F473179

General Info

Members Datasets Scaffolds Average Seq Length
658 307 1316 111

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10383059|Ga0207657_103830592
Length 133
Sequence MHRAVEIKMNWPLPASISCPPAMPHAPQSDVLRGTIELLVLKTLALTPMHGWGIGQRIQQISKGALEVNQGSLYPALQRLEHQGLITSAWGPSESNRRARYYRLTAAGRRALGEATASWRRFAAAIEVVLRTT

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
205 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
206 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 1.67
Rhizosphere 97.72
Stem 0
Stem Tuber 0
Unclassified 33.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_10383059 3300025919 Bacteria 1107
2 JGI24751J29686_10107959 3300002459 Unclassified 582
3 Ga0065712_10098456 3300005290 Bacteria 2118
4 Ga0065715_10364685 3300005293 Unclassified 899
5 Ga0070658_10955814 3300005327 Bacteria 745
6 Ga0070676_10222377 3300005328 Unclassified 1247
7 Ga0070683_100029423 3300005329 Bacteria 4973
8 Ga0070683_100168932 3300005329 Bacteria 2076
9 Ga0070683_100328968 3300005329 Bacteria 1455
10 Ga0070683_100378187 3300005329 Bacteria 1349
11 Ga0070690_100020945 3300005330 Unclassified 3989
12 Ga0070670_100007060 3300005331 Bacteria 9522
13 Ga0070670_100119529 3300005331 Bacteria 2273
14 Ga0070670_100147469 3300005331 Bacteria 2036
15 Ga0070670_100358342 3300005331 Bacteria 1282
16 Ga0070670_100501238 3300005331 Bacteria 1080
17 Ga0070677_10156976 3300005333 Unclassified 1064
18 Ga0070677_10287266 3300005333 Bacteria 831
19 Ga0070677_10315466 3300005333 Bacteria 799
20 Ga0068869_100035654 3300005334 Unclassified 3527
21 Ga0068869_100306927 3300005334 Unclassified 1283
22 Ga0070666_10386266 3300005335 Bacteria 1005
23 Ga0070680_100023124 3300005336 Bacteria 4955
24 Ga0070680_100133387 3300005336 Bacteria 2079
25 Ga0070680_100834661 3300005336 Unclassified 794
26 Ga0070680_101029389 3300005336 Unclassified 711
27 Ga0070680_101341420 3300005336 Bacteria 619
28 Ga0070682_100483173 3300005337 Unclassified 956
29 Ga0070682_101970308 3300005337 Bacteria 513
30 Ga0068868_100352521 3300005338 Unclassified 1261
31 Ga0068868_101292641 3300005338 Bacteria 677
32 Ga0070660_101399902 3300005339 Bacteria 594
33 Ga0070689_100139522 3300005340 Bacteria 1949
34 Ga0070689_101169241 3300005340 Unclassified 690
35 Ga0070689_101823021 3300005340 Bacteria 555
36 Ga0070691_10581766 3300005341 Bacteria 658
37 Ga0070687_101051395 3300005343 Unclassified 593
38 Ga0070661_101809489 3300005344 Bacteria 518
39 Ga0070692_10227581 3300005345 Unclassified 1105
40 Ga0070692_10653505 3300005345 Bacteria 702
41 Ga0070668_100045979 3300005347 Bacteria 3350
42 Ga0070668_100057417 3300005347 Unclassified 3008
43 Ga0070668_100154635 3300005347 Bacteria 1857
44 Ga0070668_100282894 3300005347 Bacteria 1386
45 Ga0070668_101463089 3300005347 Bacteria 624
46 Ga0070669_100058670 3300005353 Bacteria 2825
47 Ga0070669_100517201 3300005353 Unclassified 992
48 Ga0070669_101199121 3300005353 Unclassified 656
49 Ga0070675_100001658 3300005354 Bacteria 16459
50 Ga0070675_100222435 3300005354 Bacteria 1644
51 Ga0070675_100774094 3300005354 Bacteria 876
52 Ga0070675_101031507 3300005354 Bacteria 755
53 Ga0070675_101459726 3300005354 Unclassified 631
54 Ga0070674_100009267 3300005356 Bacteria 5892
55 Ga0070674_100342853 3300005356 Unclassified 1204
56 Ga0070674_100494881 3300005356 Bacteria 1017
57 Ga0070674_101598619 3300005356 Unclassified 588
58 Ga0070673_100022223 3300005364 Unclassified 4614
59 Ga0070673_100651416 3300005364 Bacteria 964
60 Ga0070688_100014193 3300005365 Unclassified 4510
61 Ga0070688_100030014 3300005365 Bacteria 3260
62 Ga0070688_100034823 3300005365 Bacteria 3054
63 Ga0070659_100040356 3300005366 Unclassified 3647
64 Ga0070659_101146134 3300005366 Unclassified 686
65 Ga0070659_101174015 3300005366 Unclassified 678
66 Ga0070667_100013968 3300005367 Bacteria 6636
67 Ga0070667_100128790 3300005367 Bacteria 2208
68 Ga0070667_100619192 3300005367 Unclassified 998
69 Ga0070667_100689149 3300005367 Bacteria 945
70 Ga0070709_10057821 3300005434 Bacteria 2458
71 Ga0070714_100026838 3300005435 Bacteria 4763
72 Ga0070714_100103445 3300005435 Unclassified 2512
73 Ga0070714_100163215 3300005435 Bacteria 2017
74 Ga0070714_100356933 3300005435 Bacteria 1374
75 Ga0070714_100894262 3300005435 Bacteria 862
76 Ga0070713_100013737 3300005436 Bacteria 5988
77 Ga0070713_100025049 3300005436 Bacteria 4659
78 Ga0070713_100131798 3300005436 Bacteria 2205
79 Ga0070713_100211129 3300005436 Unclassified 1757
80 Ga0070710_10867460 3300005437 Bacteria 649
81 Ga0070701_10621959 3300005438 Bacteria 718
82 Ga0070701_10753444 3300005438 Unclassified 660
83 Ga0070711_100165555 3300005439 Unclassified 1680
84 Ga0070711_100255414 3300005439 Unclassified 1377
85 Ga0070700_100216169 3300005441 Unclassified 1355
86 Ga0070700_100287991 3300005441 Unclassified 1194
87 Ga0070700_101375696 3300005441 Unclassified 596
88 Ga0070694_100831035 3300005444 Unclassified 759
89 Ga0070694_101026951 3300005444 Bacteria 685
90 Ga0070678_101879215 3300005456 Bacteria 565
91 Ga0070681_10003278 3300005458 Bacteria 15111
92 Ga0070681_10005781 3300005458 Bacteria 11965
93 Ga0070681_10205722 3300005458 Unclassified 1885
94 Ga0070681_10236150 3300005458 Unclassified 1742
95 Ga0070681_10288868 3300005458 Bacteria 1550
96 Ga0070681_10865904 3300005458 Bacteria 821
97 Ga0068867_100223980 3300005459 Unclassified 1517
98 Ga0068867_101273904 3300005459 Unclassified 678
99 Ga0070685_10043287 3300005466 Bacteria 2574
100 Ga0070707_100818515 3300005468 Bacteria 895
101 Ga0070698_100040209 3300005471 Bacteria 4808
102 Ga0070698_100326282 3300005471 Bacteria 1466
103 Ga0070698_100372030 3300005471 Unclassified 1361
104 Ga0070698_100445420 3300005471 Bacteria 1230
105 Ga0070699_100053410 3300005518 Bacteria 3497
106 Ga0070699_100426854 3300005518 Unclassified 1200
107 Ga0070699_100505973 3300005518 Bacteria 1097
108 Ga0070699_101088258 3300005518 Bacteria 733
109 Ga0070679_100019029 3300005530 Bacteria 6671
110 Ga0070679_100289553 3300005530 Unclassified 1589
111 Ga0070679_100292933 3300005530 Bacteria 1579
112 Ga0070679_100301757 3300005530 Unclassified 1552
113 Ga0070679_101447455 3300005530 Bacteria 634
114 Ga0070684_100123127 3300005535 Bacteria 2334
115 Ga0070684_100467616 3300005535 Bacteria 1166
116 Ga0070684_101132586 3300005535 Bacteria 735
117 Ga0070684_101369154 3300005535 Bacteria 666
118 Ga0070697_100090946 3300005536 Unclassified 2523
119 Ga0070697_100801484 3300005536 Bacteria 833
120 Ga0070672_100134948 3300005543 Unclassified 2032
121 Ga0070672_100170885 3300005543 Unclassified 1808
122 Ga0070686_100013269 3300005544 Bacteria 4713
123 Ga0070696_100016728 3300005546 Bacteria 4946
124 Ga0070696_100315587 3300005546 Unclassified 1201
125 Ga0070696_100469629 3300005546 Bacteria 996
126 Ga0070696_101435524 3300005546 Unclassified 589
127 Ga0070693_100025700 3300005547 Unclassified 3171
128 Ga0070693_100270691 3300005547 Unclassified 1134
129 Ga0070665_101751275 3300005548 Unclassified 628
130 Ga0070704_102132778 3300005549 Unclassified 521
131 Ga0068855_100925904 3300005563 Bacteria 919
132 Ga0070664_100023792 3300005564 Bacteria 5061
133 Ga0070664_100070945 3300005564 Bacteria 2985
134 Ga0070664_100073273 3300005564 Bacteria 2938
135 Ga0070664_100495566 3300005564 Bacteria 1126
136 Ga0070664_100518280 3300005564 Unclassified 1100
137 Ga0068857_100021149 3300005577 Bacteria 5725
138 Ga0068857_100077174 3300005577 Unclassified 2972
139 Ga0068857_100289975 3300005577 Bacteria 1507
140 Ga0068857_100368636 3300005577 Bacteria 1332
141 Ga0068857_100406715 3300005577 Bacteria 1267
142 Ga0068857_100605769 3300005577 Unclassified 1036
143 Ga0068852_101241560 3300005616 Bacteria 767
144 Ga0068859_100063711 3300005617 Bacteria 3718
145 Ga0068859_100114471 3300005617 Unclassified 2761
146 Ga0068859_100156348 3300005617 Bacteria 2357
147 Ga0068859_100573499 3300005617 Unclassified 1222
148 Ga0068859_100904608 3300005617 Unclassified 967
149 Ga0068864_100002122 3300005618 Bacteria 16393
150 Ga0068864_100190636 3300005618 Bacteria 1879
151 Ga0068866_10019122 3300005718 Bacteria 3111
152 Ga0068866_10534764 3300005718 Bacteria 781
153 Ga0068866_10924582 3300005718 Unclassified 615
154 Ga0068861_100817036 3300005719 Unclassified 876
155 Ga0068861_100952090 3300005719 Unclassified 817
156 Ga0068870_10067367 3300005840 Bacteria 1942
157 Ga0068863_100232326 3300005841 Bacteria 1779
158 Ga0068863_100393820 3300005841 Unclassified 1354
159 Ga0068858_100071162 3300005842 Bacteria 3225
160 Ga0068858_100565888 3300005842 Unclassified 1101
161 Ga0068860_100353173 3300005843 Unclassified 1447
162 Ga0068860_100496036 3300005843 Unclassified 1219
163 Ga0068860_101963455 3300005843 Bacteria 607
164 Ga0068862_100331629 3300005844 Bacteria 1407
165 Ga0068862_101275410 3300005844 Bacteria 735
166 Ga0068862_101773461 3300005844 Bacteria 626
167 Ga0070717_10142806 3300006028 Bacteria 2066
168 Ga0070717_10279987 3300006028 Bacteria 1479
169 Ga0070717_10541361 3300006028 Bacteria 1054
170 Ga0070717_10568743 3300006028 Unclassified 1027
171 Ga0070716_100431087 3300006173 Unclassified 956
172 Ga0070716_100493170 3300006173 Bacteria 902
173 Ga0070712_100021822 3300006175 Unclassified 4212
174 Ga0097621_100111572 3300006237 Bacteria 2311
175 Ga0068871_100740931 3300006358 Bacteria 903
176 Ga0075428_100009513 3300006844 Bacteria 10790
177 Ga0075428_100054808 3300006844 Bacteria 4369
178 Ga0075428_100076115 3300006844 Bacteria 3664
179 Ga0075428_100166504 3300006844 Unclassified 2391
180 Ga0075428_100185523 3300006844 Unclassified 2251
181 Ga0075428_100252362 3300006844 Bacteria 1901
182 Ga0075430_100083299 3300006846 Unclassified 2679
183 Ga0075430_100089507 3300006846 Bacteria 2575
184 Ga0075430_100099136 3300006846 Bacteria 2433
185 Ga0075430_100138551 3300006846 Bacteria 2026
186 Ga0075430_100194214 3300006846 Bacteria 1686
187 Ga0075431_100009694 3300006847 Bacteria 9673
188 Ga0075431_100062362 3300006847 Bacteria 3847
189 Ga0075431_100080152 3300006847 Bacteria 3371
190 Ga0075431_100195366 3300006847 Unclassified 2072
191 Ga0075431_100227878 3300006847 Unclassified 1899
192 Ga0075431_100250238 3300006847 Unclassified 1801
193 Ga0075431_100388671 3300006847 Bacteria 1398
194 Ga0075433_10265049 3300006852 Bacteria 1523
195 Ga0075433_10408653 3300006852 Bacteria 1197
196 Ga0075433_10489801 3300006852 Bacteria 1083
197 Ga0075433_11179132 3300006852 Unclassified 665
198 Ga0075433_11185669 3300006852 Unclassified 663
199 Ga0075434_100215882 3300006871 Bacteria 1938
200 Ga0075434_100216504 3300006871 Unclassified 1935
201 Ga0075434_100447596 3300006871 Bacteria 1313
202 Ga0075434_100637619 3300006871 Unclassified 1084
203 Ga0075429_100000195 3300006880 Bacteria 40131
204 Ga0075429_100236483 3300006880 Bacteria 1600
205 Ga0075429_100262958 3300006880 Unclassified 1511
206 Ga0075429_100877694 3300006880 Unclassified 785
207 Ga0075429_101332457 3300006880 Unclassified 626
208 Ga0075429_101683081 3300006880 Bacteria 551
209 Ga0068865_100246199 3300006881 Bacteria 1409
210 Ga0068865_100347316 3300006881 Unclassified 1201
211 Ga0068865_101409807 3300006881 Bacteria 622
212 Ga0075436_100754025 3300006914 Bacteria 723
213 Ga0097620_100063709 3300006931 Bacteria 3718
214 Ga0097620_100114455 3300006931 Unclassified 2761
215 Ga0097620_100156346 3300006931 Bacteria 2357
216 Ga0097620_100573426 3300006931 Unclassified 1222
217 Ga0097620_100904616 3300006931 Unclassified 967
218 Ga0105240_12266949 3300009093 Bacteria 563
219 Ga0111539_10020906 3300009094 Bacteria 8059
220 Ga0111539_10049929 3300009094 Unclassified 4986
221 Ga0111539_10233480 3300009094 Bacteria 2141
222 Ga0111539_10610095 3300009094 Bacteria 1271
223 Ga0111539_11721039 3300009094 Bacteria 727
224 Ga0111539_11766246 3300009094 Bacteria 717
225 Ga0111539_11861627 3300009094 Unclassified 698
226 Ga0105245_10282493 3300009098 Unclassified 1623
227 Ga0105245_10428487 3300009098 Bacteria 1327
228 Ga0105245_10492192 3300009098 Bacteria 1241
229 Ga0105245_10542317 3300009098 Unclassified 1184
230 Ga0105245_11363031 3300009098 Bacteria 759
231 Ga0105247_10013323 3300009101 Bacteria 4936
232 Ga0114129_10000783 3300009147 Bacteria 40711
233 Ga0114129_10007271 3300009147 Bacteria 15759
234 Ga0114129_10018849 3300009147 Bacteria 9829
235 Ga0114129_10032955 3300009147 Bacteria 7321
236 Ga0114129_10088931 3300009147 Bacteria 4282
237 Ga0114129_10142753 3300009147 Bacteria 3281
238 Ga0114129_10149608 3300009147 Bacteria 3195
239 Ga0114129_10286315 3300009147 Unclassified 2200
240 Ga0114129_10315181 3300009147 Bacteria 2081
241 Ga0114129_10501441 3300009147 Bacteria 1585
242 Ga0114129_10691023 3300009147 Bacteria 1312
243 Ga0114129_10812679 3300009147 Unclassified 1192
244 Ga0114129_11431822 3300009147 Unclassified 852
245 Ga0105243_10077136 3300009148 Unclassified 2709
246 Ga0105243_12773201 3300009148 Unclassified 530
247 Ga0105241_10970405 3300009174 Bacteria 793
248 Ga0105242_10187686 3300009176 Bacteria 1828
249 Ga0105248_10302514 3300009177 Bacteria 1801
250 Ga0105248_10321306 3300009177 Unclassified 1743
251 Ga0105248_10500016 3300009177 Unclassified 1371
252 Ga0105249_10529214 3300009553 Unclassified 1227
253 Ga0105249_11400638 3300009553 Bacteria 771
254 Ga0105249_11524772 3300009553 Unclassified 741
255 Ga0105246_10300657 3300011119 Bacteria 1295
256 Ga0105246_10818872 3300011119 Unclassified 828
257 Ga0157373_10028794 3300013100 Bacteria 4006
258 Ga0157373_11463998 3300013100 Unclassified 521
259 Ga0157370_10090648 3300013104 Unclassified 2870
260 Ga0157369_10259624 3300013105 Bacteria 1812
261 Ga0157374_10179150 3300013296 Unclassified 2069
262 Ga0157374_10378957 3300013296 Bacteria 1409
263 Ga0157378_10450583 3300013297 Unclassified 1277
264 Ga0163162_10383299 3300013306 Bacteria 1539
265 Ga0163162_10445466 3300013306 Bacteria 1427
266 Ga0163162_13415250 3300013306 Bacteria 507
267 Ga0157372_10004164 3300013307 Bacteria 15481
268 Ga0157372_11355155 3300013307 Bacteria 821
269 Ga0157372_11520944 3300013307 Unclassified 771
270 Ga0157375_10070695 3300013308 Unclassified 3501
271 Ga0157375_10285691 3300013308 Bacteria 1813
272 Ga0157375_11418327 3300013308 Bacteria 818
273 Ga0163163_10068580 3300014325 Bacteria 3529
274 Ga0163163_10087558 3300014325 Bacteria 3125
275 Ga0157380_10086595 3300014326 Bacteria 2575
276 Ga0157380_10380170 3300014326 Unclassified 1332
277 Ga0157380_11081049 3300014326 Bacteria 840
278 Ga0157380_11439977 3300014326 Bacteria 740
279 Ga0157377_10164998 3300014745 Bacteria 1380
280 Ga0157379_10048537 3300014968 Bacteria 3789
281 Ga0157379_10554155 3300014968 Unclassified 1070
282 Ga0157376_10603499 3300014969 Unclassified 1093
283 Ga0163161_10442504 3300017792 Unclassified 1049
284 Ga0197907_11045495 3300020069 Bacteria 1129
285 Ga0206356_10476587 3300020070 Unclassified 581
286 Ga0213876_10002252 3300021384 Bacteria 11394
287 Ga0207710_10054157 3300025900 Bacteria 1806
288 Ga0207688_10136851 3300025901 Unclassified 1439
289 Ga0207680_10374543 3300025903 Bacteria 1003
290 Ga0207645_10075161 3300025907 Bacteria 2163
291 Ga0207645_10421818 3300025907 Unclassified 899
292 Ga0207643_10073472 3300025908 Bacteria 1971
293 Ga0207654_11250382 3300025911 Unclassified 541
294 Ga0207707_10003673 3300025912 Bacteria 13608
295 Ga0207707_10006814 3300025912 Bacteria 9969
296 Ga0207707_10013101 3300025912 Bacteria 7224
297 Ga0207707_10224597 3300025912 Unclassified 1635
298 Ga0207707_10248728 3300025912 Bacteria 1544
299 Ga0207707_10286448 3300025912 Bacteria 1426
300 Ga0207707_11664267 3300025912 Bacteria 501
301 Ga0207695_10026677 3300025913 Bacteria 6446
302 Ga0207693_10017126 3300025915 Bacteria 5782
303 Ga0207663_10169145 3300025916 Bacteria 1551
304 Ga0207663_10529789 3300025916 Bacteria 918
305 Ga0207663_10932933 3300025916 Bacteria 695
306 Ga0207660_10016243 3300025917 Bacteria 4926
307 Ga0207660_10180265 3300025917 Bacteria 1640
308 Ga0207660_10571929 3300025917 Bacteria 920
309 Ga0207660_11231950 3300025917 Bacteria 608
310 Ga0207662_10413642 3300025918 Bacteria 916
311 Ga0207649_10487020 3300025920 Bacteria 936
312 Ga0207652_10002498 3300025921 Bacteria 15476
313 Ga0207652_10148540 3300025921 Unclassified 2098
314 Ga0207652_10169873 3300025921 Bacteria 1956
315 Ga0207652_10374264 3300025921 Unclassified 1286
316 Ga0207652_10550616 3300025921 Bacteria 1037
317 Ga0207646_11771702 3300025922 Bacteria 529
318 Ga0207646_11868208 3300025922 Unclassified 512
319 Ga0207681_10067044 3300025923 Bacteria 2487
320 Ga0207681_10183388 3300025923 Unclassified 1596
321 Ga0207681_10390873 3300025923 Unclassified 1121
322 Ga0207681_10920831 3300025923 Bacteria 732
323 Ga0207694_11572607 3300025924 Unclassified 554
324 Ga0207650_10029513 3300025925 Bacteria 3943
325 Ga0207650_10033814 3300025925 Bacteria 3705
326 Ga0207650_10109560 3300025925 Unclassified 2136
327 Ga0207650_10671543 3300025925 Unclassified 874
328 Ga0207650_11129315 3300025925 Bacteria 667
329 Ga0207650_11233326 3300025925 Bacteria 637
330 Ga0207659_10000997 3300025926 Bacteria 16822
331 Ga0207659_10316432 3300025926 Bacteria 1286
332 Ga0207659_10361511 3300025926 Bacteria 1206
333 Ga0207659_10811892 3300025926 Bacteria 804
334 Ga0207659_11076774 3300025926 Unclassified 692
335 Ga0207687_11192140 3300025927 Unclassified 654
336 Ga0207700_10000277 3300025928 Bacteria 30584
337 Ga0207700_10203969 3300025928 Unclassified 1668
338 Ga0207700_10226802 3300025928 Bacteria 1586
339 Ga0207664_10027291 3300025929 Unclassified 4327
340 Ga0207664_10230328 3300025929 Unclassified 1610
341 Ga0207664_10384189 3300025929 Bacteria 1247
342 Ga0207644_10995334 3300025931 Bacteria 704
343 Ga0207690_10045027 3300025932 Unclassified 2913
344 Ga0207690_11086244 3300025932 Bacteria 667
345 Ga0207686_10083494 3300025934 Bacteria 2091
346 Ga0207709_10054321 3300025935 Bacteria 2469
347 Ga0207709_10463664 3300025935 Unclassified 982
348 Ga0207709_11692067 3300025935 Unclassified 526
349 Ga0207670_10188282 3300025936 Bacteria 1560
350 Ga0207670_10356145 3300025936 Bacteria 1160
351 Ga0207670_11602632 3300025936 Bacteria 554
352 Ga0207669_10005418 3300025937 Bacteria 5724
353 Ga0207669_10371023 3300025937 Unclassified 1112
354 Ga0207669_10577407 3300025937 Bacteria 911
355 Ga0207704_10042862 3300025938 Bacteria 2668
356 Ga0207704_10133308 3300025938 Bacteria 1725
357 Ga0207704_10606425 3300025938 Bacteria 897
358 Ga0207704_11056569 3300025938 Bacteria 689
359 Ga0207665_10130625 3300025939 Bacteria 1783
360 Ga0207665_10665831 3300025939 Bacteria 817
361 Ga0207665_11567688 3300025939 Unclassified 523
362 Ga0207691_10157970 3300025940 Unclassified 1990
363 Ga0207711_10073118 3300025941 Unclassified 2979
364 Ga0207711_10200808 3300025941 Bacteria 1819
365 Ga0207689_10035682 3300025942 Unclassified 4130
366 Ga0207689_10277858 3300025942 Bacteria 1387
367 Ga0207689_10301326 3300025942 Unclassified 1328
368 Ga0207661_10023207 3300025944 Bacteria 4686
369 Ga0207661_10516712 3300025944 Bacteria 1092
370 Ga0207679_10064250 3300025945 Bacteria 2743
371 Ga0207679_10163175 3300025945 Bacteria 1826
372 Ga0207679_10298010 3300025945 Bacteria 1389
373 Ga0207667_10393336 3300025949 Bacteria 1411
374 Ga0207651_10827021 3300025960 Unclassified 822
375 Ga0207651_11076067 3300025960 Unclassified 720
376 Ga0207712_10505760 3300025961 Bacteria 1033
377 Ga0207712_11033689 3300025961 Unclassified 730
378 Ga0207668_10036610 3300025972 Bacteria 3277
379 Ga0207668_10085763 3300025972 Bacteria 2299
380 Ga0207668_10386016 3300025972 Bacteria 1180
381 Ga0207668_10708077 3300025972 Unclassified 885
382 Ga0207640_10011393 3300025981 Bacteria 5034
383 Ga0207640_10333126 3300025981 Unclassified 1213
384 Ga0207658_10022430 3300025986 Unclassified 4396
385 Ga0207658_10390848 3300025986 Bacteria 1220
386 Ga0207658_11638996 3300025986 Unclassified 588
387 Ga0207677_10045525 3300026023 Bacteria 2930
388 Ga0207677_11314237 3300026023 Unclassified 664
389 Ga0207703_10045155 3300026035 Bacteria 3543
390 Ga0207678_10629677 3300026067 Bacteria 942
391 Ga0207708_10134120 3300026075 Bacteria 1938
392 Ga0207708_10145183 3300026075 Unclassified 1864
393 Ga0207708_10233380 3300026075 Unclassified 1478
394 Ga0207708_10713517 3300026075 Bacteria 858
395 Ga0207641_10706297 3300026088 Bacteria 993
396 Ga0207641_11364292 3300026088 Bacteria 710
397 Ga0207648_10259509 3300026089 Bacteria 1550
398 Ga0207648_10863811 3300026089 Unclassified 844
399 Ga0207648_11359912 3300026089 Unclassified 667
400 Ga0207676_10878048 3300026095 Bacteria 878
401 Ga0207674_10017395 3300026116 Bacteria 7845
402 Ga0207674_10401981 3300026116 Bacteria 1324
403 Ga0207674_10767730 3300026116 Unclassified 930
404 Ga0207674_10854549 3300026116 Bacteria 877
405 Ga0207675_100964159 3300026118 Unclassified 870
406 Ga0207683_10293643 3300026121 Bacteria 1486
407 Ga0207698_11630613 3300026142 Bacteria 660
408 Ga0209969_1077310 3300027360 Bacteria 531
409 Ga0209968_1099028 3300027526 Bacteria 531
410 Ga0209974_10049129 3300027876 Bacteria 1415
411 Ga0207428_10030434 3300027907 Bacteria 4462
412 Ga0207428_10496292 3300027907 Bacteria 887
413 Ga0207428_11064652 3300027907 Bacteria 566
414 Ga0268266_11974782 3300028379 Unclassified 557
415 Ga0268265_10131920 3300028380 Bacteria 2078
416 Ga0268265_10133051 3300028380 Bacteria 2070
417 Ga0268265_12009224 3300028380 Bacteria 585
418 Ga0268264_10670865 3300028381 Bacteria 1027
419 Ga0268264_10981879 3300028381 Bacteria 850
420 Ga0268264_11236832 3300028381 Unclassified 756
421 Ga0307408_100002369 3300031548 Bacteria 13310
422 Ga0307408_100083239 3300031548 Bacteria 2397
423 Ga0307408_100303279 3300031548 Unclassified 1339
424 Ga0307408_100615891 3300031548 Bacteria 966
425 Ga0307408_100824925 3300031548 Unclassified 843
426 Ga0307408_100972008 3300031548 Unclassified 781
427 Ga0307405_10206798 3300031731 Bacteria 1430
428 Ga0307405_10417590 3300031731 Unclassified 1055
429 Ga0307413_10387715 3300031824 Bacteria 1091
430 Ga0307413_10956086 3300031824 Unclassified 731
431 Ga0307413_11895519 3300031824 Bacteria 535
432 Ga0307413_12178245 3300031824 Unclassified 502
433 Ga0307410_11339820 3300031852 Unclassified 627
434 Ga0307406_10047786 3300031901 Bacteria 2699
435 Ga0307406_10353543 3300031901 Bacteria 1149
436 Ga0307406_10741352 3300031901 Unclassified 824
437 Ga0307412_10000642 3300031911 Bacteria 20318
438 Ga0307412_10220733 3300031911 Bacteria 1453
439 Ga0307412_10623082 3300031911 Bacteria 917
440 Ga0307412_10858420 3300031911 Bacteria 792
441 Ga0307409_100157010 3300031995 Unclassified 1984
442 Ga0307409_100555988 3300031995 Bacteria 1127
443 Ga0307409_101886475 3300031995 Unclassified 627
444 Ga0307416_100017794 3300032002 Unclassified 4985
445 Ga0307416_100038516 3300032002 Unclassified 3689
446 Ga0307416_100178628 3300032002 Bacteria 1987
447 Ga0307416_100278834 3300032002 Unclassified 1647
448 Ga0307416_100642306 3300032002 Bacteria 1145
449 Ga0307416_101095540 3300032002 Unclassified 901
450 Ga0307416_101199894 3300032002 Unclassified 864
451 Ga0307411_10008140 3300032005 Bacteria 5409
452 Ga0307411_10318515 3300032005 Unclassified 1255
453 Ga0307411_10411241 3300032005 Bacteria 1121
454 Ga0307411_11456432 3300032005 Bacteria 628
455 Ga0307411_12349407 3300032005 Unclassified 501
456 Ga0307415_100237857 3300032126 Bacteria 1471
457 Ga0307415_100596051 3300032126 Unclassified 983
458 Ga0307415_100609056 3300032126 Unclassified 973
459 Ga0307415_101393737 3300032126 Unclassified 667
460 Ga0316583_10000074 3300032133 Bacteria 20904
461 Ga0316583_10000149 3300032133 Bacteria 16832
462 Ga0373934_0000471 3300035086 Bacteria 14069
463 Ga0373944_0005097 3300035089 Unclassified 3451
464 Ga0373923_0010669 3300035111 Bacteria 3350
465 Ga0373941_0315289 3300035115 Bacteria 628
466 Ga0373945_0013223 3300035116 Unclassified 2752
467 Ga0373954_0034427 3300035118 Bacteria 2346
468 Ga0373956_0002108 3300035119 Bacteria 8239
469 Ga0373957_0028846 3300035120 Bacteria 2024
470 Ga0373960_0185516 3300035121 Bacteria 728
471 Ga0373943_0010090 3300035170 Unclassified 4235
472 Ga0373946_0000874 3300035171 Bacteria 10368
473 Ga0373955_0002749 3300035172 Bacteria 7718
474 Ga0373961_0442578 3300035241 Bacteria 505
475 Ga0373924_0015150 3300035410 Unclassified 2925
476 Ga0373931_0775861 3300035691 Unclassified 638
477 Ga0373935_0023987 3300035692 Bacteria 3750
478 Ga0373935_0130707 3300035692 Unclassified 1687
479 Ga0373935_0306611 3300035692 Bacteria 1123
480 Ga0373927_0061604 3300035695 Unclassified 2427
481 Ga0373933_0000215 3300035724 Bacteria 38112
482 Ga0373947_0011937 3300035725 Bacteria 4976
483 Ga0373947_0826656 3300035725 Bacteria 632
484 Ga0373937_0006331 3300036401 Bacteria 10208
485 Ga0373937_0590653 3300036401 Bacteria 1054
486 Ga0373925_0001875 3300037068 Bacteria 17464
487 Ga0395898_0504432 3300037466 Unclassified 1151
488 Ga0436364_0208104 3300037853 Bacteria 3838
489 Ga0395901_1376270 3300038443 Bacteria 665
490 Ga0436365_0205767 3300039437 Bacteria 16017
491 Ga0439442_149385 3300042002 Unclassified 519
492 Ga0439450_175348 3300042008 Unclassified 568
493 Ga0439455_0103528 3300042012 Bacteria 788
494 Ga0439446_0159023 3300042156 Unclassified 746
495 Ga0439434_0017557 3300042435 Bacteria 2141
496 Ga0439460_0260853 3300042461 Unclassified 600
497 Ga0453683_0062008 3300044673 Bacteria 2338
498 Ga0466968_0448615 3300044735 Bacteria 638
499 Ga0466957_0535770 3300044842 Bacteria 815
500 Ga0466958_0425560 3300045836 Bacteria 858
501 Ga0466967_0031768 3300045976 Bacteria 4451
502 Ga0466967_0269857 3300045976 Unclassified 1630
503 Ga0495592_0089958 3300046454 Bacteria 2203
504 Ga0495603_0002359 3300046455 Bacteria 11083
505 Ga0495629_0045238 3300046459 Unclassified 3089
506 Ga0495641_0154400 3300046461 Bacteria 1026
507 Ga0495651_0011271 3300046462 Bacteria 6871
508 Ga0495653_0005951 3300046463 Bacteria 9985
509 Ga0495580_0013749 3300046472 Bacteria 6163
510 Ga0495582_0000618 3300046473 Bacteria 19543
511 Ga0495639_0002837 3300046475 Bacteria 7529
512 Ga0495664_0156612 3300046477 Bacteria 1382
513 Ga0495594_0033657 3300046499 Unclassified 2787
514 Ga0495608_0010771 3300046511 Bacteria 6373
515 Ga0495628_0000672 3300046516 Bacteria 31412
516 Ga0495630_0000652 3300046517 Bacteria 25068
517 Ga0495630_0002917 3300046517 Bacteria 11888
518 Ga0495652_0003030 3300046529 Bacteria 16850
519 Ga0495665_0001191 3300046531 Bacteria 13849
520 Ga0495665_0312363 3300046531 Bacteria 803
521 Ga0495586_0045008 3300046535 Bacteria 2378
522 Ga0495587_0000162 3300046536 Bacteria 48485
523 Ga0495645_0005353 3300046543 Bacteria 8797
524 Ga0495645_0509108 3300046543 Unclassified 751
525 Ga0495667_0001019 3300046559 Bacteria 18123
526 Ga0495634_0258105 3300046642 Bacteria 1064
527 Ga0495635_0000137 3300046663 Bacteria 44393
528 Ga0495659_0238650 3300046664 Bacteria 755
529 Ga0495588_0000635 3300046674 Bacteria 16302
530 Ga0495657_0000930 3300046675 Bacteria 25867
531 Ga0495599_0003272 3300046678 Bacteria 9439
532 Ga0495623_0000112 3300046679 Bacteria 49285
533 Ga0495646_0000561 3300046680 Bacteria 20140
534 Ga0495658_0000123 3300046683 Bacteria 42198
535 Ga0495613_0008231 3300046689 Bacteria 7743
536 Ga0495600_0004152 3300046809 Bacteria 8627
537 Ga0495581_0001728 3300047315 Bacteria 12172
538 Ga0495581_0013630 3300047315 Bacteria 4715
539 Ga0495581_0557152 3300047315 Bacteria 665
540 Ga0495604_0000266 3300047317 Bacteria 46520
541 Ga0495636_0377053 3300047318 Unclassified 673
542 Ga0495674_0002199 3300047319 Bacteria 19172
543 Ga0495674_1044091 3300047319 Bacteria 624
544 Ga0495672_0004260 3300047320 Bacteria 11809
545 Ga0495680_0007874 3300047322 Bacteria 9724
546 Ga0495675_0012654 3300047444 Bacteria 5310
547 Ga0495684_0000094 3300047471 Bacteria 62993
548 Ga0495593_0000261 3300047673 Bacteria 28501
549 Ga0495593_0049339 3300047673 Bacteria 2233
550 Ga0495602_0002830 3300048088 Bacteria 17761
551 Ga0495614_0001222 3300048089 Bacteria 11056
552 Ga0496102_0616157 3300048905 Bacteria 1008
553 Ga0496104_0301370 3300048907 Bacteria 1515
554 Ga0496104_1068414 3300048907 Bacteria 711
555 Ga0496106_0102755 3300048909 Bacteria 2217
556 Ga0496106_0629422 3300048909 Bacteria 858
557 Ga0496108_0014902 3300048911 Bacteria 6344
558 Ga0496108_0137944 3300048911 Unclassified 2100
559 Ga0496109_0607899 3300048912 Bacteria 1030
560 Ga0496112_0043552 3300048915 Bacteria 4394
561 Ga0496113_1316519 3300048916 Unclassified 561
562 Ga0496114_1316223 3300048917 Bacteria 609
563 Ga0501031_0236741 3300049568 Bacteria 1187
564 Ga0501032_0386496 3300049569 Unclassified 900
565 Ga0501036_0008440 3300049572 Bacteria 8440
566 Ga0501037_0559722 3300049573 Unclassified 771
567 Ga0501038_0163492 3300049574 Bacteria 1807
568 Ga0501039_0353744 3300049575 Unclassified 1154
569 Ga0501040_0615995 3300049576 Unclassified 784
570 Ga0501041_0012406 3300049577 Bacteria 5048
571 Ga0501046_0009428 3300049580 Bacteria 8437
572 Ga0501048_0053345 3300049582 Bacteria 2876
573 Ga0501067_0170112 3300049583 Unclassified 1214
574 Ga0501067_0263965 3300049583 Unclassified 958
575 Ga0501067_0286652 3300049583 Unclassified 917
576 Ga0501069_0138849 3300049585 Unclassified 1394
577 Ga0501069_0872743 3300049585 Unclassified 547
578 Ga0501071_0022623 3300049587 Bacteria 4383
579 Ga0501071_1084205 3300049587 Bacteria 619
580 Ga0501072_0169205 3300049588 Bacteria 1744
581 Ga0501072_0569358 3300049588 Unclassified 894
582 Ga0501073_0061511 3300049589 Bacteria 2620
583 Ga0501074_0187162 3300049590 Bacteria 1476
584 Ga0501075_0037720 3300049591 Bacteria 3611
585 Ga0501076_0008274 3300049592 Bacteria 7620
586 Ga0501077_0016967 3300049593 Bacteria 4593
587 Ga0501079_0111811 3300049741 Bacteria 2123
588 Ga0501079_0245437 3300049741 Unclassified 1399
589 Ga0501080_0042154 3300049742 Bacteria 4252
590 Ga0501083_0217232 3300049744 Unclassified 1246
591 Ga0501035_0159621 3300049822 Bacteria 1953
592 Ga0501035_0178301 3300049822 Bacteria 1832
593 Ga0501045_0210196 3300049824 Bacteria 1449
594 nmdc:mga05p37_116_c1 3300050507 Bacteria 48738
595 nmdc:mga05p37_126151_c1 3300050507 Bacteria 3143
596 nmdc:mga05p37_1461560_c1 3300050507 Bacteria 683
597 nmdc:mga05p37_1886218_c1 3300050507 Unclassified 572
598 nmdc:mga05p37_207319_c1 3300050507 Bacteria 2370
599 nmdc:mga05p37_2244442_c1 3300050507 Unclassified 505
600 nmdc:mga05p37_251719_c1 3300050507 Bacteria 2118
601 nmdc:mga05p37_266489_c1 3300050507 Bacteria 2048
602 nmdc:mga05p37_2898_c1 3300050507 Bacteria 19902
603 nmdc:mga05p37_577965_c1 3300050507 Bacteria 1273
604 nmdc:mga05p37_743679_c1 3300050507 Bacteria 1082
605 nmdc:mga05p37_770545_c1 3300050507 Bacteria 1057
606 nmdc:mga09592_1075112_c1 3300050508 Unclassified 670
607 nmdc:mga09592_117050_c1 3300050508 Bacteria 880
608 nmdc:mga09592_66314_c1 3300050508 Viruses 3059
609 nmdc:mga09592_69610_c1 3300050508 Bacteria 2985
610 nmdc:mga0qj67_1008036_c1 3300050509 Bacteria 653
611 nmdc:mga0qj67_1012090_c1 3300050509 Unclassified 652
612 nmdc:mga0qj67_123473_c1 3300050509 Bacteria 2095
613 nmdc:mga0qj67_140536_c1 3300050509 Bacteria 1958
614 nmdc:mga0qj67_201129_c1 3300050509 Bacteria 1619
615 nmdc:mga0qj67_221256_c1 3300050509 Bacteria 1537
616 nmdc:mga0qj67_861864_c1 3300050509 Unclassified 715
617 nmdc:mga06r32_1183610_c1 3300050510 Bacteria 711
618 nmdc:mga06r32_146937_c1 3300050510 Bacteria 2335
619 nmdc:mga06r32_1521694_c1 3300050510 Unclassified 609
620 nmdc:mga06r32_166095_c1 3300050510 Unclassified 2190
621 nmdc:mga06r32_2087978_c1 3300050510 Unclassified 500
622 nmdc:mga06r32_364356_c1 3300050510 Bacteria 1429
623 nmdc:mga06r32_911743_c1 3300050510 Bacteria 835
624 nmdc:mga08y16_104457_c1 3300050511 Bacteria 2949
625 nmdc:mga08y16_152103_c1 3300050511 Bacteria 2101
626 nmdc:mga08y16_1769214_c1 3300050511 Unclassified 572
627 nmdc:mga08y16_513676_c1 3300050511 Bacteria 1216
628 nmdc:mga08y16_582_c1 3300050511 Bacteria 33956
629 nmdc:mga08y16_829568_c1 3300050511 Bacteria 915
630 nmdc:mga0n895_1183160_c1 3300050512 Bacteria 739
631 nmdc:mga0n895_236667_c1 3300050512 Unclassified 1853
632 nmdc:mga0n895_242770_c1 3300050512 Bacteria 1828
633 nmdc:mga0n895_444491_c1 3300050512 Unclassified 1309
634 nmdc:mga0n895_539455_c1 3300050512 Unclassified 1173
635 nmdc:mga0n895_868368_c1 3300050512 Unclassified 889
636 nmdc:mga0rr50_106696_c1 3300050513 Bacteria 2210
637 nmdc:mga08x19_975550_c1 3300050514 Bacteria 602
638 nmdc:mga0a205_1016300_c1 3300050515 Unclassified 676
639 nmdc:mga0a205_1277011_c1 3300050515 Unclassified 582
640 nmdc:mga0a205_401876_c1 3300050515 Bacteria 1234
641 nmdc:mga0a205_448620_c1 3300050515 Bacteria 1150
642 nmdc:mga0a205_504155_c1 3300050515 Bacteria 1067
643 nmdc:mga0a205_70544_c1 3300050515 Bacteria 3373
644 nmdc:mga0a205_971949_c1 3300050515 Unclassified 696
645 Ga0495601_0028632 3300053077 Bacteria 3451
646 Ga0495612_0001090 3300053078 Bacteria 11112
647 Ga0495612_0220518 3300053078 Bacteria 839
648 Ga0495595_0129799 3300053084 Bacteria 1231
649 Ga0495619_0087232 3300053085 Bacteria 2110
650 Ga0500596_018297 3300053735 Unclassified 1051
651 Ga0501084_0031737 3300054114 Bacteria 4417
652 Ga0501084_0381961 3300054114 Bacteria 1190
653 Ga0590075_161360 3300059424 Bacteria 591
654 Ga0590077_025326 3300059426 Bacteria 1278
655 Ga0501082_0178963 3300060353 Bacteria 1844
656 Ga0501082_0276768 3300060353 Bacteria 1461
657 Ga0501082_1703303 3300060353 Bacteria 550
658 Ga0530510_0028699 3300061734 Bacteria 3990
659 Ga0207657_10383059
660 JGI24751J29686_10107959
661 Ga0065712_10098456
662 Ga0065715_10364685
663 Ga0070658_10955814
664 Ga0070676_10222377
665 Ga0070683_100029423
666 Ga0070683_100168932
667 Ga0070683_100328968
668 Ga0070683_100378187
669 Ga0070690_100020945
670 Ga0070670_100007060
671 Ga0070670_100119529
672 Ga0070670_100147469
673 Ga0070670_100358342
674 Ga0070670_100501238
675 Ga0070677_10156976
676 Ga0070677_10287266
677 Ga0070677_10315466
678 Ga0068869_100035654
679 Ga0068869_100306927
680 Ga0070666_10386266
681 Ga0070680_100023124
682 Ga0070680_100133387
683 Ga0070680_100834661
684 Ga0070680_101029389
685 Ga0070680_101341420
686 Ga0070682_100483173
687 Ga0070682_101970308
688 Ga0068868_100352521
689 Ga0068868_101292641
690 Ga0070660_101399902
691 Ga0070689_100139522
692 Ga0070689_101169241
693 Ga0070689_101823021
694 Ga0070691_10581766
695 Ga0070687_101051395
696 Ga0070661_101809489
697 Ga0070692_10227581
698 Ga0070692_10653505
699 Ga0070668_100045979
700 Ga0070668_100057417
701 Ga0070668_100154635
702 Ga0070668_100282894
703 Ga0070668_101463089
704 Ga0070669_100058670
705 Ga0070669_100517201
706 Ga0070669_101199121
707 Ga0070675_100001658
708 Ga0070675_100222435
709 Ga0070675_100774094
710 Ga0070675_101031507
711 Ga0070675_101459726
712 Ga0070674_100009267
713 Ga0070674_100342853
714 Ga0070674_100494881
715 Ga0070674_101598619
716 Ga0070673_100022223
717 Ga0070673_100651416
718 Ga0070688_100014193
719 Ga0070688_100030014
720 Ga0070688_100034823
721 Ga0070659_100040356
722 Ga0070659_101146134
723 Ga0070659_101174015
724 Ga0070667_100013968
725 Ga0070667_100128790
726 Ga0070667_100619192
727 Ga0070667_100689149
728 Ga0070709_10057821
729 Ga0070714_100026838
730 Ga0070714_100103445
731 Ga0070714_100163215
732 Ga0070714_100356933
733 Ga0070714_100894262
734 Ga0070713_100013737
735 Ga0070713_100025049
736 Ga0070713_100131798
737 Ga0070713_100211129
738 Ga0070710_10867460
739 Ga0070701_10621959
740 Ga0070701_10753444
741 Ga0070711_100165555
742 Ga0070711_100255414
743 Ga0070700_100216169
744 Ga0070700_100287991
745 Ga0070700_101375696
746 Ga0070694_100831035
747 Ga0070694_101026951
748 Ga0070678_101879215
749 Ga0070681_10003278
750 Ga0070681_10005781
751 Ga0070681_10205722
752 Ga0070681_10236150
753 Ga0070681_10288868
754 Ga0070681_10865904
755 Ga0068867_100223980
756 Ga0068867_101273904
757 Ga0070685_10043287
758 Ga0070707_100818515
759 Ga0070698_100040209
760 Ga0070698_100326282
761 Ga0070698_100372030
762 Ga0070698_100445420
763 Ga0070699_100053410
764 Ga0070699_100426854
765 Ga0070699_100505973
766 Ga0070699_101088258
767 Ga0070679_100019029
768 Ga0070679_100289553
769 Ga0070679_100292933
770 Ga0070679_100301757
771 Ga0070679_101447455
772 Ga0070684_100123127
773 Ga0070684_100467616
774 Ga0070684_101132586
775 Ga0070684_101369154
776 Ga0070697_100090946
777 Ga0070697_100801484
778 Ga0070672_100134948
779 Ga0070672_100170885
780 Ga0070686_100013269
781 Ga0070696_100016728
782 Ga0070696_100315587
783 Ga0070696_100469629
784 Ga0070696_101435524
785 Ga0070693_100025700
786 Ga0070693_100270691
787 Ga0070665_101751275
788 Ga0070704_102132778
789 Ga0068855_100925904
790 Ga0070664_100023792
791 Ga0070664_100070945
792 Ga0070664_100073273
793 Ga0070664_100495566
794 Ga0070664_100518280
795 Ga0068857_100021149
796 Ga0068857_100077174
797 Ga0068857_100289975
798 Ga0068857_100368636
799 Ga0068857_100406715
800 Ga0068857_100605769
801 Ga0068852_101241560
802 Ga0068859_100063711
803 Ga0068859_100114471
804 Ga0068859_100156348
805 Ga0068859_100573499
806 Ga0068859_100904608
807 Ga0068864_100002122
808 Ga0068864_100190636
809 Ga0068866_10019122
810 Ga0068866_10534764
811 Ga0068866_10924582
812 Ga0068861_100817036
813 Ga0068861_100952090
814 Ga0068870_10067367
815 Ga0068863_100232326
816 Ga0068863_100393820
817 Ga0068858_100071162
818 Ga0068858_100565888
819 Ga0068860_100353173
820 Ga0068860_100496036
821 Ga0068860_101963455
822 Ga0068862_100331629
823 Ga0068862_101275410
824 Ga0068862_101773461
825 Ga0070717_10142806
826 Ga0070717_10279987
827 Ga0070717_10541361
828 Ga0070717_10568743
829 Ga0070716_100431087
830 Ga0070716_100493170
831 Ga0070712_100021822
832 Ga0097621_100111572
833 Ga0068871_100740931
834 Ga0075428_100009513
835 Ga0075428_100054808
836 Ga0075428_100076115
837 Ga0075428_100166504
838 Ga0075428_100185523
839 Ga0075428_100252362
840 Ga0075430_100083299
841 Ga0075430_100089507
842 Ga0075430_100099136
843 Ga0075430_100138551
844 Ga0075430_100194214
845 Ga0075431_100009694
846 Ga0075431_100062362
847 Ga0075431_100080152
848 Ga0075431_100195366
849 Ga0075431_100227878
850 Ga0075431_100250238
851 Ga0075431_100388671
852 Ga0075433_10265049
853 Ga0075433_10408653
854 Ga0075433_10489801
855 Ga0075433_11179132
856 Ga0075433_11185669
857 Ga0075434_100215882
858 Ga0075434_100216504
859 Ga0075434_100447596
860 Ga0075434_100637619
861 Ga0075429_100000195
862 Ga0075429_100236483
863 Ga0075429_100262958
864 Ga0075429_100877694
865 Ga0075429_101332457
866 Ga0075429_101683081
867 Ga0068865_100246199
868 Ga0068865_100347316
869 Ga0068865_101409807
870 Ga0075436_100754025
871 Ga0097620_100063709
872 Ga0097620_100114455
873 Ga0097620_100156346
874 Ga0097620_100573426
875 Ga0097620_100904616
876 Ga0105240_12266949
877 Ga0111539_10020906
878 Ga0111539_10049929
879 Ga0111539_10233480
880 Ga0111539_10610095
881 Ga0111539_11721039
882 Ga0111539_11766246
883 Ga0111539_11861627
884 Ga0105245_10282493
885 Ga0105245_10428487
886 Ga0105245_10492192
887 Ga0105245_10542317
888 Ga0105245_11363031
889 Ga0105247_10013323
890 Ga0114129_10000783
891 Ga0114129_10007271
892 Ga0114129_10018849
893 Ga0114129_10032955
894 Ga0114129_10088931
895 Ga0114129_10142753
896 Ga0114129_10149608
897 Ga0114129_10286315
898 Ga0114129_10315181
899 Ga0114129_10501441
900 Ga0114129_10691023
901 Ga0114129_10812679
902 Ga0114129_11431822
903 Ga0105243_10077136
904 Ga0105243_12773201
905 Ga0105241_10970405
906 Ga0105242_10187686
907 Ga0105248_10302514
908 Ga0105248_10321306
909 Ga0105248_10500016
910 Ga0105249_10529214
911 Ga0105249_11400638
912 Ga0105249_11524772
913 Ga0105246_10300657
914 Ga0105246_10818872
915 Ga0157373_10028794
916 Ga0157373_11463998
917 Ga0157370_10090648
918 Ga0157369_10259624
919 Ga0157374_10179150
920 Ga0157374_10378957
921 Ga0157378_10450583
922 Ga0163162_10383299
923 Ga0163162_10445466
924 Ga0163162_13415250
925 Ga0157372_10004164
926 Ga0157372_11355155
927 Ga0157372_11520944
928 Ga0157375_10070695
929 Ga0157375_10285691
930 Ga0157375_11418327
931 Ga0163163_10068580
932 Ga0163163_10087558
933 Ga0157380_10086595
934 Ga0157380_10380170
935 Ga0157380_11081049
936 Ga0157380_11439977
937 Ga0157377_10164998
938 Ga0157379_10048537
939 Ga0157379_10554155
940 Ga0157376_10603499
941 Ga0163161_10442504
942 Ga0197907_11045495
943 Ga0206356_10476587
944 Ga0213876_10002252
945 Ga0207710_10054157
946 Ga0207688_10136851
947 Ga0207680_10374543
948 Ga0207645_10075161
949 Ga0207645_10421818
950 Ga0207643_10073472
951 Ga0207654_11250382
952 Ga0207707_10003673
953 Ga0207707_10006814
954 Ga0207707_10013101
955 Ga0207707_10224597
956 Ga0207707_10248728
957 Ga0207707_10286448
958 Ga0207707_11664267
959 Ga0207695_10026677
960 Ga0207693_10017126
961 Ga0207663_10169145
962 Ga0207663_10529789
963 Ga0207663_10932933
964 Ga0207660_10016243
965 Ga0207660_10180265
966 Ga0207660_10571929
967 Ga0207660_11231950
968 Ga0207662_10413642
969 Ga0207649_10487020
970 Ga0207652_10002498
971 Ga0207652_10148540
972 Ga0207652_10169873
973 Ga0207652_10374264
974 Ga0207652_10550616
975 Ga0207646_11771702
976 Ga0207646_11868208
977 Ga0207681_10067044
978 Ga0207681_10183388
979 Ga0207681_10390873
980 Ga0207681_10920831
981 Ga0207694_11572607
982 Ga0207650_10029513
983 Ga0207650_10033814
984 Ga0207650_10109560
985 Ga0207650_10671543
986 Ga0207650_11129315
987 Ga0207650_11233326
988 Ga0207659_10000997
989 Ga0207659_10316432
990 Ga0207659_10361511
991 Ga0207659_10811892
992 Ga0207659_11076774
993 Ga0207687_11192140
994 Ga0207700_10000277
995 Ga0207700_10203969
996 Ga0207700_10226802
997 Ga0207664_10027291
998 Ga0207664_10230328
999 Ga0207664_10384189
1000 Ga0207644_10995334
1001 Ga0207690_10045027
1002 Ga0207690_11086244
1003 Ga0207686_10083494
1004 Ga0207709_10054321
1005 Ga0207709_10463664
1006 Ga0207709_11692067
1007 Ga0207670_10188282
1008 Ga0207670_10356145
1009 Ga0207670_11602632
1010 Ga0207669_10005418
1011 Ga0207669_10371023
1012 Ga0207669_10577407
1013 Ga0207704_10042862
1014 Ga0207704_10133308
1015 Ga0207704_10606425
1016 Ga0207704_11056569
1017 Ga0207665_10130625
1018 Ga0207665_10665831
1019 Ga0207665_11567688
1020 Ga0207691_10157970
1021 Ga0207711_10073118
1022 Ga0207711_10200808
1023 Ga0207689_10035682
1024 Ga0207689_10277858
1025 Ga0207689_10301326
1026 Ga0207661_10023207
1027 Ga0207661_10516712
1028 Ga0207679_10064250
1029 Ga0207679_10163175
1030 Ga0207679_10298010
1031 Ga0207667_10393336
1032 Ga0207651_10827021
1033 Ga0207651_11076067
1034 Ga0207712_10505760
1035 Ga0207712_11033689
1036 Ga0207668_10036610
1037 Ga0207668_10085763
1038 Ga0207668_10386016
1039 Ga0207668_10708077
1040 Ga0207640_10011393
1041 Ga0207640_10333126
1042 Ga0207658_10022430
1043 Ga0207658_10390848
1044 Ga0207658_11638996
1045 Ga0207677_10045525
1046 Ga0207677_11314237
1047 Ga0207703_10045155
1048 Ga0207678_10629677
1049 Ga0207708_10134120
1050 Ga0207708_10145183
1051 Ga0207708_10233380
1052 Ga0207708_10713517
1053 Ga0207641_10706297
1054 Ga0207641_11364292
1055 Ga0207648_10259509
1056 Ga0207648_10863811
1057 Ga0207648_11359912
1058 Ga0207676_10878048
1059 Ga0207674_10017395
1060 Ga0207674_10401981
1061 Ga0207674_10767730
1062 Ga0207674_10854549
1063 Ga0207675_100964159
1064 Ga0207683_10293643
1065 Ga0207698_11630613
1066 Ga0209969_1077310
1067 Ga0209968_1099028
1068 Ga0209974_10049129
1069 Ga0207428_10030434
1070 Ga0207428_10496292
1071 Ga0207428_11064652
1072 Ga0268266_11974782
1073 Ga0268265_10131920
1074 Ga0268265_10133051
1075 Ga0268265_12009224
1076 Ga0268264_10670865
1077 Ga0268264_10981879
1078 Ga0268264_11236832
1079 Ga0307408_100002369
1080 Ga0307408_100083239
1081 Ga0307408_100303279
1082 Ga0307408_100615891
1083 Ga0307408_100824925
1084 Ga0307408_100972008
1085 Ga0307405_10206798
1086 Ga0307405_10417590
1087 Ga0307413_10387715
1088 Ga0307413_10956086
1089 Ga0307413_11895519
1090 Ga0307413_12178245
1091 Ga0307410_11339820
1092 Ga0307406_10047786
1093 Ga0307406_10353543
1094 Ga0307406_10741352
1095 Ga0307412_10000642
1096 Ga0307412_10220733
1097 Ga0307412_10623082
1098 Ga0307412_10858420
1099 Ga0307409_100157010
1100 Ga0307409_100555988
1101 Ga0307409_101886475
1102 Ga0307416_100017794
1103 Ga0307416_100038516
1104 Ga0307416_100178628
1105 Ga0307416_100278834
1106 Ga0307416_100642306
1107 Ga0307416_101095540
1108 Ga0307416_101199894
1109 Ga0307411_10008140
1110 Ga0307411_10318515
1111 Ga0307411_10411241
1112 Ga0307411_11456432
1113 Ga0307411_12349407
1114 Ga0307415_100237857
1115 Ga0307415_100596051
1116 Ga0307415_100609056
1117 Ga0307415_101393737
1118 Ga0316583_10000074
1119 Ga0316583_10000149
1120 Ga0373934_0000471
1121 Ga0373944_0005097
1122 Ga0373923_0010669
1123 Ga0373941_0315289
1124 Ga0373945_0013223
1125 Ga0373954_0034427
1126 Ga0373956_0002108
1127 Ga0373957_0028846
1128 Ga0373960_0185516
1129 Ga0373943_0010090
1130 Ga0373946_0000874
1131 Ga0373955_0002749
1132 Ga0373961_0442578
1133 Ga0373924_0015150
1134 Ga0373931_0775861
1135 Ga0373935_0023987
1136 Ga0373935_0130707
1137 Ga0373935_0306611
1138 Ga0373927_0061604
1139 Ga0373933_0000215
1140 Ga0373947_0011937
1141 Ga0373947_0826656
1142 Ga0373937_0006331
1143 Ga0373937_0590653
1144 Ga0373925_0001875
1145 Ga0395898_0504432
1146 Ga0436364_0208104
1147 Ga0395901_1376270
1148 Ga0436365_0205767
1149 Ga0439442_149385
1150 Ga0439450_175348
1151 Ga0439455_0103528
1152 Ga0439446_0159023
1153 Ga0439434_0017557
1154 Ga0439460_0260853
1155 Ga0453683_0062008
1156 Ga0466968_0448615
1157 Ga0466957_0535770
1158 Ga0466958_0425560
1159 Ga0466967_0031768
1160 Ga0466967_0269857
1161 Ga0495592_0089958
1162 Ga0495603_0002359
1163 Ga0495629_0045238
1164 Ga0495641_0154400
1165 Ga0495651_0011271
1166 Ga0495653_0005951
1167 Ga0495580_0013749
1168 Ga0495582_0000618
1169 Ga0495639_0002837
1170 Ga0495664_0156612
1171 Ga0495594_0033657
1172 Ga0495608_0010771
1173 Ga0495628_0000672
1174 Ga0495630_0000652
1175 Ga0495630_0002917
1176 Ga0495652_0003030
1177 Ga0495665_0001191
1178 Ga0495665_0312363
1179 Ga0495586_0045008
1180 Ga0495587_0000162
1181 Ga0495645_0005353
1182 Ga0495645_0509108
1183 Ga0495667_0001019
1184 Ga0495634_0258105
1185 Ga0495635_0000137
1186 Ga0495659_0238650
1187 Ga0495588_0000635
1188 Ga0495657_0000930
1189 Ga0495599_0003272
1190 Ga0495623_0000112
1191 Ga0495646_0000561
1192 Ga0495658_0000123
1193 Ga0495613_0008231
1194 Ga0495600_0004152
1195 Ga0495581_0001728
1196 Ga0495581_0013630
1197 Ga0495581_0557152
1198 Ga0495604_0000266
1199 Ga0495636_0377053
1200 Ga0495674_0002199
1201 Ga0495674_1044091
1202 Ga0495672_0004260
1203 Ga0495680_0007874
1204 Ga0495675_0012654
1205 Ga0495684_0000094
1206 Ga0495593_0000261
1207 Ga0495593_0049339
1208 Ga0495602_0002830
1209 Ga0495614_0001222
1210 Ga0496102_0616157
1211 Ga0496104_0301370
1212 Ga0496104_1068414
1213 Ga0496106_0102755
1214 Ga0496106_0629422
1215 Ga0496108_0014902
1216 Ga0496108_0137944
1217 Ga0496109_0607899
1218 Ga0496112_0043552
1219 Ga0496113_1316519
1220 Ga0496114_1316223
1221 Ga0501031_0236741
1222 Ga0501032_0386496
1223 Ga0501036_0008440
1224 Ga0501037_0559722
1225 Ga0501038_0163492
1226 Ga0501039_0353744
1227 Ga0501040_0615995
1228 Ga0501041_0012406
1229 Ga0501046_0009428
1230 Ga0501048_0053345
1231 Ga0501067_0170112
1232 Ga0501067_0263965
1233 Ga0501067_0286652
1234 Ga0501069_0138849
1235 Ga0501069_0872743
1236 Ga0501071_0022623
1237 Ga0501071_1084205
1238 Ga0501072_0169205
1239 Ga0501072_0569358
1240 Ga0501073_0061511
1241 Ga0501074_0187162
1242 Ga0501075_0037720
1243 Ga0501076_0008274
1244 Ga0501077_0016967
1245 Ga0501079_0111811
1246 Ga0501079_0245437
1247 Ga0501080_0042154
1248 Ga0501083_0217232
1249 Ga0501035_0159621
1250 Ga0501035_0178301
1251 Ga0501045_0210196
1252 nmdc:mga05p37_116_c1
1253 nmdc:mga05p37_126151_c1
1254 nmdc:mga05p37_1461560_c1
1255 nmdc:mga05p37_1886218_c1
1256 nmdc:mga05p37_207319_c1
1257 nmdc:mga05p37_2244442_c1
1258 nmdc:mga05p37_251719_c1
1259 nmdc:mga05p37_266489_c1
1260 nmdc:mga05p37_2898_c1
1261 nmdc:mga05p37_577965_c1
1262 nmdc:mga05p37_743679_c1
1263 nmdc:mga05p37_770545_c1
1264 nmdc:mga09592_1075112_c1
1265 nmdc:mga09592_117050_c1
1266 nmdc:mga09592_66314_c1
1267 nmdc:mga09592_69610_c1
1268 nmdc:mga0qj67_1008036_c1
1269 nmdc:mga0qj67_1012090_c1
1270 nmdc:mga0qj67_123473_c1
1271 nmdc:mga0qj67_140536_c1
1272 nmdc:mga0qj67_201129_c1
1273 nmdc:mga0qj67_221256_c1
1274 nmdc:mga0qj67_861864_c1
1275 nmdc:mga06r32_1183610_c1
1276 nmdc:mga06r32_146937_c1
1277 nmdc:mga06r32_1521694_c1
1278 nmdc:mga06r32_166095_c1
1279 nmdc:mga06r32_2087978_c1
1280 nmdc:mga06r32_364356_c1
1281 nmdc:mga06r32_911743_c1
1282 nmdc:mga08y16_104457_c1
1283 nmdc:mga08y16_152103_c1
1284 nmdc:mga08y16_1769214_c1
1285 nmdc:mga08y16_513676_c1
1286 nmdc:mga08y16_582_c1
1287 nmdc:mga08y16_829568_c1
1288 nmdc:mga0n895_1183160_c1
1289 nmdc:mga0n895_236667_c1
1290 nmdc:mga0n895_242770_c1
1291 nmdc:mga0n895_444491_c1
1292 nmdc:mga0n895_539455_c1
1293 nmdc:mga0n895_868368_c1
1294 nmdc:mga0rr50_106696_c1
1295 nmdc:mga08x19_975550_c1
1296 nmdc:mga0a205_1016300_c1
1297 nmdc:mga0a205_1277011_c1
1298 nmdc:mga0a205_401876_c1
1299 nmdc:mga0a205_448620_c1
1300 nmdc:mga0a205_504155_c1
1301 nmdc:mga0a205_70544_c1
1302 nmdc:mga0a205_971949_c1
1303 Ga0495601_0028632
1304 Ga0495612_0001090
1305 Ga0495612_0220518
1306 Ga0495595_0129799
1307 Ga0495619_0087232
1308 Ga0500596_018297
1309 Ga0501084_0031737
1310 Ga0501084_0381961
1311 Ga0590075_161360
1312 Ga0590077_025326
1313 Ga0501082_0178963
1314 Ga0501082_0276768
1315 Ga0501082_1703303
1316 Ga0530510_0028699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

40

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.888 10 107
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8802 8 107
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.8777 14 94
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8775 8 105
5x11-assembly4.cif.gz_H crystal structure of bacillus subtilis padr in complex with operator dna 0.8739 14 94
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8775 8 105 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8753 10 110 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8741 14 94 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8665 8 103 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8652 14 94 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9H684-F1-model_v4 PadR family transcriptional regulator 0.9864 9 93
AF-A0A2V8ZGY6-F1-model_v4 PadR family transcriptional regulator 0.98 8 110
AF-A0A6A7KXK4-F1-model_v4 PadR family transcriptional regulator 0.9797 12 110
AF-A0A3E0NN79-F1-model_v4 PadR family transcriptional regulator 0.9766 14 110
AF-A0A843S070-F1-model_v4 PadR family transcriptional regulator 0.9753 14 110

Map