F473244

General Info

Members Datasets Scaffolds Average Seq Length
659 348 595 333

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10205582|Ga0157369_102055822
Length 403
Sequence VPARLASFVLLAASATVAHAADEAASTPGADATPEKAWSFALTAYPTAVRGGEDYTSAIATADRASLHLEARYNYESIGARSAYVGWTFAGGASLALAQGKLKVAAVYTVPVEQQWVSRIHKALNEAKGRGEIEYVFSEKVANADYERVMREFAEKGNQLIVGESFAVEAAARKVAKDYPKTAFLMGSSGKPQAPNFAVFDNYIQEPAYLTGMIAGGMTKTNRIGMVGGYPIPEVNRLMHAFMAGARDVNPNVQFTVTFIGSWFDPPKAKEAAFAMIEKGADVLYAERFGVSDAAKERGKLAIGNVIDTQKDYPNTVVASALWNMEPTIDRAIAAVKSNTFKAEDYGQYSLMKNKGSELAPLGTFASKVPADLQAKVKAKEKDILDGKLKVAVVETEPKSTTK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
4 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
5 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
8 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
9 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
10 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
11 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
12 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
13 2643221569 Achromobacter sp. Root565 Isolate Unclassified
14 2643221594 Achromobacter sp. Root170 Isolate Unclassified
15 2643221621 Achromobacter sp. Root83 Isolate Unclassified
16 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
17 2643221658 Variovorax sp. Root411 Isolate Unclassified
18 2643221672 Variovorax sp. Root434 Isolate Unclassified
19 2643221683 Variovorax sp. Root473 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738543013 Variovorax sp. BT01 Isolate Unclassified
23 2738543019 Variovorax sp. GV040 Isolate Unclassified
24 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
27 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
28 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
29 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
30 2842677519 Variovorax sp. R-72495 Isolate Unclassified
31 2842733646 Variovorax sp. R-72446 Isolate Unclassified
32 2842747753 Variovorax sp. R-72060 Isolate Unclassified
33 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
34 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
35 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
36 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
37 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
38 2858950400 Achromobacter sp. K91 Isolate Unclassified
39 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
40 2885198086 Variovorax sp. 679 Isolate Unclassified
41 2885211737 Variovorax sp. 553 Isolate Unclassified
42 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
43 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
44 2899924645 Variovorax sp. 369 Isolate Unclassified
45 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
46 2904456579 Variovorax sp. 2002 Isolate Unclassified
47 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
48 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
49 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
50 2928037797 Variovorax sp. 1126 Isolate Unclassified
51 2928044640 Variovorax sp. 1128 Isolate Unclassified
52 2928051484 Variovorax sp. 1133 Isolate Unclassified
53 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
54 2928070936 Variovorax gossypii 1167 Isolate Unclassified
55 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
56 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
57 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
58 2929520902 Variovorax beijingensis 502 Isolate Unclassified
59 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
60 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
61 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
62 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
63 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
64 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
65 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
66 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
67 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
68 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
69 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
70 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
71 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
72 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
73 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
76 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
77 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
78 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
79 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
80 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
81 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
82 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
83 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
84 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
85 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
86 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
87 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
88 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
89 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
90 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
91 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
92 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
93 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
94 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
95 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
96 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
97 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
98 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
99 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
100 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
101 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
102 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
103 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
104 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
105 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
106 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
107 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
108 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
109 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
110 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
111 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
112 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
113 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
114 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
115 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
116 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
117 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
118 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
119 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
120 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
121 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
122 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
123 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
124 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
125 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
126 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
127 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
128 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
129 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
132 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
133 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
134 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
135 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
136 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
137 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
138 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
139 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
140 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
141 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
142 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
143 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
144 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
145 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
146 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
147 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
148 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
149 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
150 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
151 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
152 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
153 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
154 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
155 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
156 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
157 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
158 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
159 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
161 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
162 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
163 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
164 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
165 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
167 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
168 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
169 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
170 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
174 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
175 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
179 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
180 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
181 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
184 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
185 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
186 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
187 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
188 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
189 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
190 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
191 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
192 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
193 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
196 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
197 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
198 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
200 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
201 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
204 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
205 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
208 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
210 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
213 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
268 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
270 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
274 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
275 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
276 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
277 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
278 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
279 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
280 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
281 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
282 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
283 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
284 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
285 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
286 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
287 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
288 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
289 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
290 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
291 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
292 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
293 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
294 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
295 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
296 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
297 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
298 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
299 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
300 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
301 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
302 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
303 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
304 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
305 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
306 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
307 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
308 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
309 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
312 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
345 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
346 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
347 641522639 Methylobacterium sp. 4-46 Isolate Nodule
348 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.29
Metatranscriptomes 0
Isolates 9.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.88
Nodule 1.21
Rhizoplane 2.73
Rhizosphere 63.73
Stem 0
Stem Tuber 0
Unclassified 12.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3784724 2162886007 Bacteria 1193
2 JGI24752J21851_1012623 3300001976 Bacteria 1105
3 JGI24744J21845_10010624 3300002077 Bacteria 1885
4 JGI24742J22300_10017095 3300002244 Bacteria 1225
5 JGI24751J29686_10011003 3300002459 Bacteria 1865
6 JGI25155J39150_1000002 3300002704 Bacteria 292156
7 JGI25156J39149_1000003 3300002705 Bacteria 305434
8 JGI25154J39366_1000009 3300002738 Bacteria 305408
9 JGI25157J39369_1000002 3300002741 Bacteria 305434
10 JGI25159J45721_1006315 3300002987 Bacteria 3567
11 JGI25151J46595_10000556 3300003187 Bacteria 33939
12 JGI25151J46595_10001070 3300003187 Bacteria 20411
13 JGI25151J46595_10009742 3300003187 Bacteria 4526
14 JGI25151J46595_10010218 3300003187 Bacteria 4377
15 JGI25153J46596_10001768 3300003215 Bacteria 12822
16 JGI25153J46596_10016831 3300003215 Bacteria 2909
17 JGI25160J50197_1000123 3300003354 Bacteria 70031
18 JGI25160J50197_1004001 3300003354 Bacteria 6433
19 JGI25160J50197_1010348 3300003354 Bacteria 3379
20 JGI25161J50226_1000032 3300003374 Bacteria 138440
21 JGI25161J50226_1005856 3300003374 Bacteria 2307
22 Ga0055535_1001386 3300003761 Bacteria 12574
23 Ga0055542_1000021 3300003762 Bacteria 331499
24 Ga0055526_1002671 3300003771 Bacteria 11909
25 Ga0055526_1009970 3300003771 Bacteria 4487
26 Ga0055537_1001952 3300003773 Bacteria 7365
27 Ga0055524_1000012 3300003775 Bacteria 260384
28 Ga0055524_1000987 3300003775 Bacteria 17754
29 Ga0055524_1010495 3300003775 Bacteria 3682
30 Ga0055536_1000657 3300003781 Bacteria 23356
31 Ga0055536_1001022 3300003781 Bacteria 17664
32 Ga0055534_1001022 3300003784 Bacteria 12273
33 Ga0055534_1005386 3300003784 Bacteria 3434
34 Ga0055528_1007069 3300003790 Bacteria 5016
35 Ga0055530_10000453 3300003791 Bacteria 36520
36 Ga0055530_10000793 3300003791 Bacteria 26295
37 Ga0055540_1000012 3300003792 Bacteria 262667
38 Ga0055540_1003742 3300003792 Bacteria 7190
39 Ga0055531_10002524 3300003794 Bacteria 12183
40 Ga0055543_1000294 3300004625 Bacteria 35881
41 Ga0065165_1018453 3300005262 Bacteria 2524
42 Ga0065165_1028107 3300005262 Bacteria 1821
43 Ga0065704_10079326 3300005289 Bacteria 4194
44 Ga0065704_10169162 3300005289 Bacteria 1302
45 Ga0065712_10207832 3300005290 Bacteria 1082
46 Ga0065715_10281030 3300005293 Bacteria 1086
47 Ga0070658_10196826 3300005327 Bacteria 1699
48 Ga0070658_10345218 3300005327 Bacteria 1273
49 Ga0070676_10009016 3300005328 Bacteria 5397
50 Ga0070676_10057247 3300005328 Bacteria 2306
51 Ga0070683_100016058 3300005329 Bacteria 6590
52 Ga0070683_100038041 3300005329 Bacteria 4409
53 Ga0070690_100106265 3300005330 Bacteria 1867
54 Ga0070690_100194951 3300005330 Bacteria 1406
55 Ga0070670_100007028 3300005331 Bacteria 9536
56 Ga0070670_100008068 3300005331 Bacteria 8956
57 Ga0070677_10013807 3300005333 Bacteria 2833
58 Ga0068869_100006883 3300005334 Bacteria 7233
59 Ga0068869_100009675 3300005334 Bacteria 6258
60 Ga0068869_100014498 3300005334 Bacteria 5266
61 Ga0070666_10036543 3300005335 Bacteria 3261
62 Ga0068868_100080157 3300005338 Bacteria 2616
63 Ga0068868_100105100 3300005338 Bacteria 2289
64 Ga0068868_100112968 3300005338 Bacteria 2208
65 Ga0068868_100184182 3300005338 Bacteria 1734
66 Ga0070660_100024939 3300005339 Bacteria 4440
67 Ga0070689_100108410 3300005340 Bacteria 2206
68 Ga0070689_100307199 3300005340 Bacteria 1322
69 Ga0070661_100052808 3300005344 Bacteria 2974
70 Ga0070661_100317260 3300005344 Bacteria 1217
71 Ga0070692_10024699 3300005345 Bacteria 2956
72 Ga0070668_100037769 3300005347 Bacteria 3690
73 Ga0070668_100060654 3300005347 Bacteria 2930
74 Ga0070669_100018890 3300005353 Bacteria 4927
75 Ga0070669_100079455 3300005353 Bacteria 2439
76 Ga0070669_100091165 3300005353 Bacteria 2285
77 Ga0070669_100117767 3300005353 Bacteria 2022
78 Ga0070675_100001733 3300005354 Bacteria 16097
79 Ga0070675_100014312 3300005354 Bacteria 6254
80 Ga0070675_100028703 3300005354 Bacteria 4479
81 Ga0070671_100004476 3300005355 Bacteria 11061
82 Ga0070671_100013333 3300005355 Bacteria 6626
83 Ga0070671_100068661 3300005355 Bacteria 2956
84 Ga0070674_100005616 3300005356 Bacteria 7265
85 Ga0070674_100057946 3300005356 Bacteria 2691
86 Ga0070674_100126153 3300005356 Bacteria 1901
87 Ga0070674_100206818 3300005356 Bacteria 1519
88 Ga0070673_100009444 3300005364 Bacteria 6546
89 Ga0070688_100046408 3300005365 Bacteria 2690
90 Ga0070659_100085438 3300005366 Bacteria 2523
91 Ga0070659_100228912 3300005366 Bacteria 1536
92 Ga0070667_100016492 3300005367 Bacteria 6113
93 Ga0070667_100241592 3300005367 Bacteria 1613
94 Ga0070667_100276296 3300005367 Bacteria 1507
95 Ga0070709_10247758 3300005434 Bacteria 1282
96 Ga0070701_10016695 3300005438 Bacteria 3418
97 Ga0070711_100224782 3300005439 Bacteria 1461
98 Ga0070705_100220159 3300005440 Bacteria 1314
99 Ga0070700_100012190 3300005441 Bacteria 4788
100 Ga0070663_100010823 3300005455 Bacteria 5698
101 Ga0070678_100008501 3300005456 Bacteria 6149
102 Ga0070678_100013926 3300005456 Bacteria 5057
103 Ga0070678_100068917 3300005456 Bacteria 2639
104 Ga0070678_100081283 3300005456 Bacteria 2456
105 Ga0070678_100176557 3300005456 Bacteria 1745
106 Ga0070662_100007540 3300005457 Bacteria 7060
107 Ga0070662_100016060 3300005457 Bacteria 5022
108 Ga0070662_100071446 3300005457 Bacteria 2559
109 Ga0070681_10036162 3300005458 Bacteria 4961
110 Ga0068867_100005155 3300005459 Bacteria 9226
111 Ga0068867_100021447 3300005459 Bacteria 4609
112 Ga0068867_100068017 3300005459 Bacteria 2657
113 Ga0070685_10008963 3300005466 Bacteria 5159
114 Ga0070684_100005497 3300005535 Bacteria 9714
115 Ga0068853_100096607 3300005539 Bacteria 2607
116 Ga0068853_100354329 3300005539 Bacteria 1366
117 Ga0070672_100004667 3300005543 Bacteria 8984
118 Ga0070672_100010425 3300005543 Bacteria 6449
119 Ga0070695_100177467 3300005545 Bacteria 1507
120 Ga0070693_100047331 3300005547 Bacteria 2447
121 Ga0070665_100203426 3300005548 Bacteria 1980
122 Ga0068855_100140928 3300005563 Bacteria 2748
123 Ga0070664_100005648 3300005564 Bacteria 10071
124 Ga0070664_100203650 3300005564 Bacteria 1767
125 Ga0068857_100051888 3300005577 Bacteria 3640
126 Ga0068857_100133759 3300005577 Bacteria 2238
127 Ga0068854_100013238 3300005578 Bacteria 5407
128 Ga0068856_100107344 3300005614 Bacteria 2787
129 Ga0070702_100032707 3300005615 Bacteria 2855
130 Ga0068852_100043337 3300005616 Bacteria 3816
131 Ga0068852_100162799 3300005616 Bacteria 2084
132 Ga0068859_100046409 3300005617 Bacteria 4362
133 Ga0068859_100291338 3300005617 Bacteria 1725
134 Ga0068864_100002200 3300005618 Bacteria 16087
135 Ga0068864_100045661 3300005618 Bacteria 3758
136 Ga0068864_100059378 3300005618 Bacteria 3309
137 Ga0068864_100089148 3300005618 Bacteria 2717
138 Ga0068864_100153517 3300005618 Bacteria 2088
139 Ga0068864_100242456 3300005618 Bacteria 1670
140 Ga0068866_10031509 3300005718 Bacteria 2555
141 Ga0068861_100002547 3300005719 Bacteria 11913
142 Ga0068861_100095858 3300005719 Bacteria 2350
143 Ga0068861_100265810 3300005719 Bacteria 1471
144 Ga0068870_10150193 3300005840 Bacteria 1371
145 Ga0068863_100002680 3300005841 Bacteria 17598
146 Ga0068863_100022184 3300005841 Bacteria 6061
147 Ga0068863_100054985 3300005841 Bacteria 3770
148 Ga0068858_100018789 3300005842 Bacteria 6466
149 Ga0068858_100057687 3300005842 Bacteria 3588
150 Ga0068858_100108207 3300005842 Bacteria 2595
151 Ga0068860_100004285 3300005843 Bacteria 14582
152 Ga0068860_100100333 3300005843 Bacteria 2762
153 Ga0068860_100102229 3300005843 Bacteria 2735
154 Ga0068860_100145104 3300005843 Bacteria 2283
155 Ga0068860_100235221 3300005843 Bacteria 1781
156 Ga0068862_100011044 3300005844 Bacteria 7459
157 Ga0068862_100011483 3300005844 Bacteria 7312
158 Ga0068862_100038440 3300005844 Bacteria 4059
159 Ga0068862_100072612 3300005844 Bacteria 2973
160 Ga0068862_100090846 3300005844 Bacteria 2659
161 Ga0068862_100250020 3300005844 Bacteria 1615
162 Ga0068862_100326014 3300005844 Bacteria 1419
163 Ga0081455_10128564 3300005937 Bacteria 1984
164 Ga0081455_10236012 3300005937 Bacteria 1346
165 Ga0075368_10074870 3300006042 Bacteria 1372
166 Ga0075363_100006291 3300006048 Bacteria 5378
167 Ga0070712_100014780 3300006175 Bacteria 5015
168 Ga0075362_10018253 3300006177 Bacteria 2899
169 Ga0075362_10050113 3300006177 Bacteria 1866
170 Ga0075367_10002951 3300006178 Bacteria 7945
171 Ga0075366_10008599 3300006195 Bacteria 5684
172 Ga0075366_10018117 3300006195 Bacteria 4066
173 Ga0075366_10073340 3300006195 Bacteria 2040
174 Ga0097621_100017078 3300006237 Bacteria 5504
175 Ga0097621_100074079 3300006237 Bacteria 2819
176 Ga0097621_100108313 3300006237 Bacteria 2345
177 Ga0097621_100135946 3300006237 Bacteria 2097
178 Ga0075370_10000581 3300006353 Bacteria 14080
179 Ga0075370_10003631 3300006353 Bacteria 7384
180 Ga0075370_10007859 3300006353 Bacteria 5457
181 Ga0075370_10011390 3300006353 Bacteria 4670
182 Ga0075370_10028017 3300006353 Bacteria 3129
183 Ga0075370_10029780 3300006353 Bacteria 3042
184 Ga0075370_10127413 3300006353 Bacteria 1484
185 Ga0068871_100005755 3300006358 Bacteria 8703
186 Ga0068871_100011783 3300006358 Bacteria 6425
187 Ga0068871_100032087 3300006358 Bacteria 4145
188 Ga0068871_100063833 3300006358 Bacteria 3013
189 Ga0068871_100086507 3300006358 Bacteria 2604
190 Ga0075434_100369756 3300006871 Bacteria 1455
191 Ga0068865_100020605 3300006881 Bacteria 4277
192 Ga0068865_100023958 3300006881 Bacteria 4001
193 Ga0097620_100046408 3300006931 Bacteria 4362
194 Ga0097620_100189034 3300006931 Bacteria 2143
195 Ga0097620_100291337 3300006931 Bacteria 1725
196 Ga0099826_10000027 3300006948 Bacteria 140533
197 Ga0099794_10020874 3300007265 Bacteria 2969
198 Ga0105251_10024824 3300009011 Bacteria 3074
199 Ga0105244_10000965 3300009036 Bacteria 24157
200 Ga0105240_10013158 3300009093 Bacteria 11383
201 Ga0105240_10356268 3300009093 Bacteria 1659
202 Ga0105240_10440104 3300009093 Bacteria 1461
203 Ga0111539_10033508 3300009094 Bacteria 6237
204 Ga0105245_10012088 3300009098 Bacteria 7507
205 Ga0105245_10037607 3300009098 Bacteria 4303
206 Ga0105247_10198224 3300009101 Bacteria 1347
207 Ga0105243_10001233 3300009148 Bacteria 23051
208 Ga0105243_10004695 3300009148 Bacteria 10755
209 Ga0105243_10017874 3300009148 Bacteria 5365
210 Ga0105243_10093995 3300009148 Bacteria 2475
211 Ga0105243_10152568 3300009148 Bacteria 1983
212 Ga0105243_10226000 3300009148 Bacteria 1657
213 Ga0105241_10010537 3300009174 Bacteria 6782
214 Ga0105242_10025996 3300009176 Bacteria 4636
215 Ga0105242_10121024 3300009176 Bacteria 2246
216 Ga0105248_10022102 3300009177 Bacteria 7049
217 Ga0105248_10083235 3300009177 Bacteria 3599
218 Ga0105248_10404995 3300009177 Bacteria 1536
219 Ga0105237_10001628 3300009545 Bacteria 29150
220 Ga0105237_10011624 3300009545 Bacteria 9318
221 Ga0105237_10014335 3300009545 Bacteria 8297
222 Ga0105237_10063747 3300009545 Bacteria 3683
223 Ga0105237_10080165 3300009545 Bacteria 3255
224 Ga0105237_10454120 3300009545 Bacteria 1287
225 Ga0105249_10009786 3300009553 Bacteria 8399
226 Ga0105033_100704 3300009986 Bacteria 2590
227 Ga0105239_10001684 3300010375 Bacteria 29148
228 Ga0105239_10094552 3300010375 Bacteria 3301
229 Ga0105239_10194616 3300010375 Bacteria 2270
230 Ga0105239_10231109 3300010375 Bacteria 2075
231 Ga0105239_10483842 3300010375 Bacteria 1406
232 Ga0157373_10027700 3300013100 Bacteria 4088
233 Ga0157373_10042400 3300013100 Bacteria 3252
234 Ga0157371_10037766 3300013102 Bacteria 3456
235 Ga0157371_10086060 3300013102 Bacteria 2226
236 Ga0157369_10002311 3300013105 Bacteria 22944
237 Ga0157369_10205582 3300013105 Bacteria 2065
238 Ga0157374_10133683 3300013296 Bacteria 2402
239 Ga0157378_10004470 3300013297 Bacteria 12280
240 Ga0157378_10011046 3300013297 Bacteria 7903
241 Ga0157378_10014904 3300013297 Bacteria 6802
242 Ga0163162_10008437 3300013306 Bacteria 10048
243 Ga0163162_10239580 3300013306 Bacteria 1945
244 Ga0157375_10020725 3300013308 Bacteria 6014
245 Ga0157375_10073262 3300013308 Bacteria 3444
246 Ga0157375_10085470 3300013308 Bacteria 3204
247 Ga0157375_10316262 3300013308 Bacteria 1726
248 Ga0163163_10009364 3300014325 Bacteria 8742
249 Ga0163163_10010625 3300014325 Bacteria 8294
250 Ga0163163_10096759 3300014325 Bacteria 2973
251 Ga0163163_10436417 3300014325 Bacteria 1369
252 Ga0157380_10039361 3300014326 Bacteria 3676
253 Ga0157380_10087180 3300014326 Bacteria 2566
254 Ga0157380_10087811 3300014326 Bacteria 2557
255 Ga0157380_10120306 3300014326 Bacteria 2223
256 Ga0157380_10158652 3300014326 Bacteria 1963
257 Ga0182008_10022139 3300014497 Bacteria 3255
258 Ga0182008_10026570 3300014497 Bacteria 2936
259 Ga0157379_10006962 3300014968 Bacteria 9778
260 Ga0157379_10011595 3300014968 Bacteria 7697
261 Ga0157379_10017722 3300014968 Bacteria 6274
262 Ga0157379_10056850 3300014968 Bacteria 3496
263 Ga0157376_10008524 3300014969 Bacteria 7404
264 Ga0157376_10079954 3300014969 Bacteria 2803
265 Ga0182006_1001032 3300015261 Bacteria 18152
266 Ga0182007_10000366 3300015262 Bacteria 28535
267 Ga0163161_10001014 3300017792 Bacteria 21406
268 Ga0163161_10013132 3300017792 Bacteria 5757
269 Ga0163161_10016219 3300017792 Bacteria 5199
270 Ga0163161_10268497 3300017792 Bacteria 1334
271 Ga0209435_100001 3300025206 Bacteria 1424171
272 Ga0209436_105668 3300025208 Bacteria 2831
273 Ga0209147_101220 3300025229 Bacteria 10252
274 Ga0209258_100058 3300025242 Bacteria 331567
275 Ga0207425_1002090 3300025245 Bacteria 7399
276 Ga0207425_1008428 3300025245 Bacteria 2639
277 Ga0209646_1000001 3300025246 Bacteria 3092932
278 Ga0209026_1000003 3300025250 Bacteria 1060571
279 Ga0209148_1000071 3300025254 Bacteria 331551
280 Ga0209759_1000001 3300025256 Bacteria 2799452
281 Ga0209129_1005627 3300025258 Bacteria 4355
282 Ga0209129_1006005 3300025258 Bacteria 4078
283 Ga0209129_1006848 3300025258 Bacteria 3557
284 Ga0209565_1000004 3300025263 Bacteria 983150
285 Ga0209565_1000840 3300025263 Bacteria 17373
286 Ga0209565_1005531 3300025263 Bacteria 3653
287 Ga0209565_1006363 3300025263 Bacteria 3320
288 Ga0209673_1000066 3300025273 Bacteria 250037
289 Ga0209673_1000074 3300025273 Bacteria 233552
290 Ga0209130_1000050 3300025284 Bacteria 222092
291 Ga0209130_1000082 3300025284 Bacteria 164441
292 Ga0209130_1000625 3300025284 Bacteria 33527
293 Ga0209130_1000816 3300025284 Bacteria 26299
294 Ga0209130_1004224 3300025284 Bacteria 5591
295 Ga0207673_1001090 3300025290 Bacteria 2926
296 Ga0209675_1001153 3300025291 Bacteria 16079
297 Ga0209675_1001253 3300025291 Bacteria 15226
298 Ga0209675_1006841 3300025291 Bacteria 4495
299 Ga0209675_1008946 3300025291 Bacteria 3600
300 Ga0209675_1026318 3300025291 Bacteria 1449
301 Ga0209676_1000005 3300025292 Bacteria 1076001
302 Ga0209676_1000029 3300025292 Bacteria 520536
303 Ga0209676_1007573 3300025292 Bacteria 5055
304 Ga0209025_1000351 3300025294 Bacteria 99585
305 Ga0209025_1000750 3300025294 Bacteria 54523
306 Ga0209025_1000766 3300025294 Bacteria 53411
307 Ga0209025_1001156 3300025294 Bacteria 37386
308 Ga0209025_1002301 3300025294 Bacteria 20715
309 Ga0209025_1003418 3300025294 Bacteria 15061
310 Ga0209025_1014059 3300025294 Bacteria 4967
311 Ga0209025_1017671 3300025294 Bacteria 4098
312 Ga0209025_1039234 3300025294 Bacteria 2069
313 Ga0209564_1000090 3300025295 Bacteria 249298
314 Ga0209564_1001244 3300025295 Bacteria 28537
315 Ga0209564_1001617 3300025295 Bacteria 21862
316 Ga0209758_1000249 3300025297 Bacteria 110026
317 Ga0209758_1008491 3300025297 Bacteria 6631
318 Ga0209758_1025030 3300025297 Bacteria 2635
319 Ga0209758_1057641 3300025297 Bacteria 1304
320 Ga0209050_1000003 3300025298 Bacteria 1609245
321 Ga0209050_1000007 3300025298 Bacteria 1187891
322 Ga0209050_1004456 3300025298 Bacteria 9447
323 Ga0209256_1000001 3300025299 Bacteria 2166974
324 Ga0209256_1000022 3300025299 Bacteria 481843
325 Ga0209256_1000127 3300025299 Bacteria 164393
326 Ga0209256_1001660 3300025299 Bacteria 21630
327 Ga0207426_1000031 3300025302 Bacteria 460699
328 Ga0207426_1000071 3300025302 Bacteria 329539
329 Ga0207426_1000336 3300025302 Bacteria 88370
330 Ga0207426_1002464 3300025302 Bacteria 11778
331 Ga0209051_1000003 3300025303 Bacteria 1609245
332 Ga0209051_1000036 3300025303 Bacteria 339863
333 Ga0209051_1000542 3300025303 Bacteria 46577
334 Ga0209051_1011223 3300025303 Bacteria 4444
335 Ga0209051_1031858 3300025303 Bacteria 2022
336 Ga0209257_1000011 3300025304 Bacteria 1112630
337 Ga0209257_1000012 3300025304 Bacteria 1111138
338 Ga0209257_1000018 3300025304 Bacteria 836016
339 Ga0209257_1011452 3300025304 Bacteria 4269
340 Ga0207697_10000857 3300025315 Bacteria 17209
341 Ga0207697_10030381 3300025315 Bacteria 2211
342 Ga0207697_10072477 3300025315 Bacteria 1444
343 Ga0207656_10005144 3300025321 Bacteria 4598
344 Ga0207656_10007254 3300025321 Bacteria 4027
345 Ga0207655_1008917 3300025728 Bacteria 6296
346 Ga0207682_10000120 3300025893 Bacteria 36172
347 Ga0207682_10043131 3300025893 Bacteria 1845
348 Ga0207642_10020166 3300025899 Bacteria 2597
349 Ga0207688_10120342 3300025901 Bacteria 1532
350 Ga0207680_10065967 3300025903 Bacteria 2224
351 Ga0207680_10068843 3300025903 Bacteria 2185
352 Ga0207645_10001475 3300025907 Bacteria 19229
353 Ga0207645_10080294 3300025907 Bacteria 2091
354 Ga0207643_10000681 3300025908 Bacteria 21214
355 Ga0207643_10002912 3300025908 Bacteria 9244
356 Ga0207705_10030042 3300025909 Bacteria 3876
357 Ga0207654_10066265 3300025911 Bacteria 2129
358 Ga0207707_10043109 3300025912 Bacteria 3937
359 Ga0207695_10020847 3300025913 Bacteria 7492
360 Ga0207695_10318030 3300025913 Bacteria 1446
361 Ga0207695_10328361 3300025913 Bacteria 1418
362 Ga0207671_10001800 3300025914 Bacteria 23963
363 Ga0207671_10035768 3300025914 Bacteria 3683
364 Ga0207671_10143976 3300025914 Bacteria 1838
365 Ga0207660_10142588 3300025917 Bacteria 1833
366 Ga0207662_10004254 3300025918 Bacteria 7509
367 Ga0207657_10005234 3300025919 Bacteria 13591
368 Ga0207649_10021763 3300025920 Bacteria 3697
369 Ga0207649_10215899 3300025920 Bacteria 1363
370 Ga0207681_10023616 3300025923 Bacteria 3935
371 Ga0207681_10061746 3300025923 Bacteria 2577
372 Ga0207650_10002722 3300025925 Bacteria 12201
373 Ga0207650_10003389 3300025925 Bacteria 10964
374 Ga0207650_10009669 3300025925 Bacteria 6592
375 Ga0207650_10029364 3300025925 Bacteria 3953
376 Ga0207650_10071477 3300025925 Bacteria 2610
377 Ga0207659_10000256 3300025926 Bacteria 32624
378 Ga0207659_10009618 3300025926 Bacteria 6047
379 Ga0207659_10073521 3300025926 Bacteria 2503
380 Ga0207687_10053653 3300025927 Bacteria 2817
381 Ga0207687_10163090 3300025927 Bacteria 1712
382 Ga0207687_10185564 3300025927 Bacteria 1614
383 Ga0207644_10004912 3300025931 Bacteria 8716
384 Ga0207644_10008335 3300025931 Bacteria 6792
385 Ga0207644_10021303 3300025931 Bacteria 4414
386 Ga0207644_10094604 3300025931 Bacteria 2232
387 Ga0207644_10252643 3300025931 Bacteria 1407
388 Ga0207706_10000850 3300025933 Bacteria 31426
389 Ga0207706_10005242 3300025933 Bacteria 12091
390 Ga0207706_10170700 3300025933 Bacteria 1911
391 Ga0207686_10059632 3300025934 Bacteria 2412
392 Ga0207686_10171067 3300025934 Bacteria 1532
393 Ga0207686_10314153 3300025934 Bacteria 1168
394 Ga0207709_10003703 3300025935 Bacteria 9001
395 Ga0207709_10011257 3300025935 Bacteria 4935
396 Ga0207709_10047480 3300025935 Bacteria 2611
397 Ga0207709_10093251 3300025935 Bacteria 1974
398 Ga0207709_10121303 3300025935 Bacteria 1765
399 Ga0207670_10051220 3300025936 Bacteria 2771
400 Ga0207669_10008390 3300025937 Bacteria 4847
401 Ga0207669_10055448 3300025937 Bacteria 2400
402 Ga0207704_10018726 3300025938 Bacteria 3621
403 Ga0207704_10040711 3300025938 Bacteria 2718
404 Ga0207704_10084488 3300025938 Bacteria 2063
405 Ga0207691_10000360 3300025940 Bacteria 45895
406 Ga0207691_10000773 3300025940 Bacteria 31657
407 Ga0207691_10009293 3300025940 Bacteria 9434
408 Ga0207691_10020172 3300025940 Bacteria 6305
409 Ga0207711_10066931 3300025941 Bacteria 3108
410 Ga0207689_10000307 3300025942 Bacteria 45007
411 Ga0207689_10001301 3300025942 Bacteria 24043
412 Ga0207689_10009368 3300025942 Bacteria 8462
413 Ga0207661_10017959 3300025944 Bacteria 5248
414 Ga0207661_10275474 3300025944 Bacteria 1502
415 Ga0207679_10009175 3300025945 Bacteria 6325
416 Ga0207679_10015100 3300025945 Bacteria 5093
417 Ga0207679_10019703 3300025945 Bacteria 4539
418 Ga0207651_10023043 3300025960 Bacteria 3821
419 Ga0207651_10118548 3300025960 Bacteria 2002
420 Ga0207712_10010255 3300025961 Bacteria 5944
421 Ga0207668_10009980 3300025972 Bacteria 5714
422 Ga0207668_10096144 3300025972 Bacteria 2188
423 Ga0207640_10067975 3300025981 Bacteria 2386
424 Ga0207640_10078491 3300025981 Bacteria 2247
425 Ga0207658_10090649 3300025986 Bacteria 2370
426 Ga0207658_10092294 3300025986 Bacteria 2351
427 Ga0207658_10130220 3300025986 Bacteria 2020
428 Ga0207677_10057250 3300026023 Bacteria 2675
429 Ga0207677_10069942 3300026023 Bacteria 2471
430 Ga0207677_10090162 3300026023 Bacteria 2227
431 Ga0207677_10243055 3300026023 Bacteria 1457
432 Ga0207703_10026771 3300026035 Bacteria 4543
433 Ga0207703_10128445 3300026035 Bacteria 2185
434 Ga0207639_10107710 3300026041 Bacteria 2264
435 Ga0207639_10181887 3300026041 Bacteria 1789
436 Ga0207678_10001655 3300026067 Bacteria 20422
437 Ga0207708_10000529 3300026075 Bacteria 29463
438 Ga0207702_10246674 3300026078 Bacteria 1675
439 Ga0207641_10008475 3300026088 Bacteria 8497
440 Ga0207641_10063711 3300026088 Bacteria 3149
441 Ga0207648_10002743 3300026089 Bacteria 18714
442 Ga0207648_10003420 3300026089 Bacteria 16668
443 Ga0207648_10009516 3300026089 Bacteria 9298
444 Ga0207648_10010728 3300026089 Bacteria 8661
445 Ga0207648_10023605 3300026089 Bacteria 5506
446 Ga0207648_10099845 3300026089 Bacteria 2542
447 Ga0207676_10018219 3300026095 Bacteria 5100
448 Ga0207676_10037987 3300026095 Bacteria 3673
449 Ga0207676_10062352 3300026095 Bacteria 2957
450 Ga0207676_10082436 3300026095 Bacteria 2616
451 Ga0207676_10267560 3300026095 Bacteria 1546
452 Ga0207674_10003249 3300026116 Bacteria 20002
453 Ga0207674_10020383 3300026116 Bacteria 7164
454 Ga0207674_10050112 3300026116 Bacteria 4267
455 Ga0207674_10093743 3300026116 Bacteria 2990
456 Ga0207675_100008033 3300026118 Bacteria 9941
457 Ga0207675_100024821 3300026118 Bacteria 5578
458 Ga0207675_100058990 3300026118 Bacteria 3582
459 Ga0207675_100331927 3300026118 Bacteria 1487
460 Ga0207683_10002951 3300026121 Bacteria 14839
461 Ga0207683_10010884 3300026121 Bacteria 7760
462 Ga0207683_10036681 3300026121 Bacteria 4270
463 Ga0207683_10041187 3300026121 Bacteria 4032
464 Ga0207683_10045801 3300026121 Bacteria 3826
465 Ga0207683_10062761 3300026121 Bacteria 3273
466 Ga0207698_10016839 3300026142 Bacteria 4940
467 Ga0209282_1000069 3300027666 Bacteria 85661
468 Ga0209282_1089479 3300027666 Bacteria 1617
469 Ga0209588_1067968 3300027671 Bacteria 1151
470 Ga0209813_10007684 3300027866 Bacteria 2693
471 Ga0268266_10127158 3300028379 Bacteria 2275
472 Ga0268266_10211875 3300028379 Bacteria 1777
473 Ga0268265_10015157 3300028380 Bacteria 5268
474 Ga0268265_10046919 3300028380 Bacteria 3232
475 Ga0268265_10083964 3300028380 Bacteria 2523
476 Ga0268265_10168443 3300028380 Bacteria 1869
477 Ga0268265_10307731 3300028380 Bacteria 1429
478 Ga0268264_10017548 3300028381 Bacteria 5862
479 Ga0268264_10022650 3300028381 Bacteria 5126
480 Ga0268264_10124353 3300028381 Bacteria 2277
481 Ga0268264_10129384 3300028381 Bacteria 2236
482 Ga0268264_10129464 3300028381 Bacteria 2235
483 Ga0307515_10000267 3300028794 Bacteria 128554
484 Ga0307515_10000283 3300028794 Bacteria 124822
485 Ga0307515_10102505 3300028794 Bacteria 3441
486 Ga0307515_10156619 3300028794 Bacteria 2347
487 Ga0307515_10182241 3300028794 Bacteria 2045
488 Ga0307515_10201866 3300028794 Bacteria 1861
489 Ga0307512_10051832 3300030522 Bacteria 3279
490 Ga0316176_1111959 3300030732 Bacteria 1865
491 Ga0314311_1018953 3300030733 Bacteria 4042
492 Ga0316183_1163725 3300030742 Bacteria 4721
493 Ga0316181_1083351 3300030744 Bacteria 6292
494 Ga0307513_10000019 3300031456 Bacteria 231194
495 Ga0307513_10000051 3300031456 Bacteria 149733
496 Ga0307513_10013784 3300031456 Bacteria 9912
497 Ga0307513_10210027 3300031456 Bacteria 1779
498 Ga0307513_10324869 3300031456 Bacteria 1295
499 Ga0307408_100036080 3300031548 Bacteria 3473
500 Ga0307408_100112537 3300031548 Bacteria 2093
501 Ga0307508_10000876 3300031616 Bacteria 35008
502 Ga0307508_10001111 3300031616 Bacteria 31133
503 Ga0307508_10016840 3300031616 Bacteria 6650
504 Ga0307514_10000806 3300031649 Bacteria 51095
505 Ga0307516_10037208 3300031730 Bacteria 4866
506 Ga0307410_10016709 3300031852 Bacteria 4386
507 Ga0307406_10006998 3300031901 Bacteria 6244
508 Ga0307407_10134193 3300031903 Bacteria 1588
509 Ga0307412_10008248 3300031911 Bacteria 5939
510 Ga0307412_10085387 3300031911 Bacteria 2193
511 Ga0307416_100031041 3300032002 Bacteria 4018
512 Ga0307414_10011968 3300032004 Bacteria 5115
513 Ga0307414_10115575 3300032004 Bacteria 2052
514 Ga0307411_10015798 3300032005 Bacteria 4253
515 Ga0307507_10050320 3300033179 Bacteria 4024
516 Ga0307507_10066708 3300033179 Bacteria 3296
517 Ga0373954_0107382 3300035118 Bacteria 1349
518 Ga0373955_0213183 3300035172 Bacteria 1152
519 Ga0373927_0046506 3300035695 Bacteria 2808
520 Ga0373933_0092230 3300035724 Bacteria 1871
521 Ga0373947_0148886 3300035725 Bacteria 1506
522 Ga0373937_0245753 3300036401 Bacteria 1686
523 Ga0373925_0003621 3300037068 Bacteria 11900
524 Ga0439436_0013301 3300041404 Bacteria 2490
525 Ga0439465_0000905 3300041413 Bacteria 9390
526 Ga0439445_0000950 3300042004 Bacteria 6171
527 Ga0439449_0000923 3300042007 Bacteria 11452
528 Ga0439457_002549 3300042014 Bacteria 5168
529 Ga0450898_012118 3300042134 Bacteria 1421
530 Ga0453683_0004388 3300044673 Bacteria 10027
531 Ga0453684_0004147 3300044712 Bacteria 31361
532 Ga0451576_0003846 3300045051 Bacteria 20162
533 Ga0451576_0388790 3300045051 Bacteria 1462
534 Ga0495650_0015317 3300046471 Bacteria 3938
535 Ga0495607_0000280 3300046501 Bacteria 54943
536 Ga0495643_0102073 3300046522 Bacteria 1469
537 Ga0495586_0053114 3300046535 Bacteria 2195
538 Ga0495621_0026542 3300046539 Bacteria 1955
539 Ga0495597_0007306 3300046542 Bacteria 5628
540 Ga0495668_0089218 3300046616 Bacteria 1690
541 Ga0495625_0000807 3300046660 Bacteria 43441
542 Ga0495625_0013304 3300046660 Bacteria 6616
543 Ga0495647_0003910 3300046681 Bacteria 4806
544 Ga0495658_0009897 3300046683 Bacteria 4755
545 Ga0495660_0022664 3300046810 Bacteria 3584
546 Ga0495687_000196 3300047443 Bacteria 87053
547 Ga0496100_0015028 3300048903 Bacteria 4513
548 Ga0496101_0003644 3300048904 Bacteria 9612
549 Ga0496101_0020827 3300048904 Bacteria 4498
550 Ga0496102_0061675 3300048905 Bacteria 3432
551 Ga0496103_0015705 3300048906 Bacteria 4513
552 Ga0496104_0050519 3300048907 Bacteria 3923
553 Ga0496106_0173091 3300048909 Bacteria 1712
554 Ga0496106_0339859 3300048909 Bacteria 1206
555 Ga0496108_0015385 3300048911 Bacteria 6241
556 Ga0496108_0078227 3300048911 Bacteria 2799
557 Ga0496109_0005385 3300048912 Bacteria 10697
558 Ga0496110_0055926 3300048913 Bacteria 3472
559 Ga0496114_0106841 3300048917 Bacteria 2395
560 Ga0496114_0106912 3300048917 Bacteria 2394
561 Ga0496116_0076715 3300048919 Bacteria 2092
562 Ga0496118_0010875 3300048921 Bacteria 8954
563 Ga0496118_0171653 3300048921 Bacteria 1324
564 Ga0496119_0013228 3300048922 Bacteria 6596
565 Ga0496122_0000217 3300048925 Bacteria 128502
566 Ga0496122_0000669 3300048925 Bacteria 68904
567 Ga0496123_0000057 3300048926 Bacteria 228608
568 Ga0496123_0000603 3300048926 Bacteria 61111
569 Ga0496123_0011878 3300048926 Bacteria 7486
570 Ga0496124_0000103 3300048927 Bacteria 179162
571 Ga0496124_0068992 3300048927 Bacteria 2936
572 Ga0496125_0000168 3300048928 Bacteria 146364
573 Ga0496125_0001023 3300048928 Bacteria 43458
574 Ga0496125_0032129 3300048928 Bacteria 4666
575 Ga0496125_0046771 3300048928 Bacteria 3626
576 Ga0496125_0079823 3300048928 Bacteria 2507
577 Ga0496126_0020831 3300048929 Bacteria 6418
578 nmdc:mga00v17_573_c1 3300050491 Bacteria 20549
579 nmdc:mga0k408_117992_c1 3300050493 Bacteria 1571
580 nmdc:mga0k408_1222_c2 3300050493 Bacteria 3149
581 nmdc:mga0k408_122491_c1 3300050493 Bacteria 1541
582 nmdc:mga0k408_130522_c1 3300050493 Bacteria 1492
583 nmdc:mga0k408_49253_c1 3300050493 Bacteria 2439
584 nmdc:mga0k408_8612_c1 3300050493 Bacteria 5481
585 nmdc:mga04h51_8957_c1 3300050495 Bacteria 2693
586 nmdc:mga07m45_22579_c1 3300050496 Bacteria 3436
587 nmdc:mga07m45_308_c1 3300050496 Bacteria 19736
588 nmdc:mga07m45_6054_c1 3300050496 Bacteria 6090
589 nmdc:mga07m45_69134_c1 3300050496 Bacteria 2008
590 nmdc:mga08y16_169739_c1 3300050511 Bacteria 2266
591 nmdc:mga0sz30_43116_c1 3300050516 Bacteria 1899
592 Ga0500643_009420 3300053087 Bacteria 3735
593 Ga0500658_0001486 3300053134 Bacteria 9378
594 Ga0500645_000198 3300053730 Bacteria 46701
595 Ga0500645_002382 3300053730 Bacteria 8455

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10004695 Ga0105243_100046959 313
2 3300013102 Ga0157371_10037766 Ga0157371_100377662 314
3 3300048922 Ga0496119_0013228 Ga0496119_0013228_913_1947 314
4 3300048926 Ga0496123_0011878 Ga0496123_0011878_5285_6319 314
5 3300048927 Ga0496124_0068992 Ga0496124_0068992_735_1769 314
6 3300048928 Ga0496125_0000168 Ga0496125_0000168_101651_102685 314
7 3300048929 Ga0496126_0020831 Ga0496126_0020831_2336_3370 314
8 3300048903 Ga0496100_0015028 Ga0496100_0015028_236_1294 315
9 3300048904 Ga0496101_0003644 Ga0496101_0003644_4986_6044 315
10 3300048907 Ga0496104_0050519 Ga0496104_0050519_2440_3498 315
11 3300048917 Ga0496114_0106841 Ga0496114_0106841_1327_2385 315
12 3300005347 Ga0070668_100060654 Ga0070668_1000606541 321
13 3300005354 Ga0070675_100014312 Ga0070675_1000143122 321
14 3300005364 Ga0070673_100009444 Ga0070673_1000094441 321
15 3300005457 Ga0070662_100016060 Ga0070662_1000160602 321
16 3300005543 Ga0070672_100004667 Ga0070672_1000046678 321
17 3300005618 Ga0068864_100045661 Ga0068864_1000456612 321
18 3300005843 Ga0068860_100235221 Ga0068860_1002352212 321
19 3300013308 Ga0157375_10073262 Ga0157375_100732622 321
20 3300014326 Ga0157380_10039361 Ga0157380_100393613 321
21 3300025315 Ga0207697_10030381 Ga0207697_100303811 321
22 3300025903 Ga0207680_10068843 Ga0207680_100688431 321
23 3300025940 Ga0207691_10000773 Ga0207691_1000077311 321
24 3300025972 Ga0207668_10096144 Ga0207668_100961441 321
25 3300026118 Ga0207675_100024821 Ga0207675_1000248212 321
26 3300028381 Ga0268264_10022650 Ga0268264_100226502 321
27 iso_pu_bacteria 2846952575 2846958082 321
28 3300005334 Ga0068869_100014498 Ga0068869_1000144982 322
29 3300005617 Ga0068859_100046409 Ga0068859_1000464092 322
30 3300005842 Ga0068858_100057687 Ga0068858_1000576873 322
31 3300006195 Ga0075366_10073340 Ga0075366_100733402 322
32 3300006931 Ga0097620_100046408 Ga0097620_1000464082 322
33 3300025294 Ga0209025_1039234 Ga0209025_10392342 322
34 3300025926 Ga0207659_10073521 Ga0207659_100735213 322
35 3300025942 Ga0207689_10001301 Ga0207689_1000130116 322
36 3300026023 Ga0207677_10057250 Ga0207677_100572502 322
37 3300026035 Ga0207703_10128445 Ga0207703_101284452 322
38 3300048925 Ga0496122_0000669 Ga0496122_0000669_12116_13273 322
39 3300048926 Ga0496123_0000603 Ga0496123_0000603_41853_43010 322
40 3300048928 Ga0496125_0046771 Ga0496125_0046771_1356_2513 322
41 3300050493 nmdc:mga0k408_1222_c2 nmdc:mga0k408_1222_c2_1804_2793 322
42 iso_pu_bacteria 2643221654 2644303763 322
43 iso_pu_bacteria 2821443989 2821444107 322
44 3300003187 JGI25151J46595_10010218 JGI25151J46595_100102182 323
45 3300003354 JGI25160J50197_1004001 JGI25160J50197_10040013 323
46 3300005459 Ga0068867_100068017 Ga0068867_1000680172 323
47 3300005844 Ga0068862_100011483 Ga0068862_1000114832 323
48 3300005937 Ga0081455_10128564 Ga0081455_101285642 323
49 3300006048 Ga0075363_100006291 Ga0075363_1000062915 323
50 3300006177 Ga0075362_10050113 Ga0075362_100501133 323
51 3300006178 Ga0075367_10002951 Ga0075367_100029513 323
52 3300006195 Ga0075366_10018117 Ga0075366_100181172 323
53 3300006353 Ga0075370_10000581 Ga0075370_100005815 323
54 3300009986 Ga0105033_100704 Ga0105033_1007042 323
55 3300013100 Ga0157373_10042400 Ga0157373_100424003 323
56 3300014497 Ga0182008_10026570 Ga0182008_100265703 323
57 3300025284 Ga0209130_1000625 Ga0209130_100062522 323
58 3300025294 Ga0209025_1000750 Ga0209025_100075064 323
59 3300025297 Ga0209758_1008491 Ga0209758_10084913 323
60 3300025302 Ga0207426_1000336 Ga0207426_100033634 323
61 3300025901 Ga0207688_10120342 Ga0207688_101203422 323
62 3300026041 Ga0207639_10181887 Ga0207639_101818872 323
63 3300026118 Ga0207675_100331927 Ga0207675_1003319272 323
64 3300027866 Ga0209813_10007684 Ga0209813_100076843 323
65 3300028380 Ga0268265_10307731 Ga0268265_103077312 323
66 3300028794 Ga0307515_10000283 Ga0307515_10000283100 323
67 3300048921 Ga0496118_0171653 Ga0496118_0171653_18_1010 323
68 3300050493 nmdc:mga0k408_117992_c1 nmdc:mga0k408_117992_c1_30_1022 323
69 3300050493 nmdc:mga0k408_130522_c1 nmdc:mga0k408_130522_c1_310_1302 323
70 3300050495 nmdc:mga04h51_8957_c1 nmdc:mga04h51_8957_c1_1623_2615 323
71 3300050496 nmdc:mga07m45_308_c1 nmdc:mga07m45_308_c1_1583_2575 323
72 3300050496 nmdc:mga07m45_69134_c1 nmdc:mga07m45_69134_c1_411_1403 323
73 3300050516 nmdc:mga0sz30_43116_c1 nmdc:mga0sz30_43116_c1_557_1549 323
74 3300053087 Ga0500643_009420 Ga0500643_009420_1646_2647 323
75 iso_pu_bacteria 2844533157 2844539473 323
76 iso_pu_bacteria 2894023352 2894027686 323
77 3300006353 Ga0075370_10029780 Ga0075370_100297802 324
78 3300007265 Ga0099794_10020874 Ga0099794_100208742 324
79 3300009177 Ga0105248_10022102 Ga0105248_100221025 324
80 3300010375 Ga0105239_10194616 Ga0105239_101946161 324
81 3300013308 Ga0157375_10316262 Ga0157375_103162621 324
82 3300014325 Ga0163163_10436417 Ga0163163_104364172 324
83 3300014969 Ga0157376_10008524 Ga0157376_100085245 324
84 3300017792 Ga0163161_10013132 Ga0163161_100131325 324
85 3300027671 Ga0209588_1067968 Ga0209588_10679681 324
86 3300028794 Ga0307515_10201866 Ga0307515_102018662 324
87 3300031456 Ga0307513_10324869 Ga0307513_103248691 324
88 3300031616 Ga0307508_10016840 Ga0307508_100168406 324
89 3300042134 Ga0450898_012118 Ga0450898_012118_73_1146 324
90 iso_pu_bacteria 2904479285 2904481054 324
91 3300005843 Ga0068860_100102229 Ga0068860_1001022292 325
92 3300006931 Ga0097620_100189034 Ga0097620_1001890341 325
93 3300009545 Ga0105237_10080165 Ga0105237_100801652 325
94 3300009553 Ga0105249_10009786 Ga0105249_100097865 325
95 3300013297 Ga0157378_10004470 Ga0157378_100044707 325
96 3300013297 Ga0157378_10014904 Ga0157378_100149046 325
97 3300013306 Ga0163162_10008437 Ga0163162_100084373 325
98 3300014968 Ga0157379_10006962 Ga0157379_100069629 325
99 3300025914 Ga0207671_10035768 Ga0207671_100357682 325
100 3300028381 Ga0268264_10124353 Ga0268264_101243532 325
101 3300028794 Ga0307515_10156619 Ga0307515_101566193 325
102 3300031616 Ga0307508_10001111 Ga0307508_1000111128 325
103 3300033179 Ga0307507_10050320 Ga0307507_100503202 325
104 3300044712 Ga0453684_0004147 Ga0453684_0004147_7155_8153 325
105 3300045051 Ga0451576_0388790 Ga0451576_0388790_433_1425 325
106 3300046522 Ga0495643_0102073 Ga0495643_0102073_143_1141 325
107 iso_pu_bacteria 2545555834 2545678243 325
108 iso_pu_bacteria 641522639 641643379 325
109 3300003215 JGI25153J46596_10001768 JGI25153J46596_100017687 326
110 3300005333 Ga0070677_10013807 Ga0070677_100138073 326
111 3300005353 Ga0070669_100018890 Ga0070669_1000188904 326
112 3300005356 Ga0070674_100057946 Ga0070674_1000579463 326
113 3300005456 Ga0070678_100008501 Ga0070678_1000085011 326
114 3300005459 Ga0068867_100005155 Ga0068867_1000051558 326
115 3300005719 Ga0068861_100002547 Ga0068861_1000025478 326
116 3300005843 Ga0068860_100004285 Ga0068860_1000042857 326
117 3300005843 Ga0068860_100100333 Ga0068860_1001003332 326
118 3300005844 Ga0068862_100038440 Ga0068862_1000384403 326
119 3300005844 Ga0068862_100250020 Ga0068862_1002500201 326
120 3300005937 Ga0081455_10236012 Ga0081455_102360121 326
121 3300006358 Ga0068871_100063833 Ga0068871_1000638332 326
122 3300006881 Ga0068865_100023958 Ga0068865_1000239582 326
123 3300009148 Ga0105243_10152568 Ga0105243_101525682 326
124 3300014968 Ga0157379_10056850 Ga0157379_100568502 326
125 3300017792 Ga0163161_10016219 Ga0163161_100162194 326
126 3300025297 Ga0209758_1000249 Ga0209758_100024961 326
127 3300025893 Ga0207682_10043131 Ga0207682_100431312 326
128 3300025907 Ga0207645_10080294 Ga0207645_100802942 326
129 3300025927 Ga0207687_10163090 Ga0207687_101630902 326
130 3300025931 Ga0207644_10252643 Ga0207644_102526431 326
131 3300025935 Ga0207709_10047480 Ga0207709_100474802 326
132 3300025935 Ga0207709_10093251 Ga0207709_100932512 326
133 3300025937 Ga0207669_10055448 Ga0207669_100554482 326
134 3300025938 Ga0207704_10084488 Ga0207704_100844882 326
135 3300025940 Ga0207691_10009293 Ga0207691_100092932 326
136 3300025961 Ga0207712_10010255 Ga0207712_100102552 326
137 3300025986 Ga0207658_10130220 Ga0207658_101302202 326
138 3300026089 Ga0207648_10009516 Ga0207648_100095163 326
139 3300026118 Ga0207675_100008033 Ga0207675_1000080337 326
140 3300026121 Ga0207683_10045801 Ga0207683_100458012 326
141 3300028380 Ga0268265_10083964 Ga0268265_100839643 326
142 3300028380 Ga0268265_10168443 Ga0268265_101684432 326
143 3300028381 Ga0268264_10017548 Ga0268264_100175484 326
144 3300028794 Ga0307515_10182241 Ga0307515_101822412 326
145 3300035118 Ga0373954_0107382 Ga0373954_0107382_226_1209 326
146 3300035695 Ga0373927_0046506 Ga0373927_0046506_1370_2365 326
147 3300036401 Ga0373937_0245753 Ga0373937_0245753_455_1441 326
148 3300037068 Ga0373925_0003621 Ga0373925_0003621_5681_6676 326
149 3300046471 Ga0495650_0015317 Ga0495650_0015317_1952_2941 326
150 3300046535 Ga0495586_0053114 Ga0495586_0053114_876_1874 326
151 3300046681 Ga0495647_0003910 Ga0495647_0003910_411_1397 326
152 3300046683 Ga0495658_0009897 Ga0495658_0009897_2298_3284 326
153 3300048925 Ga0496122_0000217 Ga0496122_0000217_87527_88528 326
154 3300048926 Ga0496123_0000057 Ga0496123_0000057_15689_16690 326
155 3300050493 nmdc:mga0k408_49253_c1 nmdc:mga0k408_49253_c1_1115_2110 326
156 iso_pu_bacteria 2585428062 2587757174 326
157 iso_pu_bacteria 2597490356 2599101936 326
158 iso_pu_bacteria 2848858292 2848864856 326
159 iso_pu_bacteria 2897803580 2897805879 326
160 3300005456 Ga0070678_100013926 Ga0070678_1000139265 327
161 3300005457 Ga0070662_100007540 Ga0070662_1000075405 327
162 3300005577 Ga0068857_100051888 Ga0068857_1000518883 327
163 3300006042 Ga0075368_10074870 Ga0075368_100748702 327
164 3300006177 Ga0075362_10018253 Ga0075362_100182532 327
165 3300006353 Ga0075370_10028017 Ga0075370_100280174 327
166 3300009036 Ga0105244_10000965 Ga0105244_1000096515 327
167 3300009093 Ga0105240_10013158 Ga0105240_100131587 327
168 3300009093 Ga0105240_10356268 Ga0105240_103562682 327
169 3300009148 Ga0105243_10001233 Ga0105243_100012332 327
170 3300009545 Ga0105237_10001628 Ga0105237_1000162821 327
171 3300009545 Ga0105237_10014335 Ga0105237_100143355 327
172 3300010375 Ga0105239_10001684 Ga0105239_1000168421 327
173 3300010375 Ga0105239_10094552 Ga0105239_100945522 327
174 3300013100 Ga0157373_10027700 Ga0157373_100277004 327
175 3300013105 Ga0157369_10002311 Ga0157369_1000231115 327
176 3300014497 Ga0182008_10022139 Ga0182008_100221393 327
177 3300015261 Ga0182006_1001032 Ga0182006_10010322 327
178 3300015262 Ga0182007_10000366 Ga0182007_1000036614 327
179 3300025913 Ga0207695_10020847 Ga0207695_100208475 327
180 3300025913 Ga0207695_10318030 Ga0207695_103180301 327
181 3300025914 Ga0207671_10001800 Ga0207671_100018007 327
182 3300025914 Ga0207671_10143976 Ga0207671_101439762 327
183 3300025933 Ga0207706_10005242 Ga0207706_100052422 327
184 3300025935 Ga0207709_10011257 Ga0207709_100112575 327
185 3300026116 Ga0207674_10020383 Ga0207674_100203833 327
186 3300028794 Ga0307515_10102505 Ga0307515_101025052 327
187 3300030522 Ga0307512_10051832 Ga0307512_100518322 327
188 3300031456 Ga0307513_10210027 Ga0307513_102100271 327
189 3300031616 Ga0307508_10000876 Ga0307508_1000087624 327
190 3300031730 Ga0307516_10037208 Ga0307516_100372081 327
191 3300032004 Ga0307414_10115575 Ga0307414_101155752 327
192 3300033179 Ga0307507_10066708 Ga0307507_100667082 327
193 3300046542 Ga0495597_0007306 Ga0495597_0007306_4103_5107 327
194 3300046616 Ga0495668_0089218 Ga0495668_0089218_31_1035 327
195 3300046660 Ga0495625_0000807 Ga0495625_0000807_10992_11996 327
196 3300046660 Ga0495625_0013304 Ga0495625_0013304_4208_5212 327
197 3300046810 Ga0495660_0022664 Ga0495660_0022664_736_1740 327
198 3300047443 Ga0495687_000196 Ga0495687_000196_34990_35994 327
199 3300048919 Ga0496116_0076715 Ga0496116_0076715_118_1101 327
200 3300048921 Ga0496118_0010875 Ga0496118_0010875_4900_5883 327
201 3300050493 nmdc:mga0k408_122491_c1 nmdc:mga0k408_122491_c1_61_1149 327
202 3300050496 nmdc:mga07m45_22579_c1 nmdc:mga07m45_22579_c1_382_1407 327
203 3300053134 Ga0500658_0001486 Ga0500658_0001486_5700_6704 327
204 3300002704 JGI25155J39150_1000002 JGI25155J39150_100000286 328
205 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003219 328
206 3300002738 JGI25154J39366_1000009 JGI25154J39366_100000986 328
207 3300002741 JGI25157J39369_1000002 JGI25157J39369_100000286 328
208 3300002987 JGI25159J45721_1006315 JGI25159J45721_10063152 328
209 3300003775 Ga0055524_1000012 Ga0055524_100001258 328
210 3300003790 Ga0055528_1007069 Ga0055528_10070693 328
211 3300003791 Ga0055530_10000793 Ga0055530_100007939 328
212 3300003792 Ga0055540_1000012 Ga0055540_1000012177 328
213 3300005327 Ga0070658_10196826 Ga0070658_101968261 328
214 3300005328 Ga0070676_10057247 Ga0070676_100572472 328
215 3300005338 Ga0068868_100080157 Ga0068868_1000801572 328
216 3300005338 Ga0068868_100184182 Ga0068868_1001841821 328
217 3300005344 Ga0070661_100317260 Ga0070661_1003172601 328
218 3300005353 Ga0070669_100079455 Ga0070669_1000794552 328
219 3300005354 Ga0070675_100001733 Ga0070675_10000173310 328
220 3300005355 Ga0070671_100004476 Ga0070671_1000044764 328
221 3300005356 Ga0070674_100005616 Ga0070674_1000056165 328
222 3300005367 Ga0070667_100016492 Ga0070667_1000164924 328
223 3300005456 Ga0070678_100176557 Ga0070678_1001765572 328
224 3300005459 Ga0068867_100021447 Ga0068867_1000214473 328
225 3300005539 Ga0068853_100354329 Ga0068853_1003543291 328
226 3300005616 Ga0068852_100162799 Ga0068852_1001627992 328
227 3300005618 Ga0068864_100153517 Ga0068864_1001535172 328
228 3300005718 Ga0068866_10031509 Ga0068866_100315092 328
229 3300005719 Ga0068861_100265810 Ga0068861_1002658103 328
230 3300005840 Ga0068870_10150193 Ga0068870_101501933 328
231 3300005841 Ga0068863_100054985 Ga0068863_1000549854 328
232 3300005844 Ga0068862_100326014 Ga0068862_1003260141 328
233 3300006358 Ga0068871_100032087 Ga0068871_1000320872 328
234 3300006871 Ga0075434_100369756 Ga0075434_1003697561 328
235 3300009098 Ga0105245_10012088 Ga0105245_100120884 328
236 3300009101 Ga0105247_10198224 Ga0105247_101982242 328
237 3300009148 Ga0105243_10226000 Ga0105243_102260002 328
238 3300009177 Ga0105248_10083235 Ga0105248_100832353 328
239 3300009177 Ga0105248_10404995 Ga0105248_104049951 328
240 3300009545 Ga0105237_10454120 Ga0105237_104541201 328
241 3300010375 Ga0105239_10483842 Ga0105239_104838421 328
242 3300013306 Ga0163162_10239580 Ga0163162_102395802 328
243 3300013308 Ga0157375_10020725 Ga0157375_100207254 328
244 3300014325 Ga0163163_10096759 Ga0163163_100967593 328
245 3300014326 Ga0157380_10087811 Ga0157380_100878112 328
246 3300014326 Ga0157380_10158652 Ga0157380_101586522 328
247 3300014968 Ga0157379_10017722 Ga0157379_100177223 328
248 3300025206 Ga0209435_100001 Ga0209435_100001630 328
249 3300025245 Ga0207425_1008428 Ga0207425_10084283 328
250 3300025246 Ga0209646_1000001 Ga0209646_1000001999 328
251 3300025250 Ga0209026_1000003 Ga0209026_1000003630 328
252 3300025256 Ga0209759_1000001 Ga0209759_1000001630 328
253 3300025263 Ga0209565_1000004 Ga0209565_1000004577 328
254 3300025273 Ga0209673_1000074 Ga0209673_1000074205 328
255 3300025284 Ga0209130_1000082 Ga0209130_1000082107 328
256 3300025291 Ga0209675_1001253 Ga0209675_100125315 328
257 3300025292 Ga0209676_1000029 Ga0209676_1000029326 328
258 3300025294 Ga0209025_1014059 Ga0209025_10140594 328
259 3300025295 Ga0209564_1001244 Ga0209564_100124412 328
260 3300025297 Ga0209758_1057641 Ga0209758_10576412 328
261 3300025298 Ga0209050_1000003 Ga0209050_1000003388 328
262 3300025299 Ga0209256_1000001 Ga0209256_1000001390 328
263 3300025302 Ga0207426_1002464 Ga0207426_10024644 328
264 3300025303 Ga0209051_1000003 Ga0209051_1000003388 328
265 3300025304 Ga0209257_1000018 Ga0209257_1000018388 328
266 3300025315 Ga0207697_10072477 Ga0207697_100724772 328
267 3300025899 Ga0207642_10020166 Ga0207642_100201662 328
268 3300025923 Ga0207681_10061746 Ga0207681_100617462 328
269 3300025925 Ga0207650_10002722 Ga0207650_1000272211 328
270 3300025926 Ga0207659_10000256 Ga0207659_1000025632 328
271 3300025927 Ga0207687_10053653 Ga0207687_100536532 328
272 3300025927 Ga0207687_10185564 Ga0207687_101855642 328
273 3300025931 Ga0207644_10021303 Ga0207644_100213032 328
274 3300025933 Ga0207706_10170700 Ga0207706_101707002 328
275 3300025934 Ga0207686_10171067 Ga0207686_101710671 328
276 3300025938 Ga0207704_10040711 Ga0207704_100407112 328
277 3300025940 Ga0207691_10000360 Ga0207691_1000036045 328
278 3300025960 Ga0207651_10023043 Ga0207651_100230433 328
279 3300025986 Ga0207658_10090649 Ga0207658_100906492 328
280 3300026023 Ga0207677_10069942 Ga0207677_100699422 328
281 3300026023 Ga0207677_10243055 Ga0207677_102430552 328
282 3300026089 Ga0207648_10003420 Ga0207648_100034206 328
283 3300026089 Ga0207648_10023605 Ga0207648_100236052 328
284 3300026089 Ga0207648_10099845 Ga0207648_100998452 328
285 3300026095 Ga0207676_10062352 Ga0207676_100623521 328
286 3300026095 Ga0207676_10082436 Ga0207676_100824361 328
287 3300026121 Ga0207683_10002951 Ga0207683_1000295111 328
288 3300026121 Ga0207683_10036681 Ga0207683_100366814 328
289 3300028379 Ga0268266_10211875 Ga0268266_102118751 328
290 3300028381 Ga0268264_10129384 Ga0268264_101293842 328
291 3300031456 Ga0307513_10000019 Ga0307513_100000194 328
292 3300031456 Ga0307513_10000051 Ga0307513_10000051123 328
293 3300031852 Ga0307410_10016709 Ga0307410_100167091 328
294 3300031901 Ga0307406_10006998 Ga0307406_100069981 328
295 3300031903 Ga0307407_10134193 Ga0307407_101341931 328
296 3300031911 Ga0307412_10008248 Ga0307412_100082485 328
297 3300032004 Ga0307414_10011968 Ga0307414_100119682 328
298 3300032005 Ga0307411_10015798 Ga0307411_100157982 328
299 3300041404 Ga0439436_0013301 Ga0439436_0013301_1201_2187 328
300 3300044673 Ga0453683_0004388 Ga0453683_0004388_5571_6572 328
301 3300045051 Ga0451576_0003846 Ga0451576_0003846_16875_17876 328
302 3300048909 Ga0496106_0339859 Ga0496106_0339859_89_1093 328
303 3300050493 nmdc:mga0k408_8612_c1 nmdc:mga0k408_8612_c1_1002_1988 328
304 3300053730 Ga0500645_000198 Ga0500645_000198_19124_20122 328
305 3300053730 Ga0500645_002382 Ga0500645_002382_4373_5371 328
306 iso_pu_bacteria 2857542790 2857543433 328
307 iso_pu_bacteria 2928115317 2928119630 328
308 3300003187 JGI25151J46595_10009742 JGI25151J46595_100097424 329
309 3300003354 JGI25160J50197_1000123 JGI25160J50197_100012335 329
310 3300003374 JGI25161J50226_1000032 JGI25161J50226_100003240 329
311 3300003792 Ga0055540_1003742 Ga0055540_10037424 329
312 3300003794 Ga0055531_10002524 Ga0055531_100025244 329
313 3300004625 Ga0055543_1000294 Ga0055543_100029434 329
314 3300005262 Ga0065165_1018453 Ga0065165_10184531 329
315 3300005262 Ga0065165_1028107 Ga0065165_10281071 329
316 3300005289 Ga0065704_10079326 Ga0065704_100793263 329
317 3300005330 Ga0070690_100106265 Ga0070690_1001062652 329
318 3300005331 Ga0070670_100008068 Ga0070670_1000080682 329
319 3300005334 Ga0068869_100009675 Ga0068869_1000096755 329
320 3300005340 Ga0070689_100307199 Ga0070689_1003071992 329
321 3300005353 Ga0070669_100117767 Ga0070669_1001177671 329
322 3300005354 Ga0070675_100028703 Ga0070675_1000287032 329
323 3300005356 Ga0070674_100206818 Ga0070674_1002068182 329
324 3300005367 Ga0070667_100241592 Ga0070667_1002415922 329
325 3300005440 Ga0070705_100220159 Ga0070705_1002201591 329
326 3300005456 Ga0070678_100068917 Ga0070678_1000689172 329
327 3300005458 Ga0070681_10036162 Ga0070681_100361623 329
328 3300005539 Ga0068853_100096607 Ga0068853_1000966072 329
329 3300005543 Ga0070672_100010425 Ga0070672_1000104254 329
330 3300005545 Ga0070695_100177467 Ga0070695_1001774671 329
331 3300005548 Ga0070665_100203426 Ga0070665_1002034262 329
332 3300005618 Ga0068864_100002200 Ga0068864_1000022004 329
333 3300005618 Ga0068864_100089148 Ga0068864_1000891482 329
334 3300005618 Ga0068864_100242456 Ga0068864_1002424563 329
335 3300005841 Ga0068863_100002680 Ga0068863_1000026805 329
336 3300005841 Ga0068863_100022184 Ga0068863_1000221841 329
337 3300005844 Ga0068862_100090846 Ga0068862_1000908463 329
338 3300006237 Ga0097621_100017078 Ga0097621_1000170782 329
339 3300006237 Ga0097621_100074079 Ga0097621_1000740791 329
340 3300006358 Ga0068871_100005755 Ga0068871_1000057556 329
341 3300006358 Ga0068871_100011783 Ga0068871_1000117836 329
342 3300009093 Ga0105240_10440104 Ga0105240_104401041 329
343 3300009148 Ga0105243_10093995 Ga0105243_100939951 329
344 3300009174 Ga0105241_10010537 Ga0105241_100105373 329
345 3300009176 Ga0105242_10025996 Ga0105242_100259964 329
346 3300009545 Ga0105237_10011624 Ga0105237_100116242 329
347 3300010375 Ga0105239_10231109 Ga0105239_102311092 329
348 3300013308 Ga0157375_10085470 Ga0157375_100854702 329
349 3300014325 Ga0163163_10009364 Ga0163163_100093648 329
350 3300014326 Ga0157380_10087180 Ga0157380_100871801 329
351 3300025245 Ga0207425_1002090 Ga0207425_10020907 329
352 3300025258 Ga0209129_1006848 Ga0209129_10068483 329
353 3300025284 Ga0209130_1000050 Ga0209130_1000050220 329
354 3300025292 Ga0209676_1007573 Ga0209676_10075733 329
355 3300025298 Ga0209050_1004456 Ga0209050_10044563 329
356 3300025302 Ga0207426_1000071 Ga0207426_100007136 329
357 3300025303 Ga0209051_1000542 Ga0209051_100054227 329
358 3300025304 Ga0209257_1000012 Ga0209257_1000012607 329
359 3300025908 Ga0207643_10002912 Ga0207643_100029124 329
360 3300025911 Ga0207654_10066265 Ga0207654_100662652 329
361 3300025912 Ga0207707_10043109 Ga0207707_100431092 329
362 3300025913 Ga0207695_10328361 Ga0207695_103283611 329
363 3300025917 Ga0207660_10142588 Ga0207660_101425881 329
364 3300025925 Ga0207650_10003389 Ga0207650_100033897 329
365 3300025925 Ga0207650_10029364 Ga0207650_100293642 329
366 3300025931 Ga0207644_10004912 Ga0207644_100049127 329
367 3300025934 Ga0207686_10059632 Ga0207686_100596322 329
368 3300025935 Ga0207709_10121303 Ga0207709_101213032 329
369 3300025936 Ga0207670_10051220 Ga0207670_100512203 329
370 3300025942 Ga0207689_10009368 Ga0207689_100093683 329
371 3300025960 Ga0207651_10118548 Ga0207651_101185481 329
372 3300026088 Ga0207641_10008475 Ga0207641_100084751 329
373 3300026089 Ga0207648_10010728 Ga0207648_100107282 329
374 3300026095 Ga0207676_10018219 Ga0207676_100182193 329
375 3300026095 Ga0207676_10267560 Ga0207676_102675602 329
376 3300026121 Ga0207683_10041187 Ga0207683_100411872 329
377 3300046501 Ga0495607_0000280 Ga0495607_0000280_50592_51590 329
378 3300048927 Ga0496124_0000103 Ga0496124_0000103_32233_33261 329
379 3300048928 Ga0496125_0032129 Ga0496125_0032129_264_1259 329
380 3300048928 Ga0496125_0079823 Ga0496125_0079823_1275_2267 329
381 3300050491 nmdc:mga00v17_573_c1 nmdc:mga00v17_573_c1_7611_8657 329
382 iso_pu_bacteria 2511231221 2512036216 329
383 iso_pu_bacteria 2513020051 2513231804 329
384 iso_pu_bacteria 2599185214 2599626658 329
385 iso_pu_bacteria 2599185226 2599675722 329
386 iso_pu_bacteria 2599185227 2599684195 329
387 iso_pu_bacteria 2599185229 2599696209 329
388 iso_pu_bacteria 2643221658 2644327934 329
389 iso_pu_bacteria 2643221672 2644397895 329
390 iso_pu_bacteria 2643221683 2644468265 329
391 iso_pu_bacteria 2738541277 2738718076 329
392 iso_pu_bacteria 2738541307 2738885026 329
393 iso_pu_bacteria 2738543019 2739278762 329
394 iso_pu_bacteria 2818991446 2819595767 329
395 iso_pu_bacteria 2831265667 2831266779 329
396 iso_pu_bacteria 2838054893 2838057140 329
397 iso_pu_bacteria 2842677519 2842682580 329
398 iso_pu_bacteria 2842733646 2842735580 329
399 iso_pu_bacteria 2842747753 2842751324 329
400 iso_pu_bacteria 2885192300 2885192722 329
401 iso_pu_bacteria 2885198086 2885201228 329
402 iso_pu_bacteria 2885211737 2885214882 329
403 iso_pu_bacteria 2899924645 2899925113 329
404 iso_pu_bacteria 2904541872 2904544746 329
405 iso_pu_bacteria 2919462493 2919465986 329
406 iso_pu_bacteria 2928037797 2928038762 329
407 iso_pu_bacteria 2928044640 2928045633 329
408 iso_pu_bacteria 2928051484 2928053250 329
409 iso_pu_bacteria 2928064002 2928066855 329
410 iso_pu_bacteria 2928070936 2928071258 329
411 iso_pu_bacteria 2928084124 2928084813 329
412 iso_pu_bacteria 2929160207 2929163583 329
413 iso_pu_bacteria 2929520902 2929526991 329
414 iso_pu_bacteria 2945909444 2945912270 329
415 iso_pu_bacteria 2945945610 2945948205 329
416 iso_pu_bacteria 2945984333 2945985418 329
417 iso_pu_bacteria 8054002106 8054008476 329
418 3300003187 JGI25151J46595_10001070 JGI25151J46595_1000107015 330
419 3300003771 Ga0055526_1002671 Ga0055526_10026712 330
420 3300003773 Ga0055537_1001952 Ga0055537_10019525 330
421 3300003775 Ga0055524_1000987 Ga0055524_100098713 330
422 3300003775 Ga0055524_1010495 Ga0055524_10104952 330
423 3300003784 Ga0055534_1001022 Ga0055534_10010226 330
424 3300006948 Ga0099826_10000027 Ga0099826_10000027106 330
425 3300009011 Ga0105251_10024824 Ga0105251_100248242 330
426 3300025263 Ga0209565_1000840 Ga0209565_100084016 330
427 3300025263 Ga0209565_1005531 Ga0209565_10055312 330
428 3300025291 Ga0209675_1001153 Ga0209675_10011532 330
429 3300025291 Ga0209675_1006841 Ga0209675_10068413 330
430 3300025294 Ga0209025_1001156 Ga0209025_100115628 330
431 3300025294 Ga0209025_1002301 Ga0209025_100230111 330
432 3300025295 Ga0209564_1001617 Ga0209564_10016177 330
433 3300025297 Ga0209758_1025030 Ga0209758_10250302 330
434 3300025299 Ga0209256_1000127 Ga0209256_100012748 330
435 3300025299 Ga0209256_1001660 Ga0209256_100166016 330
436 3300025303 Ga0209051_1011223 Ga0209051_10112232 330
437 3300027666 Ga0209282_1000069 Ga0209282_100006962 330
438 iso_pu_bacteria 2599185292 2599902924 330
439 iso_pu_bacteria 2643221569 2643861747 330
440 iso_pu_bacteria 2643221594 2643983218 330
441 iso_pu_bacteria 2643221621 2644123479 330
442 iso_pu_bacteria 2738543013 2739250454 330
443 iso_pu_bacteria 2808606395 2809033257 330
444 iso_pu_bacteria 2842333319 2842335009 330
445 iso_pu_bacteria 2857537821 2857538244 330
446 iso_pu_bacteria 2858950400 2858952054 330
447 iso_pu_bacteria 2904449895 2904454448 330
448 iso_pu_bacteria 2904456579 2904461109 330
449 iso_pu_bacteria 2941479691 2941482493 330
450 iso_pu_bacteria 2945972063 2945977150 330
451 3300001976 JGI24752J21851_1012623 JGI24752J21851_10126231 331
452 3300002077 JGI24744J21845_10010624 JGI24744J21845_100106241 331
453 3300002244 JGI24742J22300_10017095 JGI24742J22300_100170952 331
454 3300002459 JGI24751J29686_10011003 JGI24751J29686_100110031 331
455 3300005290 Ga0065712_10207832 Ga0065712_102078321 331
456 3300005293 Ga0065715_10281030 Ga0065715_102810301 331
457 3300005327 Ga0070658_10345218 Ga0070658_103452181 331
458 3300005328 Ga0070676_10009016 Ga0070676_100090164 331
459 3300005329 Ga0070683_100016058 Ga0070683_1000160582 331
460 3300005329 Ga0070683_100038041 Ga0070683_1000380413 331
461 3300005330 Ga0070690_100194951 Ga0070690_1001949511 331
462 3300005331 Ga0070670_100007028 Ga0070670_1000070285 331
463 3300005334 Ga0068869_100006883 Ga0068869_1000068835 331
464 3300005335 Ga0070666_10036543 Ga0070666_100365433 331
465 3300005338 Ga0068868_100105100 Ga0068868_1001051002 331
466 3300005338 Ga0068868_100112968 Ga0068868_1001129682 331
467 3300005339 Ga0070660_100024939 Ga0070660_1000249393 331
468 3300005340 Ga0070689_100108410 Ga0070689_1001084103 331
469 3300005344 Ga0070661_100052808 Ga0070661_1000528081 331
470 3300005345 Ga0070692_10024699 Ga0070692_100246992 331
471 3300005347 Ga0070668_100037769 Ga0070668_1000377692 331
472 3300005353 Ga0070669_100091165 Ga0070669_1000911652 331
473 3300005355 Ga0070671_100013333 Ga0070671_1000133336 331
474 3300005355 Ga0070671_100068661 Ga0070671_1000686611 331
475 3300005356 Ga0070674_100126153 Ga0070674_1001261532 331
476 3300005365 Ga0070688_100046408 Ga0070688_1000464082 331
477 3300005366 Ga0070659_100085438 Ga0070659_1000854382 331
478 3300005366 Ga0070659_100228912 Ga0070659_1002289121 331
479 3300005367 Ga0070667_100276296 Ga0070667_1002762961 331
480 3300005434 Ga0070709_10247758 Ga0070709_102477582 331
481 3300005438 Ga0070701_10016695 Ga0070701_100166951 331
482 3300005439 Ga0070711_100224782 Ga0070711_1002247821 331
483 3300005441 Ga0070700_100012190 Ga0070700_1000121903 331
484 3300005455 Ga0070663_100010823 Ga0070663_1000108232 331
485 3300005456 Ga0070678_100081283 Ga0070678_1000812832 331
486 3300005457 Ga0070662_100071446 Ga0070662_1000714462 331
487 3300005466 Ga0070685_10008963 Ga0070685_100089632 331
488 3300005535 Ga0070684_100005497 Ga0070684_1000054973 331
489 3300005547 Ga0070693_100047331 Ga0070693_1000473312 331
490 3300005563 Ga0068855_100140928 Ga0068855_1001409282 331
491 3300005564 Ga0070664_100005648 Ga0070664_1000056483 331
492 3300005564 Ga0070664_100203650 Ga0070664_1002036502 331
493 3300005577 Ga0068857_100133759 Ga0068857_1001337592 331
494 3300005578 Ga0068854_100013238 Ga0068854_1000132382 331
495 3300005614 Ga0068856_100107344 Ga0068856_1001073442 331
496 3300005615 Ga0070702_100032707 Ga0070702_1000327073 331
497 3300005616 Ga0068852_100043337 Ga0068852_1000433372 331
498 3300005617 Ga0068859_100291338 Ga0068859_1002913381 331
499 3300005618 Ga0068864_100059378 Ga0068864_1000593782 331
500 3300005719 Ga0068861_100095858 Ga0068861_1000958582 331
501 3300005842 Ga0068858_100018789 Ga0068858_1000187895 331
502 3300005842 Ga0068858_100108207 Ga0068858_1001082072 331
503 3300005843 Ga0068860_100145104 Ga0068860_1001451042 331
504 3300005844 Ga0068862_100011044 Ga0068862_1000110444 331
505 3300006175 Ga0070712_100014780 Ga0070712_1000147804 331
506 3300006237 Ga0097621_100108313 Ga0097621_1001083133 331
507 3300006358 Ga0068871_100086507 Ga0068871_1000865072 331
508 3300006881 Ga0068865_100020605 Ga0068865_1000206053 331
509 3300006931 Ga0097620_100291337 Ga0097620_1002913372 331
510 3300009094 Ga0111539_10033508 Ga0111539_100335082 331
511 3300009098 Ga0105245_10037607 Ga0105245_100376072 331
512 3300009148 Ga0105243_10017874 Ga0105243_100178742 331
513 3300009176 Ga0105242_10121024 Ga0105242_101210243 331
514 3300009545 Ga0105237_10063747 Ga0105237_100637473 331
515 3300013102 Ga0157371_10086060 Ga0157371_100860601 331
516 3300013296 Ga0157374_10133683 Ga0157374_101336832 331
517 3300013297 Ga0157378_10011046 Ga0157378_100110467 331
518 3300014325 Ga0163163_10010625 Ga0163163_100106252 331
519 3300014326 Ga0157380_10120306 Ga0157380_101203062 331
520 3300014968 Ga0157379_10011595 Ga0157379_100115953 331
521 3300014969 Ga0157376_10079954 Ga0157376_100799541 331
522 3300017792 Ga0163161_10268497 Ga0163161_102684971 331
523 3300025290 Ga0207673_1001090 Ga0207673_10010902 331
524 3300025315 Ga0207697_10000857 Ga0207697_1000085718 331
525 3300025321 Ga0207656_10005144 Ga0207656_100051444 331
526 3300025321 Ga0207656_10007254 Ga0207656_100072542 331
527 3300025893 Ga0207682_10000120 Ga0207682_100001208 331
528 3300025903 Ga0207680_10065967 Ga0207680_100659671 331
529 3300025907 Ga0207645_10001475 Ga0207645_1000147511 331
530 3300025908 Ga0207643_10000681 Ga0207643_1000068116 331
531 3300025909 Ga0207705_10030042 Ga0207705_100300424 331
532 3300025918 Ga0207662_10004254 Ga0207662_100042543 331
533 3300025919 Ga0207657_10005234 Ga0207657_100052349 331
534 3300025920 Ga0207649_10021763 Ga0207649_100217633 331
535 3300025920 Ga0207649_10215899 Ga0207649_102158991 331
536 3300025923 Ga0207681_10023616 Ga0207681_100236162 331
537 3300025925 Ga0207650_10009669 Ga0207650_100096692 331
538 3300025925 Ga0207650_10071477 Ga0207650_100714772 331
539 3300025926 Ga0207659_10009618 Ga0207659_100096185 331
540 3300025931 Ga0207644_10008335 Ga0207644_100083357 331
541 3300025931 Ga0207644_10094604 Ga0207644_100946042 331
542 3300025933 Ga0207706_10000850 Ga0207706_100008508 331
543 3300025934 Ga0207686_10314153 Ga0207686_103141531 331
544 3300025937 Ga0207669_10008390 Ga0207669_100083903 331
545 3300025938 Ga0207704_10018726 Ga0207704_100187263 331
546 3300025940 Ga0207691_10020172 Ga0207691_100201725 331
547 3300025941 Ga0207711_10066931 Ga0207711_100669312 331
548 3300025942 Ga0207689_10000307 Ga0207689_1000030726 331
549 3300025944 Ga0207661_10017959 Ga0207661_100179593 331
550 3300025944 Ga0207661_10275474 Ga0207661_102754742 331
551 3300025945 Ga0207679_10015100 Ga0207679_100151005 331
552 3300025945 Ga0207679_10019703 Ga0207679_100197033 331
553 3300025972 Ga0207668_10009980 Ga0207668_100099804 331
554 3300025981 Ga0207640_10067975 Ga0207640_100679751 331
555 3300025981 Ga0207640_10078491 Ga0207640_100784912 331
556 3300025986 Ga0207658_10092294 Ga0207658_100922941 331
557 3300026023 Ga0207677_10090162 Ga0207677_100901622 331
558 3300026035 Ga0207703_10026771 Ga0207703_100267713 331
559 3300026041 Ga0207639_10107710 Ga0207639_101077102 331
560 3300026067 Ga0207678_10001655 Ga0207678_1000165515 331
561 3300026075 Ga0207708_10000529 Ga0207708_100005298 331
562 3300026078 Ga0207702_10246674 Ga0207702_102466741 331
563 3300026088 Ga0207641_10063711 Ga0207641_100637111 331
564 3300026089 Ga0207648_10002743 Ga0207648_1000274314 331
565 3300026095 Ga0207676_10037987 Ga0207676_100379873 331
566 3300026116 Ga0207674_10003249 Ga0207674_1000324910 331
567 3300026116 Ga0207674_10093743 Ga0207674_100937432 331
568 3300026118 Ga0207675_100058990 Ga0207675_1000589903 331
569 3300026121 Ga0207683_10010884 Ga0207683_100108842 331
570 3300026142 Ga0207698_10016839 Ga0207698_100168394 331
571 3300028379 Ga0268266_10127158 Ga0268266_101271583 331
572 3300028380 Ga0268265_10046919 Ga0268265_100469192 331
573 3300028381 Ga0268264_10129464 Ga0268264_101294642 331
574 3300035172 Ga0373955_0213183 Ga0373955_0213183_40_1041 331
575 3300035724 Ga0373933_0092230 Ga0373933_0092230_521_1522 331
576 3300035725 Ga0373947_0148886 Ga0373947_0148886_437_1438 331
577 3300046539 Ga0495621_0026542 Ga0495621_0026542_860_1861 331
578 3300048904 Ga0496101_0020827 Ga0496101_0020827_2054_3055 331
579 3300048905 Ga0496102_0061675 Ga0496102_0061675_2342_3343 331
580 3300048906 Ga0496103_0015705 Ga0496103_0015705_339_1337 331
581 3300048909 Ga0496106_0173091 Ga0496106_0173091_507_1508 331
582 3300048911 Ga0496108_0015385 Ga0496108_0015385_1937_2938 331
583 3300048911 Ga0496108_0078227 Ga0496108_0078227_1469_2467 331
584 3300048912 Ga0496109_0005385 Ga0496109_0005385_4768_5769 331
585 3300048913 Ga0496110_0055926 Ga0496110_0055926_190_1188 331
586 3300048917 Ga0496114_0106912 Ga0496114_0106912_1137_2138 331
587 3300050511 nmdc:mga08y16_169739_c1 nmdc:mga08y16_169739_c1_201_1202 331
588 iso_pu_bacteria 2511231002 2511245938 331
589 3300013105 Ga0157369_10205582 Ga0157369_102055822 332
590 3300003187 JGI25151J46595_10000556 JGI25151J46595_1000055622 333
591 3300003215 JGI25153J46596_10016831 JGI25153J46596_100168312 333
592 3300003354 JGI25160J50197_1010348 JGI25160J50197_10103482 333
593 3300003374 JGI25161J50226_1005856 JGI25161J50226_10058563 333
594 3300003761 Ga0055535_1001386 Ga0055535_100138610 333
595 3300003762 Ga0055542_1000021 Ga0055542_1000021263 333
596 3300003771 Ga0055526_1009970 Ga0055526_10099702 333
597 3300003781 Ga0055536_1000657 Ga0055536_10006578 333
598 3300003781 Ga0055536_1001022 Ga0055536_100102220 333
599 3300003784 Ga0055534_1005386 Ga0055534_10053862 333
600 3300003791 Ga0055530_10000453 Ga0055530_1000045322 333
601 3300005844 Ga0068862_100072612 Ga0068862_1000726123 333
602 3300006195 Ga0075366_10008599 Ga0075366_100085993 333
603 3300006237 Ga0097621_100135946 Ga0097621_1001359462 333
604 3300006353 Ga0075370_10003631 Ga0075370_100036313 333
605 3300006353 Ga0075370_10007859 Ga0075370_100078591 333
606 3300006353 Ga0075370_10011390 Ga0075370_100113904 333
607 3300006353 Ga0075370_10127413 Ga0075370_101274132 333
608 3300017792 Ga0163161_10001014 Ga0163161_1000101415 333
609 3300025208 Ga0209436_105668 Ga0209436_1056683 333
610 3300025229 Ga0209147_101220 Ga0209147_10122010 333
611 3300025242 Ga0209258_100058 Ga0209258_100058262 333
612 3300025254 Ga0209148_1000071 Ga0209148_1000071262 333
613 3300025258 Ga0209129_1005627 Ga0209129_10056272 333
614 3300025258 Ga0209129_1006005 Ga0209129_10060051 333
615 3300025263 Ga0209565_1006363 Ga0209565_10063634 333
616 3300025273 Ga0209673_1000066 Ga0209673_1000066203 333
617 3300025284 Ga0209130_1000816 Ga0209130_10008165 333
618 3300025284 Ga0209130_1004224 Ga0209130_10042243 333
619 3300025291 Ga0209675_1008946 Ga0209675_10089462 333
620 3300025291 Ga0209675_1026318 Ga0209675_10263182 333
621 3300025292 Ga0209676_1000005 Ga0209676_1000005764 333
622 3300025294 Ga0209025_1000351 Ga0209025_100035169 333
623 3300025294 Ga0209025_1000766 Ga0209025_100076632 333
624 3300025294 Ga0209025_1003418 Ga0209025_100341815 333
625 3300025294 Ga0209025_1017671 Ga0209025_10176713 333
626 3300025295 Ga0209564_1000090 Ga0209564_1000090187 333
627 3300025298 Ga0209050_1000007 Ga0209050_1000007333 333
628 3300025299 Ga0209256_1000022 Ga0209256_1000022106 333
629 3300025302 Ga0207426_1000031 Ga0207426_1000031262 333
630 3300025303 Ga0209051_1000036 Ga0209051_1000036115 333
631 3300025303 Ga0209051_1031858 Ga0209051_10318582 333
632 3300025304 Ga0209257_1000011 Ga0209257_1000011738 333
633 3300025304 Ga0209257_1011452 Ga0209257_10114523 333
634 3300025728 Ga0207655_1008917 Ga0207655_10089172 333
635 3300025935 Ga0207709_10003703 Ga0207709_100037032 333
636 3300025945 Ga0207679_10009175 Ga0207679_100091753 333
637 3300026116 Ga0207674_10050112 Ga0207674_100501123 333
638 3300026121 Ga0207683_10062761 Ga0207683_100627613 333
639 3300027666 Ga0209282_1089479 Ga0209282_10894792 333
640 3300028380 Ga0268265_10015157 Ga0268265_100151574 333
641 3300030732 Ga0316176_1111959 Ga0316176_11119592 333
642 3300030733 Ga0314311_1018953 Ga0314311_10189534 333
643 3300030742 Ga0316183_1163725 Ga0316183_11637252 333
644 3300030744 Ga0316181_1083351 Ga0316181_10833514 333
645 3300031548 Ga0307408_100036080 Ga0307408_1000360803 333
646 3300032002 Ga0307416_100031041 Ga0307416_1000310412 333
647 3300041413 Ga0439465_0000905 Ga0439465_0000905_8337_9338 333
648 3300042004 Ga0439445_0000950 Ga0439445_0000950_4637_5638 333
649 3300042007 Ga0439449_0000923 Ga0439449_0000923_3077_4078 333
650 3300042014 Ga0439457_002549 Ga0439457_002549_106_1128 333
651 3300050496 nmdc:mga07m45_6054_c1 nmdc:mga07m45_6054_c1_967_1977 333
652 2162886007 SwRhRL2b_contig_3784724 SwRhRL2b_0136.00008440 334
653 3300005289 Ga0065704_10169162 Ga0065704_101691621 334
654 3300028794 Ga0307515_10000267 Ga0307515_1000026740 334
655 3300031456 Ga0307513_10013784 Ga0307513_100137848 334
656 3300031548 Ga0307408_100112537 Ga0307408_1001125372 334
657 3300031649 Ga0307514_10000806 Ga0307514_1000080610 334
658 3300031911 Ga0307412_10085387 Ga0307412_100853872 334
659 3300048928 Ga0496125_0001023 Ga0496125_0001023_25130_26134 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02608

Bmp

ABC transporter substrate-binding protein PnrA-like

103

356

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pi5-assembly4.cif.gz_D the evolving story of atzt, a periplasmic binding protein 0.9113 32 321
7x0r-assembly1.cif.gz_A crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum 0.8993 32 323
3s99-assembly1.cif.gz_A crystal structure of a basic membrane lipoprotein from brucella melitensis, iodide soak 0.8882 32 321
6shu-assembly1.cif.gz_A borrelia burgdorferi bmpd nucleoside binding protein bound to adenosine 0.8735 30 325
2hqb-assembly1.cif.gz_A crystal structure of a transcriptional activator of comk gene from bacillus halodurans 0.8468 33 320
ID Description Score Start End Superfamily
3s99A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8935 135 321 3.40.50.2300
2fqwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8889 31 131 3.40.50.2300
3s99A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8692 32 131 3.40.50.2300
4p98A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8374 35 131 3.40.50.2300
4iilA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8141 135 323 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A833G2L3-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9907 47 332 GO:0005886
AF-A0A530APJ8-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9884 133 331 GO:0005886
AF-V7EVA4-F1-model_v4 ABC transporter substrate-binding protein 0.9851 92 331 GO:0005886
AF-A0A530APJ8-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9787 133 331 GO:0005886
AF-A0A833G2L3-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9772 47 332 GO:0005886

Feature Viewer

pLDDT pTM Quality
91.13 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map