 | Ga0207695_103283611 | 329 |
| 363 | 3300025917 | Ga0207660_10142588 | Ga0207660_101425881 | 329 |
| 364 | 3300025925 | Ga0207650_10003389 | Ga0207650_100033897 | 329 |
| 365 | 3300025925 | Ga0207650_10029364 | Ga0207650_100293642 | 329 |
| 366 | 3300025931 | Ga0207644_10004912 | Ga0207644_100049127 | 329 |
| 367 | 3300025934 | Ga0207686_10059632 | Ga0207686_100596322 | 329 |
| 368 | 3300025935 | Ga0207709_10121303 | Ga0207709_101213032 | 329 |
| 369 | 3300025936 | Ga0207670_10051220 | Ga0207670_100512203 | 329 |
| 370 | 3300025942 | Ga0207689_10009368 | Ga0207689_100093683 | 329 |
| 371 | 3300025960 | Ga0207651_10118548 | Ga0207651_101185481 | 329 |
| 372 | 3300026088 | Ga0207641_10008475 | Ga0207641_100084751 | 329 |
| 373 | 3300026089 | Ga0207648_10010728 | Ga0207648_100107282 | 329 |
| 374 | 3300026095 | Ga0207676_10018219 | Ga0207676_100182193 | 329 |
| 375 | 3300026095 | Ga0207676_10267560 | Ga0207676_102675602 | 329 |
| 376 | 3300026121 | Ga0207683_10041187 | Ga0207683_100411872 | 329 |
| 377 | 3300046501 | Ga0495607_0000280 | Ga0495607_0000280_50592_51590 | 329 |
| 378 | 3300048927 | Ga0496124_0000103 | Ga0496124_0000103_32233_33261 | 329 |
| 379 | 3300048928 | Ga0496125_0032129 | Ga0496125_0032129_264_1259 | 329 |
| 380 | 3300048928 | Ga0496125_0079823 | Ga0496125_0079823_1275_2267 | 329 |
| 381 | 3300050491 | nmdc:mga00v17_573_c1 | nmdc:mga00v17_573_c1_7611_8657 | 329 |
| 382 | iso_pu_bacteria | 2511231221 | 2512036216 | 329 |
| 383 | iso_pu_bacteria | 2513020051 | 2513231804 | 329 |
| 384 | iso_pu_bacteria | 2599185214 | 2599626658 | 329 |
| 385 | iso_pu_bacteria | 2599185226 | 2599675722 | 329 |
| 386 | iso_pu_bacteria | 2599185227 | 2599684195 | 329 |
| 387 | iso_pu_bacteria | 2599185229 | 2599696209 | 329 |
| 388 | iso_pu_bacteria | 2643221658 | 2644327934 | 329 |
| 389 | iso_pu_bacteria | 2643221672 | 2644397895 | 329 |
| 390 | iso_pu_bacteria | 2643221683 | 2644468265 | 329 |
| 391 | iso_pu_bacteria | 2738541277 | 2738718076 | 329 |
| 392 | iso_pu_bacteria | 2738541307 | 2738885026 | 329 |
| 393 | iso_pu_bacteria | 2738543019 | 2739278762 | 329 |
| 394 | iso_pu_bacteria | 2818991446 | 2819595767 | 329 |
| 395 | iso_pu_bacteria | 2831265667 | 2831266779 | 329 |
| 396 | iso_pu_bacteria | 2838054893 | 2838057140 | 329 |
| 397 | iso_pu_bacteria | 2842677519 | 2842682580 | 329 |
| 398 | iso_pu_bacteria | 2842733646 | 2842735580 | 329 |
| 399 | iso_pu_bacteria | 2842747753 | 2842751324 | 329 |
| 400 | iso_pu_bacteria | 2885192300 | 2885192722 | 329 |
| 401 | iso_pu_bacteria | 2885198086 | 2885201228 | 329 |
| 402 | iso_pu_bacteria | 2885211737 | 2885214882 | 329 |
| 403 | iso_pu_bacteria | 2899924645 | 2899925113 | 329 |
| 404 | iso_pu_bacteria | 2904541872 | 2904544746 | 329 |
| 405 | iso_pu_bacteria | 2919462493 | 2919465986 | 329 |
| 406 | iso_pu_bacteria | 2928037797 | 2928038762 | 329 |
| 407 | iso_pu_bacteria | 2928044640 | 2928045633 | 329 |
| 408 | iso_pu_bacteria | 2928051484 | 2928053250 | 329 |
| 409 | iso_pu_bacteria | 2928064002 | 2928066855 | 329 |
| 410 | iso_pu_bacteria | 2928070936 | 2928071258 | 329 |
| 411 | iso_pu_bacteria | 2928084124 | 2928084813 | 329 |
| 412 | iso_pu_bacteria | 2929160207 | 2929163583 | 329 |
| 413 | iso_pu_bacteria | 2929520902 | 2929526991 | 329 |
| 414 | iso_pu_bacteria | 2945909444 | 2945912270 | 329 |
| 415 | iso_pu_bacteria | 2945945610 | 2945948205 | 329 |
| 416 | iso_pu_bacteria | 2945984333 | 2945985418 | 329 |
| 417 | iso_pu_bacteria | 8054002106 | 8054008476 | 329 |
| 418 | 3300003187 | JGI25151J46595_10001070 | JGI25151J46595_1000107015 | 330 |
| 419 | 3300003771 | Ga0055526_1002671 | Ga0055526_10026712 | 330 |
| 420 | 3300003773 | Ga0055537_1001952 | Ga0055537_10019525 | 330 |
| 421 | 3300003775 | Ga0055524_1000987 | Ga0055524_100098713 | 330 |
| 422 | 3300003775 | Ga0055524_1010495 | Ga0055524_10104952 | 330 |
| 423 | 3300003784 | Ga0055534_1001022 | Ga0055534_10010226 | 330 |
| 424 | 3300006948 | Ga0099826_10000027 | Ga0099826_10000027106 | 330 |
| 425 | 3300009011 | Ga0105251_10024824 | Ga0105251_100248242 | 330 |
| 426 | 3300025263 | Ga0209565_1000840 | Ga0209565_100084016 | 330 |
| 427 | 3300025263 | Ga0209565_1005531 | Ga0209565_10055312 | 330 |
| 428 | 3300025291 | Ga0209675_1001153 | Ga0209675_10011532 | 330 |
| 429 | 3300025291 | Ga0209675_1006841 | Ga0209675_10068413 | 330 |
| 430 | 3300025294 | Ga0209025_1001156 | Ga0209025_100115628 | 330 |
| 431 | 3300025294 | Ga0209025_1002301 | Ga0209025_100230111 | 330 |
| 432 | 3300025295 | Ga0209564_1001617 | Ga0209564_10016177 | 330 |
| 433 | 3300025297 | Ga0209758_1025030 | Ga0209758_10250302 | 330 |
| 434 | 3300025299 | Ga0209256_1000127 | Ga0209256_100012748 | 330 |
| 435 | 3300025299 | Ga0209256_1001660 | Ga0209256_100166016 | 330 |
| 436 | 3300025303 | Ga0209051_1011223 | Ga0209051_10112232 | 330 |
| 437 | 3300027666 | Ga0209282_1000069 | Ga0209282_100006962 | 330 |
| 438 | iso_pu_bacteria | 2599185292 | 2599902924 | 330 |
| 439 | iso_pu_bacteria | 2643221569 | 2643861747 | 330 |
| 440 | iso_pu_bacteria | 2643221594 | 2643983218 | 330 |
| 441 | iso_pu_bacteria | 2643221621 | 2644123479 | 330 |
| 442 | iso_pu_bacteria | 2738543013 | 2739250454 | 330 |
| 443 | iso_pu_bacteria | 2808606395 | 2809033257 | 330 |
| 444 | iso_pu_bacteria | 2842333319 | 2842335009 | 330 |
| 445 | iso_pu_bacteria | 2857537821 | 2857538244 | 330 |
| 446 | iso_pu_bacteria | 2858950400 | 2858952054 | 330 |
| 447 | iso_pu_bacteria | 2904449895 | 2904454448 | 330 |
| 448 | iso_pu_bacteria | 2904456579 | 2904461109 | 330 |
| 449 | iso_pu_bacteria | 2941479691 | 2941482493 | 330 |
| 450 | iso_pu_bacteria | 2945972063 | 2945977150 | 330 |
| 451 | 3300001976 | JGI24752J21851_1012623 | JGI24752J21851_10126231 | 331 |
| 452 | 3300002077 | JGI24744J21845_10010624 | JGI24744J21845_100106241 | 331 |
| 453 | 3300002244 | JGI24742J22300_10017095 | JGI24742J22300_100170952 | 331 |
| 454 | 3300002459 | JGI24751J29686_10011003 | JGI24751J29686_100110031 | 331 |
| 455 | 3300005290 | Ga0065712_10207832 | Ga0065712_102078321 | 331 |
| 456 | 3300005293 | Ga0065715_10281030 | Ga0065715_102810301 | 331 |
| 457 | 3300005327 | Ga0070658_10345218 | Ga0070658_103452181 | 331 |
| 458 | 3300005328 | Ga0070676_10009016 | Ga0070676_100090164 | 331 |
| 459 | 3300005329 | Ga0070683_100016058 | Ga0070683_1000160582 | 331 |
| 460 | 3300005329 | Ga0070683_100038041 | Ga0070683_1000380413 | 331 |
| 461 | 3300005330 | Ga0070690_100194951 | Ga0070690_1001949511 | 331 |
| 462 | 3300005331 | Ga0070670_100007028 | Ga0070670_1000070285 | 331 |
| 463 | 3300005334 | Ga0068869_100006883 | Ga0068869_1000068835 | 331 |
| 464 | 3300005335 | Ga0070666_10036543 | Ga0070666_100365433 | 331 |
| 465 | 3300005338 | Ga0068868_100105100 | Ga0068868_1001051002 | 331 |
| 466 | 3300005338 | Ga0068868_100112968 | Ga0068868_1001129682 | 331 |
| 467 | 3300005339 | Ga0070660_100024939 | Ga0070660_1000249393 | 331 |
| 468 | 3300005340 | Ga0070689_100108410 | Ga0070689_1001084103 | 331 |
| 469 | 3300005344 | Ga0070661_100052808 | Ga0070661_1000528081 | 331 |
| 470 | 3300005345 | Ga0070692_10024699 | Ga0070692_100246992 | 331 |
| 471 | 3300005347 | Ga0070668_100037769 | Ga0070668_1000377692 | 331 |
| 472 | 3300005353 | Ga0070669_100091165 | Ga0070669_1000911652 | 331 |
| 473 | 3300005355 | Ga0070671_100013333 | Ga0070671_1000133336 | 331 |
| 474 | 3300005355 | Ga0070671_100068661 | Ga0070671_1000686611 | 331 |
| 475 | 3300005356 | Ga0070674_100126153 | Ga0070674_1001261532 | 331 |
| 476 | 3300005365 | Ga0070688_100046408 | Ga0070688_1000464082 | 331 |
| 477 | 3300005366 | Ga0070659_100085438 | Ga0070659_1000854382 | 331 |
| 478 | 3300005366 | Ga0070659_100228912 | Ga0070659_1002289121 | 331 |
| 479 | 3300005367 | Ga0070667_100276296 | Ga0070667_1002762961 | 331 |
| 480 | 3300005434 | Ga0070709_10247758 | Ga0070709_102477582 | 331 |
| 481 | 3300005438 | Ga0070701_10016695 | Ga0070701_100166951 | 331 |
| 482 | 3300005439 | Ga0070711_100224782 | Ga0070711_1002247821 | 331 |
| 483 | 3300005441 | Ga0070700_100012190 | Ga0070700_1000121903 | 331 |
| 484 | 3300005455 | Ga0070663_100010823 | Ga0070663_1000108232 | 331 |
| 485 | 3300005456 | Ga0070678_100081283 | Ga0070678_1000812832 | 331 |
| 486 | 3300005457 | Ga0070662_100071446 | Ga0070662_1000714462 | 331 |
| 487 | 3300005466 | Ga0070685_10008963 | Ga0070685_100089632 | 331 |
| 488 | 3300005535 | Ga0070684_100005497 | Ga0070684_1000054973 | 331 |
| 489 | 3300005547 | Ga0070693_100047331 | Ga0070693_1000473312 | 331 |
| 490 | 3300005563 | Ga0068855_100140928 | Ga0068855_1001409282 | 331 |
| 491 | 3300005564 | Ga0070664_100005648 | Ga0070664_1000056483 | 331 |
| 492 | 3300005564 | Ga0070664_100203650 | Ga0070664_1002036502 | 331 |
| 493 | 3300005577 | Ga0068857_100133759 | Ga0068857_1001337592 | 331 |
| 494 | 3300005578 | Ga0068854_100013238 | Ga0068854_1000132382 | 331 |
| 495 | 3300005614 | Ga0068856_100107344 | Ga0068856_1001073442 | 331 |
| 496 | 3300005615 | Ga0070702_100032707 | Ga0070702_1000327073 | 331 |
| 497 | 3300005616 | Ga0068852_100043337 | Ga0068852_1000433372 | 331 |
| 498 | 3300005617 | Ga0068859_100291338 | Ga0068859_1002913381 | 331 |
| 499 | 3300005618 | Ga0068864_100059378 | Ga0068864_1000593782 | 331 |
| 500 | 3300005719 | Ga0068861_100095858 | Ga0068861_1000958582 | 331 |
| 501 | 3300005842 | Ga0068858_100018789 | Ga0068858_1000187895 | 331 |
| 502 | 3300005842 | Ga0068858_100108207 | Ga0068858_1001082072 | 331 |
| 503 | 3300005843 | Ga0068860_100145104 | Ga0068860_1001451042 | 331 |
| 504 | 3300005844 | Ga0068862_100011044 | Ga0068862_1000110444 | 331 |
| 505 | 3300006175 | Ga0070712_100014780 | Ga0070712_1000147804 | 331 |
| 506 | 3300006237 | Ga0097621_100108313 | Ga0097621_1001083133 | 331 |
| 507 | 3300006358 | Ga0068871_100086507 | Ga0068871_1000865072 | 331 |
| 508 | 3300006881 | Ga0068865_100020605 | Ga0068865_1000206053 | 331 |
| 509 | 3300006931 | Ga0097620_100291337 | Ga0097620_1002913372 | 331 |
| 510 | 3300009094 | Ga0111539_10033508 | Ga0111539_100335082 | 331 |
| 511 | 3300009098 | Ga0105245_10037607 | Ga0105245_100376072 | 331 |
| 512 | 3300009148 | Ga0105243_10017874 | Ga0105243_100178742 | 331 |
| 513 | 3300009176 | Ga0105242_10121024 | Ga0105242_101210243 | 331 |
| 514 | 3300009545 | Ga0105237_10063747 | Ga0105237_100637473 | 331 |
| 515 | 3300013102 | Ga0157371_10086060 | Ga0157371_100860601 | 331 |
| 516 | 3300013296 | Ga0157374_10133683 | Ga0157374_101336832 | 331 |
| 517 | 3300013297 | Ga0157378_10011046 | Ga0157378_100110467 | 331 |
| 518 | 3300014325 | Ga0163163_10010625 | Ga0163163_100106252 | 331 |
| 519 | 3300014326 | Ga0157380_10120306 | Ga0157380_101203062 | 331 |
| 520 | 3300014968 | Ga0157379_10011595 | Ga0157379_100115953 | 331 |
| 521 | 3300014969 | Ga0157376_10079954 | Ga0157376_100799541 | 331 |
| 522 | 3300017792 | Ga0163161_10268497 | Ga0163161_102684971 | 331 |
| 523 | 3300025290 | Ga0207673_1001090 | Ga0207673_10010902 | 331 |
| 524 | 3300025315 | Ga0207697_10000857 | Ga0207697_1000085718 | 331 |
| 525 | 3300025321 | Ga0207656_10005144 | Ga0207656_100051444 | 331 |
| 526 | 3300025321 | Ga0207656_10007254 | Ga0207656_100072542 | 331 |
| 527 | 3300025893 | Ga0207682_10000120 | Ga0207682_100001208 | 331 |
| 528 | 3300025903 | Ga0207680_10065967 | Ga0207680_100659671 | 331 |
| 529 | 3300025907 | Ga0207645_10001475 | Ga0207645_1000147511 | 331 |
| 530 | 3300025908 | Ga0207643_10000681 | Ga0207643_1000068116 | 331 |
| 531 | 3300025909 | Ga0207705_10030042 | Ga0207705_100300424 | 331 |
| 532 | 3300025918 | Ga0207662_10004254 | Ga0207662_100042543 | 331 |
| 533 | 3300025919 | Ga0207657_10005234 | Ga0207657_100052349 | 331 |
| 534 | 3300025920 | Ga0207649_10021763 | Ga0207649_100217633 | 331 |
| 535 | 3300025920 | Ga0207649_10215899 | Ga0207649_102158991 | 331 |
| 536 | 3300025923 | Ga0207681_10023616 | Ga0207681_100236162 | 331 |
| 537 | 3300025925 | Ga0207650_10009669 | Ga0207650_100096692 | 331 |
| 538 | 3300025925 | Ga0207650_10071477 | Ga0207650_100714772 | 331 |
| 539 | 3300025926 | Ga0207659_10009618 | Ga0207659_100096185 | 331 |
| 540 | 3300025931 | Ga0207644_10008335 | Ga0207644_100083357 | 331 |
| 541 | 3300025931 | Ga0207644_10094604 | Ga0207644_100946042 | 331 |
| 542 | 3300025933 | Ga0207706_10000850 | Ga0207706_100008508 | 331 |
| 543 | 3300025934 | Ga0207686_10314153 | Ga0207686_103141531 | 331 |
| 544 | 3300025937 | Ga0207669_10008390 | Ga0207669_100083903 | 331 |
| 545 | 3300025938 | Ga0207704_10018726 | Ga0207704_100187263 | 331 |
| 546 | 3300025940 | Ga0207691_10020172 | Ga0207691_100201725 | 331 |
| 547 | 3300025941 | Ga0207711_10066931 | Ga0207711_100669312 | 331 |
| 548 | 3300025942 | Ga0207689_10000307 | Ga0207689_1000030726 | 331 |
| 549 | 3300025944 | Ga0207661_10017959 | Ga0207661_100179593 | 331 |
| 550 | 3300025944 | Ga0207661_10275474 | Ga0207661_102754742 | 331 |
| 551 | 3300025945 | Ga0207679_10015100 | Ga0207679_100151005 | 331 |
| 552 | 3300025945 | Ga0207679_10019703 | Ga0207679_100197033 | 331 |
| 553 | 3300025972 | Ga0207668_10009980 | Ga0207668_100099804 | 331 |
| 554 | 3300025981 | Ga0207640_10067975 | Ga0207640_100679751 | 331 |
| 555 | 3300025981 | Ga0207640_10078491 | Ga0207640_100784912 | 331 |
| 556 | 3300025986 | Ga0207658_10092294 | Ga0207658_100922941 | 331 |
| 557 | 3300026023 | Ga0207677_10090162 | Ga0207677_100901622 | 331 |
| 558 | 3300026035 | Ga0207703_10026771 | Ga0207703_100267713 | 331 |
| 559 | 3300026041 | Ga0207639_10107710 | Ga0207639_101077102 | 331 |
| 560 | 3300026067 | Ga0207678_10001655 | Ga0207678_1000165515 | 331 |
| 561 | 3300026075 | Ga0207708_10000529 | Ga0207708_100005298 | 331 |
| 562 | 3300026078 | Ga0207702_10246674 | Ga0207702_102466741 | 331 |
| 563 | 3300026088 | Ga0207641_10063711 | Ga0207641_100637111 | 331 |
| 564 | 3300026089 | Ga0207648_10002743 | Ga0207648_1000274314 | 331 |
| 565 | 3300026095 | Ga0207676_10037987 | Ga0207676_100379873 | 331 |
| 566 | 3300026116 | Ga0207674_10003249 | Ga0207674_1000324910 | 331 |
| 567 | 3300026116 | Ga0207674_10093743 | Ga0207674_100937432 | 331 |
| 568 | 3300026118 | Ga0207675_100058990 | Ga0207675_1000589903 | 331 |
| 569 | 3300026121 | Ga0207683_10010884 | Ga0207683_100108842 | 331 |
| 570 | 3300026142 | Ga0207698_10016839 | Ga0207698_100168394 | 331 |
| 571 | 3300028379 | Ga0268266_10127158 | Ga0268266_101271583 | 331 |
| 572 | 3300028380 | Ga0268265_10046919 | Ga0268265_100469192 | 331 |
| 573 | 3300028381 | Ga0268264_10129464 | Ga0268264_101294642 | 331 |
| 574 | 3300035172 | Ga0373955_0213183 | Ga0373955_0213183_40_1041 | 331 |
| 575 | 3300035724 | Ga0373933_0092230 | Ga0373933_0092230_521_1522 | 331 |
| 576 | 3300035725 | Ga0373947_0148886 | Ga0373947_0148886_437_1438 | 331 |
| 577 | 3300046539 | Ga0495621_0026542 | Ga0495621_0026542_860_1861 | 331 |
| 578 | 3300048904 | Ga0496101_0020827 | Ga0496101_0020827_2054_3055 | 331 |
| 579 | 3300048905 | Ga0496102_0061675 | Ga0496102_0061675_2342_3343 | 331 |
| 580 | 3300048906 | Ga0496103_0015705 | Ga0496103_0015705_339_1337 | 331 |
| 581 | 3300048909 | Ga0496106_0173091 | Ga0496106_0173091_507_1508 | 331 |
| 582 | 3300048911 | Ga0496108_0015385 | Ga0496108_0015385_1937_2938 | 331 |
| 583 | 3300048911 | Ga0496108_0078227 | Ga0496108_0078227_1469_2467 | 331 |
| 584 | 3300048912 | Ga0496109_0005385 | Ga0496109_0005385_4768_5769 | 331 |
| 585 | 3300048913 | Ga0496110_0055926 | Ga0496110_0055926_190_1188 | 331 |
| 586 | 3300048917 | Ga0496114_0106912 | Ga0496114_0106912_1137_2138 | 331 |
| 587 | 3300050511 | nmdc:mga08y16_169739_c1 | nmdc:mga08y16_169739_c1_201_1202 | 331 |
| 588 | iso_pu_bacteria | 2511231002 | 2511245938 | 331 |
| 589 | 3300013105 | Ga0157369_10205582 | Ga0157369_102055822 | 332 |
| 590 | 3300003187 | JGI25151J46595_10000556 | JGI25151J46595_1000055622 | 333 |
| 591 | 3300003215 | JGI25153J46596_10016831 | JGI25153J46596_100168312 | 333 |
| 592 | 3300003354 | JGI25160J50197_1010348 | JGI25160J50197_10103482 | 333 |
| 593 | 3300003374 | JGI25161J50226_1005856 | JGI25161J50226_10058563 | 333 |
| 594 | 3300003761 | Ga0055535_1001386 | Ga0055535_100138610 | 333 |
| 595 | 3300003762 | Ga0055542_1000021 | Ga0055542_1000021263 | 333 |
| 596 | 3300003771 | Ga0055526_1009970 | Ga0055526_10099702 | 333 |
| 597 | 3300003781 | Ga0055536_1000657 | Ga0055536_10006578 | 333 |
| 598 | 3300003781 | Ga0055536_1001022 | Ga0055536_100102220 | 333 |
| 599 | 3300003784 | Ga0055534_1005386 | Ga0055534_10053862 | 333 |
| 600 | 3300003791 | Ga0055530_10000453 | Ga0055530_1000045322 | 333 |
| 601 | 3300005844 | Ga0068862_100072612 | Ga0068862_1000726123 | 333 |
| 602 | 3300006195 | Ga0075366_10008599 | Ga0075366_100085993 | 333 |
| 603 | 3300006237 | Ga0097621_100135946 | Ga0097621_1001359462 | 333 |
| 604 | 3300006353 | Ga0075370_10003631 | Ga0075370_100036313 | 333 |
| 605 | 3300006353 | Ga0075370_10007859 | Ga0075370_100078591 | 333 |
| 606 | 3300006353 | Ga0075370_10011390 | Ga0075370_100113904 | 333 |
| 607 | 3300006353 | Ga0075370_10127413 | Ga0075370_101274132 | 333 |
| 608 | 3300017792 | Ga0163161_10001014 | Ga0163161_1000101415 | 333 |
| 609 | 3300025208 | Ga0209436_105668 | Ga0209436_1056683 | 333 |
| 610 | 3300025229 | Ga0209147_101220 | Ga0209147_10122010 | 333 |
| 611 | 3300025242 | Ga0209258_100058 | Ga0209258_100058262 | 333 |
| 612 | 3300025254 | Ga0209148_1000071 | Ga0209148_1000071262 | 333 |
| 613 | 3300025258 | Ga0209129_1005627 | Ga0209129_10056272 | 333 |
| 614 | 3300025258 | Ga0209129_1006005 | Ga0209129_10060051 | 333 |
| 615 | 3300025263 | Ga0209565_1006363 | Ga0209565_10063634 | 333 |
| 616 | 3300025273 | Ga0209673_1000066 | Ga0209673_1000066203 | 333 |
| 617 | 3300025284 | Ga0209130_1000816 | Ga0209130_10008165 | 333 |
| 618 | 3300025284 | Ga0209130_1004224 | Ga0209130_10042243 | 333 |
| 619 | 3300025291 | Ga0209675_1008946 | Ga0209675_10089462 | 333 |
| 620 | 3300025291 | Ga0209675_1026318 | Ga0209675_10263182 | 333 |
| 621 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005764 | 333 |
| 622 | 3300025294 | Ga0209025_1000351 | Ga0209025_100035169 | 333 |
| 623 | 3300025294 | Ga0209025_1000766 | Ga0209025_100076632 | 333 |
| 624 | 3300025294 | Ga0209025_1003418 | Ga0209025_100341815 | 333 |
| 625 | 3300025294 | Ga0209025_1017671 | Ga0209025_10176713 | 333 |
| 626 | 3300025295 | Ga0209564_1000090 | Ga0209564_1000090187 | 333 |
| 627 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007333 | 333 |
| 628 | 3300025299 | Ga0209256_1000022 | Ga0209256_1000022106 | 333 |
| 629 | 3300025302 | Ga0207426_1000031 | Ga0207426_1000031262 | 333 |
| 630 | 3300025303 | Ga0209051_1000036 | Ga0209051_1000036115 | 333 |
| 631 | 3300025303 | Ga0209051_1031858 | Ga0209051_10318582 | 333 |
| 632 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011738 | 333 |
| 633 | 3300025304 | Ga0209257_1011452 | Ga0209257_10114523 | 333 |
| 634 | 3300025728 | Ga0207655_1008917 | Ga0207655_10089172 | 333 |
| 635 | 3300025935 | Ga0207709_10003703 | Ga0207709_100037032 | 333 |
| 636 | 3300025945 | Ga0207679_10009175 | Ga0207679_100091753 | 333 |
| 637 | 3300026116 | Ga0207674_10050112 | Ga0207674_100501123 | 333 |
| 638 | 3300026121 | Ga0207683_10062761 | Ga0207683_100627613 | 333 |
| 639 | 3300027666 | Ga0209282_1089479 | Ga0209282_10894792 | 333 |
| 640 | 3300028380 | Ga0268265_10015157 | Ga0268265_100151574 | 333 |
| 641 | 3300030732 | Ga0316176_1111959 | Ga0316176_11119592 | 333 |
| 642 | 3300030733 | Ga0314311_1018953 | Ga0314311_10189534 | 333 |
| 643 | 3300030742 | Ga0316183_1163725 | Ga0316183_11637252 | 333 |
| 644 | 3300030744 | Ga0316181_1083351 | Ga0316181_10833514 | 333 |
| 645 | 3300031548 | Ga0307408_100036080 | Ga0307408_1000360803 | 333 |
| 646 | 3300032002 | Ga0307416_100031041 | Ga0307416_1000310412 | 333 |
| 647 | 3300041413 | Ga0439465_0000905 | Ga0439465_0000905_8337_9338 | 333 |
| 648 | 3300042004 | Ga0439445_0000950 | Ga0439445_0000950_4637_5638 | 333 |
| 649 | 3300042007 | Ga0439449_0000923 | Ga0439449_0000923_3077_4078 | 333 |
| 650 | 3300042014 | Ga0439457_002549 | Ga0439457_002549_106_1128 | 333 |
| 651 | 3300050496 | nmdc:mga07m45_6054_c1 | nmdc:mga07m45_6054_c1_967_1977 | 333 |
| 652 | 2162886007 | SwRhRL2b_contig_3784724 | SwRhRL2b_0136.00008440 | 334 |
| 653 | 3300005289 | Ga0065704_10169162 | Ga0065704_101691621 | 334 |
| 654 | 3300028794 | Ga0307515_10000267 | Ga0307515_1000026740 | 334 |
| 655 | 3300031456 | Ga0307513_10013784 | Ga0307513_100137848 | 334 |
| 656 | 3300031548 | Ga0307408_100112537 | Ga0307408_1001125372 | 334 |
| 657 | 3300031649 | Ga0307514_10000806 | Ga0307514_1000080610 | 334 |
| 658 | 3300031911 | Ga0307412_10085387 | Ga0307412_100853872 | 334 |
| 659 | 3300048928 | Ga0496125_0001023 | Ga0496125_0001023_25130_26134 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pi5-assembly4.cif.gz_D | the evolving story of atzt, a periplasmic binding protein | 0.9113 | 32 | 321 |
| 7x0r-assembly1.cif.gz_A | crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum | 0.8993 | 32 | 323 |
| 3s99-assembly1.cif.gz_A | crystal structure of a basic membrane lipoprotein from brucella melitensis, iodide soak | 0.8882 | 32 | 321 |
| 6shu-assembly1.cif.gz_A | borrelia burgdorferi bmpd nucleoside binding protein bound to adenosine | 0.8735 | 30 | 325 |
| 2hqb-assembly1.cif.gz_A | crystal structure of a transcriptional activator of comk gene from bacillus halodurans | 0.8468 | 33 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3s99A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8935 | 135 | 321 | 3.40.50.2300 |
| 2fqwA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8889 | 31 | 131 | 3.40.50.2300 |
| 3s99A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8692 | 32 | 131 | 3.40.50.2300 |
| 4p98A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8374 | 35 | 131 | 3.40.50.2300 |
| 4iilA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8141 | 135 | 323 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833G2L3-F1-model_v4 | BMP family ABC transporter substrate-binding protein | 0.9907 | 47 | 332 |
GO:0005886
|
| AF-A0A530APJ8-F1-model_v4 | BMP family ABC transporter substrate-binding protein | 0.9884 | 133 | 331 |
GO:0005886
|
| AF-V7EVA4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9851 | 92 | 331 |
GO:0005886
|
| AF-A0A530APJ8-F1-model_v4 | BMP family ABC transporter substrate-binding protein | 0.9787 | 133 | 331 |
GO:0005886
|
| AF-A0A833G2L3-F1-model_v4 | BMP family ABC transporter substrate-binding protein | 0.9772 | 47 | 332 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar