F473175

General Info

Members Datasets Scaffolds Average Seq Length
658 234 1316 61

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10814641|Ga0182008_108146412
Length 70
Sequence MPTPRKETQMNGRFLINRRDAKVMGVAAGISDYTGVDPTLVRLGIVALTLVTGPLMIFFYFLTGLLAPHQ

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 4.41
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10814641 3300014497 Bacteria 543
2 JGI24752J21851_1006168 3300001976 Bacteria 1565
3 JGI24739J22299_10140309 3300001989 Bacteria 717
4 JGI24737J22298_10003751 3300001990 Bacteria 5347
5 Ga0058862_12628978 3300004803 Bacteria 549
6 Ga0065712_10094677 3300005290 Bacteria 2244
7 Ga0065712_10310960 3300005290 Unclassified 844
8 Ga0065712_10336328 3300005290 Bacteria 806
9 Ga0065715_10316947 3300005293 Bacteria 1009
10 Ga0065715_10533416 3300005293 Bacteria 750
11 Ga0070658_10105560 3300005327 Bacteria 2330
12 Ga0070658_10179629 3300005327 Bacteria 1780
13 Ga0070658_10315467 3300005327 Bacteria 1334
14 Ga0070658_10560568 3300005327 Bacteria 989
15 Ga0070676_10430337 3300005328 Bacteria 924
16 Ga0070676_10771014 3300005328 Unclassified 707
17 Ga0070676_11061024 3300005328 Bacteria 611
18 Ga0070676_11566467 3300005328 Bacteria 509
19 Ga0070683_100244836 3300005329 Bacteria 1705
20 Ga0070670_100004266 3300005331 Bacteria 11961
21 Ga0070670_100058350 3300005331 Bacteria 3314
22 Ga0068869_100010735 3300005334 Bacteria 5980
23 Ga0068869_100304958 3300005334 Bacteria 1287
24 Ga0068869_100537188 3300005334 Bacteria 980
25 Ga0070666_10004566 3300005335 Bacteria 8444
26 Ga0070666_10143905 3300005335 Bacteria 1661
27 Ga0070666_10483363 3300005335 Bacteria 897
28 Ga0070680_100709653 3300005336 Bacteria 865
29 Ga0070680_101299355 3300005336 Bacteria 630
30 Ga0070682_100116570 3300005337 Bacteria 1787
31 Ga0070682_100832343 3300005337 Bacteria 753
32 Ga0068868_100277038 3300005338 Bacteria 1419
33 Ga0070660_100002977 3300005339 Bacteria 11662
34 Ga0070660_100156336 3300005339 Bacteria 1835
35 Ga0070660_100434652 3300005339 Bacteria 1087
36 Ga0070660_100610425 3300005339 Bacteria 912
37 Ga0070691_10477101 3300005341 Bacteria 717
38 Ga0070687_100230621 3300005343 Bacteria 1139
39 Ga0070661_100026040 3300005344 Bacteria 4204
40 Ga0070661_100048070 3300005344 Bacteria 3122
41 Ga0070661_100074416 3300005344 Bacteria 2501
42 Ga0070661_100505461 3300005344 Bacteria 968
43 Ga0070661_100536936 3300005344 Bacteria 940
44 Ga0070661_100922925 3300005344 Bacteria 721
45 Ga0070692_10000975 3300005345 Bacteria 9779
46 Ga0070668_100333116 3300005347 Bacteria 1281
47 Ga0070668_101740348 3300005347 Bacteria 573
48 Ga0070669_100008392 3300005353 Bacteria 7371
49 Ga0070669_100012617 3300005353 Bacteria 5997
50 Ga0070669_100129449 3300005353 Bacteria 1935
51 Ga0070675_100066971 3300005354 Bacteria 2971
52 Ga0070675_100176753 3300005354 Bacteria 1844
53 Ga0070675_100700275 3300005354 Unclassified 922
54 Ga0070671_100022840 3300005355 Bacteria 5111
55 Ga0070671_100039164 3300005355 Bacteria 3934
56 Ga0070671_100086803 3300005355 Bacteria 2618
57 Ga0070671_101263693 3300005355 Bacteria 651
58 Ga0070671_101809171 3300005355 Bacteria 543
59 Ga0070674_100276599 3300005356 Bacteria 1329
60 Ga0070673_100000163 3300005364 Bacteria 32129
61 Ga0070673_100179851 3300005364 Bacteria 1810
62 Ga0070673_100227050 3300005364 Unclassified 1618
63 Ga0070673_101010620 3300005364 Bacteria 774
64 Ga0070673_101410558 3300005364 Bacteria 656
65 Ga0070688_101414732 3300005365 Bacteria 564
66 Ga0070659_100001851 3300005366 Bacteria 15202
67 Ga0070659_100058502 3300005366 Bacteria 3042
68 Ga0070659_100059002 3300005366 Bacteria 3029
69 Ga0070659_100210830 3300005366 Bacteria 1601
70 Ga0070659_100218979 3300005366 Bacteria 1570
71 Ga0070659_100546000 3300005366 Bacteria 992
72 Ga0070659_100586923 3300005366 Unclassified 956
73 Ga0070659_100627290 3300005366 Unclassified 925
74 Ga0070659_101573274 3300005366 Bacteria 587
75 Ga0070667_100007625 3300005367 Bacteria 8974
76 Ga0070667_100011314 3300005367 Bacteria 7379
77 Ga0070667_100035150 3300005367 Bacteria 4197
78 Ga0070667_100077570 3300005367 Bacteria 2837
79 Ga0070667_100406645 3300005367 Bacteria 1239
80 Ga0070667_100464549 3300005367 Bacteria 1157
81 Ga0070667_100696524 3300005367 Bacteria 940
82 Ga0070713_101426730 3300005436 Bacteria 671
83 Ga0070701_11059180 3300005438 Bacteria 569
84 Ga0070694_100000922 3300005444 Bacteria 16634
85 Ga0070694_100605545 3300005444 Bacteria 883
86 Ga0070663_100001877 3300005455 Bacteria 11736
87 Ga0070663_100307921 3300005455 Bacteria 1270
88 Ga0070663_101296190 3300005455 Bacteria 642
89 Ga0070678_100001547 3300005456 Bacteria 12290
90 Ga0070662_100000478 3300005457 Bacteria 23734
91 Ga0070662_100001855 3300005457 Bacteria 12956
92 Ga0070662_100002921 3300005457 Bacteria 10624
93 Ga0070662_100052469 3300005457 Bacteria 2948
94 Ga0070662_100111024 3300005457 Bacteria 2089
95 Ga0070662_100394968 3300005457 Unclassified 1140
96 Ga0070662_100459481 3300005457 Bacteria 1058
97 Ga0070662_100771820 3300005457 Bacteria 816
98 Ga0070662_100803665 3300005457 Bacteria 800
99 Ga0070681_10107971 3300005458 Bacteria 2724
100 Ga0070681_10338188 3300005458 Bacteria 1415
101 Ga0070681_10559987 3300005458 Bacteria 1057
102 Ga0070681_11646643 3300005458 Bacteria 567
103 Ga0068867_101083201 3300005459 Bacteria 731
104 Ga0070679_100031449 3300005530 Bacteria 5243
105 Ga0070679_100062128 3300005530 Bacteria 3723
106 Ga0070679_100066277 3300005530 Bacteria 3599
107 Ga0070679_100128189 3300005530 Plasmid 2519
108 Ga0070679_100271356 3300005530 Bacteria 1650
109 Ga0070679_100428261 3300005530 Bacteria 1268
110 Ga0070679_101019974 3300005530 Bacteria 772
111 Ga0070697_101814805 3300005536 Bacteria 546
112 Ga0068853_100097005 3300005539 Bacteria 2601
113 Ga0068853_100102621 3300005539 Bacteria 2531
114 Ga0068853_100186054 3300005539 Bacteria 1885
115 Ga0068853_100632509 3300005539 Bacteria 1018
116 Ga0068853_100859036 3300005539 Bacteria 870
117 Ga0068853_101095694 3300005539 Bacteria 768
118 Ga0068853_101817155 3300005539 Unclassified 591
119 Ga0070672_100004071 3300005543 Bacteria 9541
120 Ga0070672_100019379 3300005543 Bacteria 4938
121 Ga0070686_100253771 3300005544 Bacteria 1286
122 Ga0070695_100080698 3300005545 Bacteria 2151
123 Ga0070693_100083484 3300005547 Bacteria 1910
124 Ga0070693_100376635 3300005547 Bacteria 978
125 Ga0070693_100640390 3300005547 Bacteria 772
126 Ga0070665_100008613 3300005548 Bacteria 10323
127 Ga0070665_100420760 3300005548 Bacteria 1345
128 Ga0070665_100548547 3300005548 Bacteria 1168
129 Ga0070704_101531995 3300005549 Bacteria 614
130 Ga0068855_100054884 3300005563 Bacteria 4681
131 Ga0068855_100155993 3300005563 Bacteria 2594
132 Ga0068855_100238421 3300005563 Bacteria 2033
133 Ga0068855_100324042 3300005563 Bacteria 1702
134 Ga0068855_100425096 3300005563 Bacteria 1453
135 Ga0070664_100007426 3300005564 Bacteria 8845
136 Ga0070664_100012121 3300005564 Bacteria 7002
137 Ga0070664_100018520 3300005564 Bacteria 5723
138 Ga0070664_100099711 3300005564 Unclassified 2525
139 Ga0070664_100217346 3300005564 Bacteria 1709
140 Ga0070664_100927886 3300005564 Bacteria 817
141 Ga0068857_100004631 3300005577 Bacteria 11653
142 Ga0068857_100008774 3300005577 Bacteria 8757
143 Ga0068857_100017148 3300005577 Bacteria 6344
144 Ga0068857_100355817 3300005577 Bacteria 1357
145 Ga0068857_101596808 3300005577 Unclassified 637
146 Ga0068854_100130042 3300005578 Bacteria 1921
147 Ga0068854_100932162 3300005578 Bacteria 765
148 Ga0068854_101156907 3300005578 Bacteria 691
149 Ga0068856_100757398 3300005614 Bacteria 991
150 Ga0068856_100804816 3300005614 Bacteria 959
151 Ga0068856_101409908 3300005614 Bacteria 711
152 Ga0068856_102173311 3300005614 Bacteria 564
153 Ga0070702_101175428 3300005615 Bacteria 617
154 Ga0070702_101453980 3300005615 Bacteria 562
155 Ga0068852_100159650 3300005616 Bacteria 2104
156 Ga0068852_100162930 3300005616 Bacteria 2084
157 Ga0068852_100190911 3300005616 Bacteria 1933
158 Ga0068852_100280339 3300005616 Bacteria 1606
159 Ga0068852_100308198 3300005616 Bacteria 1534
160 Ga0068852_100404898 3300005616 Bacteria 1343
161 Ga0068852_101203676 3300005616 Bacteria 779
162 Ga0068859_100012386 3300005617 Bacteria 8580
163 Ga0068859_100012957 3300005617 Bacteria 8377
164 Ga0068859_100014574 3300005617 Bacteria 7895
165 Ga0068859_100188179 3300005617 Bacteria 2148
166 Ga0068859_100302210 3300005617 Bacteria 1693
167 Ga0068859_100789093 3300005617 Bacteria 1038
168 Ga0068859_101420434 3300005617 Bacteria 765
169 Ga0068859_102386844 3300005617 Bacteria 583
170 Ga0068864_100004056 3300005618 Bacteria 12038
171 Ga0068864_100059589 3300005618 Bacteria 3303
172 Ga0068864_101001328 3300005618 Bacteria 829
173 Ga0068866_10083938 3300005718 Bacteria 1718
174 Ga0068851_10093971 3300005834 Bacteria 1583
175 Ga0068851_10187400 3300005834 Bacteria 1149
176 Ga0068863_100003790 3300005841 Bacteria 14952
177 Ga0068863_100004660 3300005841 Bacteria 13517
178 Ga0068863_100036538 3300005841 Bacteria 4679
179 Ga0068863_100058389 3300005841 Bacteria 3651
180 Ga0068863_100132837 3300005841 Bacteria 2377
181 Ga0068863_100150649 3300005841 Bacteria 2225
182 Ga0068863_101301870 3300005841 Bacteria 734
183 Ga0068863_102456092 3300005841 Bacteria 530
184 Ga0068858_100009806 3300005842 Bacteria 9115
185 Ga0068858_100010636 3300005842 Bacteria 8708
186 Ga0068858_100044276 3300005842 Bacteria 4126
187 Ga0068858_100083487 3300005842 Bacteria 2971
188 Ga0068858_100158341 3300005842 Bacteria 2132
189 Ga0068858_100343210 3300005842 Bacteria 1429
190 Ga0068858_101063929 3300005842 Bacteria 794
191 Ga0068858_101828294 3300005842 Bacteria 600
192 Ga0068860_100000674 3300005843 Bacteria 39467
193 Ga0068860_100053337 3300005843 Bacteria 3844
194 Ga0068860_100075640 3300005843 Bacteria 3203
195 Ga0068860_100098801 3300005843 Bacteria 2784
196 Ga0068860_100191294 3300005843 Bacteria 1980
197 Ga0068860_100254504 3300005843 Bacteria 1711
198 Ga0068860_100259233 3300005843 Bacteria 1694
199 Ga0068860_100278890 3300005843 Bacteria 1633
200 Ga0068862_100020175 3300005844 Bacteria 5566
201 Ga0068862_100127337 3300005844 Bacteria 2249
202 Ga0068862_100693630 3300005844 Bacteria 986
203 Ga0068862_100876463 3300005844 Bacteria 881
204 Ga0068862_101570091 3300005844 Bacteria 665
205 Ga0068862_102405196 3300005844 Bacteria 538
206 Ga0070716_101484146 3300006173 Unclassified 554
207 Ga0097621_100007643 3300006237 Bacteria 7747
208 Ga0097621_100150905 3300006237 Bacteria 1993
209 Ga0097621_100636387 3300006237 Bacteria 977
210 Ga0097621_101908390 3300006237 Bacteria 567
211 Ga0097621_102408731 3300006237 Bacteria 504
212 Ga0068871_100002657 3300006358 Bacteria 12206
213 Ga0068871_100098784 3300006358 Bacteria 2442
214 Ga0068871_100268847 3300006358 Bacteria 1489
215 Ga0075428_102039087 3300006844 Bacteria 594
216 Ga0075431_100191051 3300006847 Bacteria 2098
217 Ga0075433_10016296 3300006852 Bacteria 6118
218 Ga0075434_100529686 3300006871 Bacteria 1198
219 Ga0075429_100421567 3300006880 Bacteria 1169
220 Ga0068865_100182728 3300006881 Bacteria 1616
221 Ga0068865_100762409 3300006881 Bacteria 832
222 Ga0075436_101035510 3300006914 Bacteria 617
223 Ga0097620_100012385 3300006931 Bacteria 8580
224 Ga0097620_100012957 3300006931 Bacteria 8377
225 Ga0097620_100014576 3300006931 Bacteria 7895
226 Ga0097620_100188174 3300006931 Bacteria 2148
227 Ga0097620_100302215 3300006931 Bacteria 1693
228 Ga0097620_100789122 3300006931 Bacteria 1038
229 Ga0097620_101420419 3300006931 Bacteria 765
230 Ga0097620_102385740 3300006931 Bacteria 583
231 Ga0075435_101094404 3300007076 Bacteria 697
232 Ga0105251_10013893 3300009011 Bacteria 4479
233 Ga0105240_10203371 3300009093 Bacteria 2319
234 Ga0105240_11771075 3300009093 Bacteria 644
235 Ga0105240_12772004 3300009093 Bacteria 504
236 Ga0105245_10153115 3300009098 Bacteria 2182
237 Ga0105245_10753411 3300009098 Bacteria 1010
238 Ga0105247_10563552 3300009101 Bacteria 839
239 Ga0105247_10711808 3300009101 Bacteria 757
240 Ga0105247_10938213 3300009101 Bacteria 671
241 Ga0105247_11042247 3300009101 Bacteria 641
242 Ga0114129_10544939 3300009147 Unclassified 1509
243 Ga0105243_10115885 3300009148 Bacteria 2250
244 Ga0105243_10170622 3300009148 Bacteria 1884
245 Ga0105241_10061706 3300009174 Bacteria 2888
246 Ga0105241_10750861 3300009174 Bacteria 895
247 Ga0105242_10176973 3300009176 Bacteria 1879
248 Ga0105242_10537943 3300009176 Bacteria 1118
249 Ga0105248_10008362 3300009177 Bacteria 11367
250 Ga0105248_10015443 3300009177 Bacteria 8415
251 Ga0105248_10031865 3300009177 Bacteria 5890
252 Ga0105248_10051884 3300009177 Bacteria 4603
253 Ga0105248_10116473 3300009177 Bacteria 3014
254 Ga0105248_10419509 3300009177 Bacteria 1507
255 Ga0105248_10510973 3300009177 Unclassified 1355
256 Ga0105248_10620500 3300009177 Bacteria 1220
257 Ga0105237_10018861 3300009545 Bacteria 7133
258 Ga0105237_10330320 3300009545 Bacteria 1529
259 Ga0105238_10283423 3300009551 Bacteria 1638
260 Ga0105249_10000973 3300009553 Bacteria 25384
261 Ga0105249_10016941 3300009553 Bacteria 6467
262 Ga0105249_10092014 3300009553 Bacteria 2839
263 Ga0105249_10254360 3300009553 Bacteria 1743
264 Ga0105249_12261440 3300009553 Bacteria 616
265 Ga0105032_115725 3300009979 Unclassified 599
266 Ga0105239_10020816 3300010375 Bacteria 7238
267 Ga0105239_10359830 3300010375 Bacteria 1643
268 Ga0105239_10929731 3300010375 Bacteria 998
269 Ga0105246_10045834 3300011119 Bacteria 2980
270 Ga0105246_10070769 3300011119 Bacteria 2454
271 Ga0157327_1077297 3300012512 Bacteria 529
272 Ga0157373_10000811 3300013100 Bacteria 24182
273 Ga0157373_10275189 3300013100 Bacteria 1192
274 Ga0157373_10493231 3300013100 Bacteria 884
275 Ga0157371_10062764 3300013102 Bacteria 2633
276 Ga0157371_10082534 3300013102 Bacteria 2276
277 Ga0157371_10084845 3300013102 Bacteria 2244
278 Ga0157371_10134934 3300013102 Bacteria 1757
279 Ga0157371_10135975 3300013102 Bacteria 1750
280 Ga0157371_10579133 3300013102 Bacteria 834
281 Ga0157371_10589812 3300013102 Unclassified 826
282 Ga0157370_10135776 3300013104 Bacteria 2293
283 Ga0157370_10218918 3300013104 Bacteria 1764
284 Ga0157370_10293817 3300013104 Bacteria 1500
285 Ga0157369_10695338 3300013105 Bacteria 1047
286 Ga0157374_10006636 3300013296 Bacteria 9833
287 Ga0157374_10218362 3300013296 Bacteria 1870
288 Ga0157374_11219010 3300013296 Bacteria 774
289 Ga0157374_11726311 3300013296 Unclassified 651
290 Ga0157378_10324916 3300013297 Bacteria 1496
291 Ga0163162_10007903 3300013306 Bacteria 10367
292 Ga0163162_10113010 3300013306 Bacteria 2814
293 Ga0163162_10135666 3300013306 Bacteria 2571
294 Ga0163162_10295359 3300013306 Bacteria 1752
295 Ga0163162_11302481 3300013306 Bacteria 825
296 Ga0157372_10146048 3300013307 Bacteria 2727
297 Ga0157372_10177177 3300013307 Bacteria 2468
298 Ga0157372_10835004 3300013307 Bacteria 1070
299 Ga0157372_11583732 3300013307 Unclassified 754
300 Ga0157375_10002650 3300013308 Bacteria 15497
301 Ga0157375_10800539 3300013308 Bacteria 1091
302 Ga0157375_10805194 3300013308 Bacteria 1088
303 Ga0163163_10004847 3300014325 Bacteria 11562
304 Ga0163163_12533766 3300014325 Bacteria 571
305 Ga0157380_10855504 3300014326 Bacteria 932
306 Ga0157380_11670675 3300014326 Bacteria 694
307 Ga0182008_10032235 3300014497 Bacteria 2633
308 Ga0157377_10272575 3300014745 Bacteria 1106
309 Ga0157379_10004600 3300014968 Bacteria 11839
310 Ga0157379_10035587 3300014968 Bacteria 4440
311 Ga0157379_10265081 3300014968 Bacteria 1561
312 Ga0157379_10570550 3300014968 Bacteria 1054
313 Ga0157379_10698459 3300014968 Bacteria 952
314 Ga0157376_12532668 3300014969 Bacteria 553
315 Ga0163161_10298050 3300017792 Bacteria 1269
316 Ga0213875_10004474 3300021388 Bacteria 7651
317 Ga0207656_10224241 3300025321 Bacteria 914
318 Ga0207656_10461184 3300025321 Bacteria 643
319 Ga0207642_10093419 3300025899 Bacteria 1492
320 Ga0207688_10049640 3300025901 Bacteria 2346
321 Ga0207688_10164421 3300025901 Bacteria 1317
322 Ga0207680_10056345 3300025903 Bacteria 2373
323 Ga0207680_10096691 3300025903 Bacteria 1889
324 Ga0207680_10794399 3300025903 Bacteria 678
325 Ga0207647_10000895 3300025904 Bacteria 23093
326 Ga0207647_10131947 3300025904 Bacteria 1468
327 Ga0207647_10220263 3300025904 Bacteria 1094
328 Ga0207645_10010085 3300025907 Bacteria 6503
329 Ga0207643_10411536 3300025908 Bacteria 856
330 Ga0207705_10004948 3300025909 Bacteria 10002
331 Ga0207705_10010864 3300025909 Bacteria 6612
332 Ga0207705_10010892 3300025909 Bacteria 6602
333 Ga0207705_10266575 3300025909 Bacteria 1309
334 Ga0207705_10657255 3300025909 Bacteria 815
335 Ga0207654_10060261 3300025911 Bacteria 2216
336 Ga0207654_11283744 3300025911 Bacteria 534
337 Ga0207707_10344288 3300025912 Bacteria 1285
338 Ga0207707_10411315 3300025912 Bacteria 1161
339 Ga0207707_10714474 3300025912 Bacteria 840
340 Ga0207707_11179920 3300025912 Bacteria 620
341 Ga0207695_10172802 3300025913 Bacteria 2085
342 Ga0207671_10242414 3300025914 Bacteria 1416
343 Ga0207671_10454677 3300025914 Bacteria 1020
344 Ga0207660_10058423 3300025917 Bacteria 2766
345 Ga0207660_10192730 3300025917 Bacteria 1588
346 Ga0207660_10201524 3300025917 Bacteria 1555
347 Ga0207660_10415605 3300025917 Bacteria 1084
348 Ga0207660_10515781 3300025917 Bacteria 970
349 Ga0207660_10607412 3300025917 Unclassified 891
350 Ga0207660_11219009 3300025917 Bacteria 612
351 Ga0207662_10891234 3300025918 Bacteria 629
352 Ga0207657_10001607 3300025919 Bacteria 24285
353 Ga0207657_10003527 3300025919 Bacteria 16711
354 Ga0207657_10004093 3300025919 Bacteria 15482
355 Ga0207657_10010740 3300025919 Bacteria 9118
356 Ga0207657_10013799 3300025919 Bacteria 7908
357 Ga0207657_10026373 3300025919 Bacteria 5342
358 Ga0207657_10086664 3300025919 Bacteria 2620
359 Ga0207657_10382467 3300025919 Bacteria 1108
360 Ga0207657_11244937 3300025919 Unclassified 564
361 Ga0207649_10021692 3300025920 Bacteria 3702
362 Ga0207649_10029670 3300025920 Bacteria 3231
363 Ga0207649_10050753 3300025920 Bacteria 2567
364 Ga0207649_10193050 3300025920 Bacteria 1433
365 Ga0207649_11345931 3300025920 Bacteria 565
366 Ga0207649_11348970 3300025920 Bacteria 564
367 Ga0207649_11377129 3300025920 Bacteria 558
368 Ga0207652_10194734 3300025921 Bacteria 1823
369 Ga0207652_10418018 3300025921 Bacteria 1209
370 Ga0207652_10608697 3300025921 Bacteria 979
371 Ga0207652_10689335 3300025921 Unclassified 912
372 Ga0207652_10791413 3300025921 Bacteria 842
373 Ga0207652_10958808 3300025921 Bacteria 753
374 Ga0207652_11852508 3300025921 Bacteria 508
375 Ga0207681_10073324 3300025923 Bacteria 2394
376 Ga0207681_10153250 3300025923 Bacteria 1729
377 Ga0207681_10244353 3300025923 Bacteria 1398
378 Ga0207650_10014281 3300025925 Bacteria 5518
379 Ga0207650_10206919 3300025925 Bacteria 1574
380 Ga0207650_10304431 3300025925 Bacteria 1302
381 Ga0207659_10018867 3300025926 Bacteria 4529
382 Ga0207659_10075143 3300025926 Bacteria 2478
383 Ga0207659_11472060 3300025926 Bacteria 583
384 Ga0207687_10046010 3300025927 Bacteria 3019
385 Ga0207700_10263345 3300025928 Bacteria 1477
386 Ga0207700_11307083 3300025928 Unclassified 646
387 Ga0207664_10059022 3300025929 Bacteria 3054
388 Ga0207644_10001503 3300025931 Bacteria 15031
389 Ga0207644_10018846 3300025931 Bacteria 4675
390 Ga0207644_10113639 3300025931 Bacteria 2051
391 Ga0207644_10128821 3300025931 Bacteria 1935
392 Ga0207644_10376082 3300025931 Bacteria 1158
393 Ga0207644_10624893 3300025931 Bacteria 895
394 Ga0207690_10072927 3300025932 Bacteria 2372
395 Ga0207690_10171945 3300025932 Bacteria 1624
396 Ga0207690_10226604 3300025932 Bacteria 1433
397 Ga0207690_10791534 3300025932 Bacteria 783
398 Ga0207690_11179783 3300025932 Bacteria 639
399 Ga0207690_11184059 3300025932 Bacteria 638
400 Ga0207706_10000916 3300025933 Bacteria 30270
401 Ga0207706_10001240 3300025933 Bacteria 25703
402 Ga0207706_10023987 3300025933 Bacteria 5473
403 Ga0207706_10036889 3300025933 Bacteria 4342
404 Ga0207706_10129300 3300025933 Bacteria 2221
405 Ga0207706_10245699 3300025933 Bacteria 1564
406 Ga0207706_10688885 3300025933 Bacteria 874
407 Ga0207706_11326049 3300025933 Bacteria 594
408 Ga0207686_10724382 3300025934 Bacteria 792
409 Ga0207709_10052008 3300025935 Bacteria 2513
410 Ga0207709_10511406 3300025935 Bacteria 939
411 Ga0207670_11737962 3300025936 Unclassified 530
412 Ga0207704_10141299 3300025938 Bacteria 1685
413 Ga0207665_11311167 3300025939 Unclassified 577
414 Ga0207691_10003394 3300025940 Bacteria 15491
415 Ga0207691_10017860 3300025940 Bacteria 6722
416 Ga0207691_10153047 3300025940 Unclassified 2027
417 Ga0207691_10326084 3300025940 Bacteria 1316
418 Ga0207711_10002443 3300025941 Bacteria 16583
419 Ga0207711_10005220 3300025941 Bacteria 11006
420 Ga0207711_10006899 3300025941 Bacteria 9535
421 Ga0207711_10024043 3300025941 Bacteria 5100
422 Ga0207711_10084550 3300025941 Bacteria 2778
423 Ga0207711_10131087 3300025941 Bacteria 2248
424 Ga0207711_10135670 3300025941 Bacteria 2210
425 Ga0207689_10328746 3300025942 Bacteria 1269
426 Ga0207689_10474183 3300025942 Bacteria 1047
427 Ga0207679_10003645 3300025945 Bacteria 9543
428 Ga0207679_10011154 3300025945 Bacteria 5805
429 Ga0207679_10348243 3300025945 Bacteria 1291
430 Ga0207679_10388389 3300025945 Bacteria 1225
431 Ga0207679_10395325 3300025945 Bacteria 1215
432 Ga0207679_10468891 3300025945 Bacteria 1119
433 Ga0207679_10754849 3300025945 Bacteria 885
434 Ga0207667_10328225 3300025949 Bacteria 1562
435 Ga0207667_10371091 3300025949 Bacteria 1458
436 Ga0207667_10934906 3300025949 Bacteria 857
437 Ga0207667_11311348 3300025949 Bacteria 700
438 Ga0207651_10017304 3300025960 Bacteria 4255
439 Ga0207651_10257660 3300025960 Unclassified 1430
440 Ga0207651_10281203 3300025960 Bacteria 1375
441 Ga0207651_11309316 3300025960 Bacteria 651
442 Ga0207651_11906596 3300025960 Bacteria 534
443 Ga0207712_10008682 3300025961 Bacteria 6427
444 Ga0207712_10019337 3300025961 Bacteria 4445
445 Ga0207712_10400977 3300025961 Bacteria 1153
446 Ga0207668_10233148 3300025972 Bacteria 1485
447 Ga0207668_12033670 3300025972 Bacteria 517
448 Ga0207640_10634839 3300025981 Bacteria 908
449 Ga0207640_10784860 3300025981 Bacteria 824
450 Ga0207640_10978901 3300025981 Bacteria 743
451 Ga0207658_10003200 3300025986 Bacteria 11651
452 Ga0207658_10008180 3300025986 Bacteria 7122
453 Ga0207658_10045728 3300025986 Bacteria 3192
454 Ga0207658_10463178 3300025986 Bacteria 1124
455 Ga0207658_10793368 3300025986 Bacteria 859
456 Ga0207677_10080133 3300026023 Bacteria 2338
457 Ga0207677_10249136 3300026023 Bacteria 1442
458 Ga0207677_11477090 3300026023 Bacteria 627
459 Ga0207703_10006045 3300026035 Bacteria 9681
460 Ga0207703_10008602 3300026035 Bacteria 8057
461 Ga0207703_10023576 3300026035 Bacteria 4836
462 Ga0207703_10044560 3300026035 Bacteria 3566
463 Ga0207703_10056304 3300026035 Bacteria 3202
464 Ga0207703_10125323 3300026035 Bacteria 2211
465 Ga0207703_10586572 3300026035 Bacteria 1053
466 Ga0207703_10723452 3300026035 Bacteria 947
467 Ga0207703_10992765 3300026035 Bacteria 805
468 Ga0207703_11104608 3300026035 Bacteria 762
469 Ga0207703_12229742 3300026035 Bacteria 524
470 Ga0207639_10052523 3300026041 Bacteria 3106
471 Ga0207639_10158959 3300026041 Bacteria 1902
472 Ga0207639_10413509 3300026041 Bacteria 1218
473 Ga0207639_10766850 3300026041 Bacteria 898
474 Ga0207639_11136189 3300026041 Bacteria 733
475 Ga0207678_10007743 3300026067 Bacteria 9490
476 Ga0207678_10024018 3300026067 Bacteria 5328
477 Ga0207678_10087208 3300026067 Bacteria 2667
478 Ga0207678_10467893 3300026067 Bacteria 1097
479 Ga0207678_10552598 3300026067 Bacteria 1007
480 Ga0207702_10174999 3300026078 Bacteria 1971
481 Ga0207702_12307474 3300026078 Bacteria 526
482 Ga0207641_10007551 3300026088 Bacteria 9042
483 Ga0207641_10009794 3300026088 Bacteria 7890
484 Ga0207641_10016299 3300026088 Bacteria 6085
485 Ga0207641_10034236 3300026088 Bacteria 4224
486 Ga0207641_10146192 3300026088 Bacteria 2137
487 Ga0207648_10285746 3300026089 Bacteria 1476
488 Ga0207648_11921199 3300026089 Bacteria 553
489 Ga0207676_10002391 3300026095 Bacteria 13392
490 Ga0207676_10005216 3300026095 Bacteria 9197
491 Ga0207676_10072142 3300026095 Bacteria 2774
492 Ga0207674_10000284 3300026116 Bacteria 64099
493 Ga0207674_10003751 3300026116 Bacteria 18534
494 Ga0207674_10093502 3300026116 Bacteria 2995
495 Ga0207674_10290947 3300026116 Bacteria 1582
496 Ga0207674_10356794 3300026116 Bacteria 1413
497 Ga0207675_100059054 3300026118 Bacteria 3580
498 Ga0207683_10001131 3300026121 Bacteria 24274
499 Ga0207683_11196521 3300026121 Bacteria 704
500 Ga0207698_10043247 3300026142 Bacteria 3373
501 Ga0207698_10091586 3300026142 Bacteria 2489
502 Ga0207698_10112816 3300026142 Bacteria 2282
503 Ga0207698_10610398 3300026142 Bacteria 1076
504 Ga0207698_11562915 3300026142 Bacteria 675
505 Ga0209971_1144158 3300027682 Bacteria 587
506 Ga0209974_10007397 3300027876 Bacteria 3785
507 Ga0209974_10330575 3300027876 Bacteria 588
508 Ga0268266_10072791 3300028379 Bacteria 2981
509 Ga0268266_10844070 3300028379 Bacteria 885
510 Ga0268265_10003354 3300028380 Bacteria 11564
511 Ga0268265_10005551 3300028380 Bacteria 8611
512 Ga0268265_10049632 3300028380 Bacteria 3157
513 Ga0268265_10088314 3300028380 Bacteria 2469
514 Ga0268265_10455227 3300028380 Bacteria 1196
515 Ga0268265_10522196 3300028380 Bacteria 1122
516 Ga0268264_10000268 3300028381 Bacteria 91477
517 Ga0268264_10009057 3300028381 Bacteria 8260
518 Ga0268264_10052405 3300028381 Bacteria 3401
519 Ga0268264_10180016 3300028381 Bacteria 1919
520 Ga0268264_10310152 3300028381 Bacteria 1488
521 Ga0268264_10535844 3300028381 Bacteria 1146
522 Ga0268264_10639440 3300028381 Bacteria 1052
523 Ga0316182_1040096 3300030745 Bacteria 1107
524 Ga0307408_100339361 3300031548 Bacteria 1271
525 Ga0307405_10003275 3300031731 Bacteria 7397
526 Ga0307405_10711031 3300031731 Bacteria 833
527 Ga0307413_10003153 3300031824 Bacteria 6881
528 Ga0307413_10085415 3300031824 Bacteria 2037
529 Ga0307413_10723562 3300031824 Bacteria 829
530 Ga0307410_10020044 3300031852 Bacteria 4082
531 Ga0307410_10173120 3300031852 Bacteria 1628
532 Ga0307406_10004802 3300031901 Bacteria 7363
533 Ga0307406_10094149 3300031901 Bacteria 2024
534 Ga0307406_10327016 3300031901 Bacteria 1188
535 Ga0307406_10677320 3300031901 Bacteria 859
536 Ga0307407_10023861 3300031903 Bacteria 3197
537 Ga0307407_10584753 3300031903 Bacteria 829
538 Ga0307412_10019572 3300031911 Bacteria 4103
539 Ga0307412_10228106 3300031911 Bacteria 1432
540 Ga0307412_11493155 3300031911 Bacteria 614
541 Ga0307409_100006377 3300031995 Bacteria 6923
542 Ga0307409_100120424 3300031995 Bacteria 2221
543 Ga0307409_101056072 3300031995 Bacteria 832
544 Ga0307409_101241065 3300031995 Bacteria 769
545 Ga0307416_100047203 3300032002 Bacteria 3406
546 Ga0307416_101621190 3300032002 Bacteria 752
547 Ga0307416_102909649 3300032002 Bacteria 573
548 Ga0307416_102960441 3300032002 Unclassified 568
549 Ga0307414_10024631 3300032004 Bacteria 3841
550 Ga0307414_11489930 3300032004 Bacteria 630
551 Ga0307414_12149397 3300032004 Bacteria 521
552 Ga0307411_10239501 3300032005 Bacteria 1419
553 Ga0307411_10328104 3300032005 Bacteria 1239
554 Ga0307411_11747129 3300032005 Bacteria 576
555 Ga0307415_100017785 3300032126 Bacteria 4271
556 Ga0307415_100510276 3300032126 Bacteria 1053
557 Ga0307415_101758917 3300032126 Bacteria 599
558 Ga0373930_0177000 3300034816 Bacteria 546
559 Ga0373940_0320937 3300035088 Bacteria 538
560 Ga0373951_0189705 3300035091 Bacteria 594
561 Ga0373939_0119774 3300035114 Bacteria 927
562 Ga0373941_0278463 3300035115 Bacteria 661
563 Ga0373962_0104024 3300035242 Bacteria 889
564 Ga0373962_0306016 3300035242 Bacteria 565
565 Ga0373931_1239151 3300035691 Bacteria 512
566 Ga0395899_0093846 3300037312 Bacteria 2172
567 Ga0395899_0147874 3300037312 Bacteria 1667
568 Ga0395899_0234931 3300037312 Bacteria 1264
569 Ga0395899_0323597 3300037312 Bacteria 1038
570 Ga0395899_0876920 3300037312 Bacteria 549
571 Ga0395900_0002620 3300037418 Bacteria 19629
572 Ga0395900_0029134 3300037418 Bacteria 5663
573 Ga0395900_0049692 3300037418 Bacteria 4321
574 Ga0395900_0139880 3300037418 Bacteria 2479
575 Ga0395900_0284020 3300037418 Bacteria 1646
576 Ga0395900_0361959 3300037418 Bacteria 1422
577 Ga0395900_0465552 3300037418 Bacteria 1218
578 Ga0395900_0471263 3300037418 Bacteria 1209
579 Ga0395900_1337942 3300037418 Bacteria 630
580 Ga0395900_1490486 3300037418 Bacteria 589
581 Ga0395898_0012923 3300037466 Bacteria 8611
582 Ga0395898_0095035 3300037466 Bacteria 2864
583 Ga0395905_0010391 3300037471 Bacteria 9062
584 Ga0395905_0052465 3300037471 Bacteria 3817
585 Ga0395905_0706571 3300037471 Bacteria 910
586 Ga0395905_0983300 3300037471 Bacteria 747
587 Ga0395905_1338913 3300037471 Bacteria 620
588 Ga0436364_0490014 3300037853 Bacteria 17577
589 Ga0395901_0002295 3300038443 Bacteria 19494
590 Ga0395901_0069900 3300038443 Bacteria 3657
591 Ga0395901_0318930 3300038443 Bacteria 1608
592 Ga0395901_0342825 3300038443 Bacteria 1543
593 Ga0395901_0989036 3300038443 Bacteria 818
594 Ga0395901_1053448 3300038443 Bacteria 786
595 Ga0395901_1954402 3300038443 Bacteria 533
596 Ga0439465_0349163 3300041413 Bacteria 558
597 Ga0451793_0802542 3300041452 Bacteria 675
598 Ga0439432_017996 3300042006 Bacteria 2366
599 Ga0439464_0000510 3300042439 Bacteria 7949
600 Ga0466965_0190988 3300044683 Bacteria 1083
601 Ga0466965_0192610 3300044683 Bacteria 1079
602 Ga0466966_0158438 3300044684 Bacteria 1379
603 Ga0466961_0035536 3300044693 Bacteria 3200
604 Ga0466961_0293078 3300044693 Bacteria 995
605 Ga0466963_0103381 3300044694 Bacteria 1952
606 Ga0466963_0814556 3300044694 Bacteria 658
607 Ga0466970_0029530 3300044765 Bacteria 2887
608 Ga0466970_0305213 3300044765 Bacteria 898
609 Ga0466960_0432055 3300044901 Bacteria 763
610 Ga0466959_0874892 3300045049 Bacteria 600
611 Ga0466958_0040793 3300045836 Bacteria 2790
612 Ga0466967_0012002 3300045976 Bacteria 6601
613 Ga0466967_0051276 3300045976 Bacteria 3615
614 Ga0466967_0105405 3300045976 Bacteria 2583
615 Ga0466967_1247322 3300045976 Bacteria 740
616 Ga0495668_0023055 3300046616 Bacteria 3554
617 Ga0495659_0309958 3300046664 Bacteria 668
618 Ga0495669_0649310 3300046684 Bacteria 513
619 Ga0496100_0005711 3300048903 Bacteria 6729
620 Ga0496101_0012570 3300048904 Bacteria 5652
621 Ga0496101_0196889 3300048904 Bacteria 1557
622 Ga0496102_0018195 3300048905 Bacteria 6168
623 Ga0496102_0087064 3300048905 Bacteria 2886
624 Ga0496103_0009605 3300048906 Bacteria 5728
625 Ga0496104_0066704 3300048907 Bacteria 3417
626 Ga0496105_0157458 3300048908 Bacteria 1865
627 Ga0496106_0510873 3300048909 Bacteria 965
628 Ga0496107_0068584 3300048910 Bacteria 2574
629 Ga0496107_0500321 3300048910 Bacteria 901
630 Ga0496107_0603511 3300048910 Bacteria 811
631 Ga0496108_0005805 3300048911 Bacteria 10005
632 Ga0496108_0024653 3300048911 Bacteria 4954
633 Ga0496109_0008694 3300048912 Bacteria 8643
634 Ga0496109_0048582 3300048912 Bacteria 3860
635 Ga0496109_0070634 3300048912 Bacteria 3205
636 Ga0496109_0871327 3300048912 Bacteria 838
637 Ga0496110_0016281 3300048913 Bacteria 6206
638 Ga0496111_0037904 3300048914 Bacteria 3451
639 Ga0496111_0944669 3300048914 Bacteria 620
640 Ga0496112_0049069 3300048915 Bacteria 4137
641 Ga0496112_0090336 3300048915 Bacteria 3031
642 Ga0496112_1427431 3300048915 Bacteria 607
643 Ga0496113_0002132 3300048916 Bacteria 11414
644 Ga0496113_0057431 3300048916 Bacteria 2924
645 Ga0496114_0683622 3300048917 Bacteria 901
646 Ga0496115_0039617 3300048918 Bacteria 3743
647 Ga0501067_0266803 3300049583 Bacteria 953
648 Ga0501270_078987 3300049767 Bacteria 651
649 nmdc:mga05p37_623346_c1 3300050507 Bacteria 1213
650 nmdc:mga06r32_992327_c1 3300050510 Bacteria 793
651 nmdc:mga08y16_174598_c1 3300050511 Bacteria 2231
652 nmdc:mga0rr50_807833_c1 3300050513 Bacteria 800
653 nmdc:mga08x19_1169435_c1 3300050514 Bacteria 545
654 nmdc:mga0a205_3851_c2 3300050515 Bacteria 10890
655 Ga0500658_0000128 3300053134 Bacteria 35779
656 Ga0587073_0295445 3300059492 Bacteria 525
657 Ga0587113_050331 3300059625 Bacteria 519
658 Ga0587072_157996 3300059643 Bacteria 552
659 Ga0182008_10814641
660 JGI24752J21851_1006168
661 JGI24739J22299_10140309
662 JGI24737J22298_10003751
663 Ga0058862_12628978
664 Ga0065712_10094677
665 Ga0065712_10310960
666 Ga0065712_10336328
667 Ga0065715_10316947
668 Ga0065715_10533416
669 Ga0070658_10105560
670 Ga0070658_10179629
671 Ga0070658_10315467
672 Ga0070658_10560568
673 Ga0070676_10430337
674 Ga0070676_10771014
675 Ga0070676_11061024
676 Ga0070676_11566467
677 Ga0070683_100244836
678 Ga0070670_100004266
679 Ga0070670_100058350
680 Ga0068869_100010735
681 Ga0068869_100304958
682 Ga0068869_100537188
683 Ga0070666_10004566
684 Ga0070666_10143905
685 Ga0070666_10483363
686 Ga0070680_100709653
687 Ga0070680_101299355
688 Ga0070682_100116570
689 Ga0070682_100832343
690 Ga0068868_100277038
691 Ga0070660_100002977
692 Ga0070660_100156336
693 Ga0070660_100434652
694 Ga0070660_100610425
695 Ga0070691_10477101
696 Ga0070687_100230621
697 Ga0070661_100026040
698 Ga0070661_100048070
699 Ga0070661_100074416
700 Ga0070661_100505461
701 Ga0070661_100536936
702 Ga0070661_100922925
703 Ga0070692_10000975
704 Ga0070668_100333116
705 Ga0070668_101740348
706 Ga0070669_100008392
707 Ga0070669_100012617
708 Ga0070669_100129449
709 Ga0070675_100066971
710 Ga0070675_100176753
711 Ga0070675_100700275
712 Ga0070671_100022840
713 Ga0070671_100039164
714 Ga0070671_100086803
715 Ga0070671_101263693
716 Ga0070671_101809171
717 Ga0070674_100276599
718 Ga0070673_100000163
719 Ga0070673_100179851
720 Ga0070673_100227050
721 Ga0070673_101010620
722 Ga0070673_101410558
723 Ga0070688_101414732
724 Ga0070659_100001851
725 Ga0070659_100058502
726 Ga0070659_100059002
727 Ga0070659_100210830
728 Ga0070659_100218979
729 Ga0070659_100546000
730 Ga0070659_100586923
731 Ga0070659_100627290
732 Ga0070659_101573274
733 Ga0070667_100007625
734 Ga0070667_100011314
735 Ga0070667_100035150
736 Ga0070667_100077570
737 Ga0070667_100406645
738 Ga0070667_100464549
739 Ga0070667_100696524
740 Ga0070713_101426730
741 Ga0070701_11059180
742 Ga0070694_100000922
743 Ga0070694_100605545
744 Ga0070663_100001877
745 Ga0070663_100307921
746 Ga0070663_101296190
747 Ga0070678_100001547
748 Ga0070662_100000478
749 Ga0070662_100001855
750 Ga0070662_100002921
751 Ga0070662_100052469
752 Ga0070662_100111024
753 Ga0070662_100394968
754 Ga0070662_100459481
755 Ga0070662_100771820
756 Ga0070662_100803665
757 Ga0070681_10107971
758 Ga0070681_10338188
759 Ga0070681_10559987
760 Ga0070681_11646643
761 Ga0068867_101083201
762 Ga0070679_100031449
763 Ga0070679_100062128
764 Ga0070679_100066277
765 Ga0070679_100128189
766 Ga0070679_100271356
767 Ga0070679_100428261
768 Ga0070679_101019974
769 Ga0070697_101814805
770 Ga0068853_100097005
771 Ga0068853_100102621
772 Ga0068853_100186054
773 Ga0068853_100632509
774 Ga0068853_100859036
775 Ga0068853_101095694
776 Ga0068853_101817155
777 Ga0070672_100004071
778 Ga0070672_100019379
779 Ga0070686_100253771
780 Ga0070695_100080698
781 Ga0070693_100083484
782 Ga0070693_100376635
783 Ga0070693_100640390
784 Ga0070665_100008613
785 Ga0070665_100420760
786 Ga0070665_100548547
787 Ga0070704_101531995
788 Ga0068855_100054884
789 Ga0068855_100155993
790 Ga0068855_100238421
791 Ga0068855_100324042
792 Ga0068855_100425096
793 Ga0070664_100007426
794 Ga0070664_100012121
795 Ga0070664_100018520
796 Ga0070664_100099711
797 Ga0070664_100217346
798 Ga0070664_100927886
799 Ga0068857_100004631
800 Ga0068857_100008774
801 Ga0068857_100017148
802 Ga0068857_100355817
803 Ga0068857_101596808
804 Ga0068854_100130042
805 Ga0068854_100932162
806 Ga0068854_101156907
807 Ga0068856_100757398
808 Ga0068856_100804816
809 Ga0068856_101409908
810 Ga0068856_102173311
811 Ga0070702_101175428
812 Ga0070702_101453980
813 Ga0068852_100159650
814 Ga0068852_100162930
815 Ga0068852_100190911
816 Ga0068852_100280339
817 Ga0068852_100308198
818 Ga0068852_100404898
819 Ga0068852_101203676
820 Ga0068859_100012386
821 Ga0068859_100012957
822 Ga0068859_100014574
823 Ga0068859_100188179
824 Ga0068859_100302210
825 Ga0068859_100789093
826 Ga0068859_101420434
827 Ga0068859_102386844
828 Ga0068864_100004056
829 Ga0068864_100059589
830 Ga0068864_101001328
831 Ga0068866_10083938
832 Ga0068851_10093971
833 Ga0068851_10187400
834 Ga0068863_100003790
835 Ga0068863_100004660
836 Ga0068863_100036538
837 Ga0068863_100058389
838 Ga0068863_100132837
839 Ga0068863_100150649
840 Ga0068863_101301870
841 Ga0068863_102456092
842 Ga0068858_100009806
843 Ga0068858_100010636
844 Ga0068858_100044276
845 Ga0068858_100083487
846 Ga0068858_100158341
847 Ga0068858_100343210
848 Ga0068858_101063929
849 Ga0068858_101828294
850 Ga0068860_100000674
851 Ga0068860_100053337
852 Ga0068860_100075640
853 Ga0068860_100098801
854 Ga0068860_100191294
855 Ga0068860_100254504
856 Ga0068860_100259233
857 Ga0068860_100278890
858 Ga0068862_100020175
859 Ga0068862_100127337
860 Ga0068862_100693630
861 Ga0068862_100876463
862 Ga0068862_101570091
863 Ga0068862_102405196
864 Ga0070716_101484146
865 Ga0097621_100007643
866 Ga0097621_100150905
867 Ga0097621_100636387
868 Ga0097621_101908390
869 Ga0097621_102408731
870 Ga0068871_100002657
871 Ga0068871_100098784
872 Ga0068871_100268847
873 Ga0075428_102039087
874 Ga0075431_100191051
875 Ga0075433_10016296
876 Ga0075434_100529686
877 Ga0075429_100421567
878 Ga0068865_100182728
879 Ga0068865_100762409
880 Ga0075436_101035510
881 Ga0097620_100012385
882 Ga0097620_100012957
883 Ga0097620_100014576
884 Ga0097620_100188174
885 Ga0097620_100302215
886 Ga0097620_100789122
887 Ga0097620_101420419
888 Ga0097620_102385740
889 Ga0075435_101094404
890 Ga0105251_10013893
891 Ga0105240_10203371
892 Ga0105240_11771075
893 Ga0105240_12772004
894 Ga0105245_10153115
895 Ga0105245_10753411
896 Ga0105247_10563552
897 Ga0105247_10711808
898 Ga0105247_10938213
899 Ga0105247_11042247
900 Ga0114129_10544939
901 Ga0105243_10115885
902 Ga0105243_10170622
903 Ga0105241_10061706
904 Ga0105241_10750861
905 Ga0105242_10176973
906 Ga0105242_10537943
907 Ga0105248_10008362
908 Ga0105248_10015443
909 Ga0105248_10031865
910 Ga0105248_10051884
911 Ga0105248_10116473
912 Ga0105248_10419509
913 Ga0105248_10510973
914 Ga0105248_10620500
915 Ga0105237_10018861
916 Ga0105237_10330320
917 Ga0105238_10283423
918 Ga0105249_10000973
919 Ga0105249_10016941
920 Ga0105249_10092014
921 Ga0105249_10254360
922 Ga0105249_12261440
923 Ga0105032_115725
924 Ga0105239_10020816
925 Ga0105239_10359830
926 Ga0105239_10929731
927 Ga0105246_10045834
928 Ga0105246_10070769
929 Ga0157327_1077297
930 Ga0157373_10000811
931 Ga0157373_10275189
932 Ga0157373_10493231
933 Ga0157371_10062764
934 Ga0157371_10082534
935 Ga0157371_10084845
936 Ga0157371_10134934
937 Ga0157371_10135975
938 Ga0157371_10579133
939 Ga0157371_10589812
940 Ga0157370_10135776
941 Ga0157370_10218918
942 Ga0157370_10293817
943 Ga0157369_10695338
944 Ga0157374_10006636
945 Ga0157374_10218362
946 Ga0157374_11219010
947 Ga0157374_11726311
948 Ga0157378_10324916
949 Ga0163162_10007903
950 Ga0163162_10113010
951 Ga0163162_10135666
952 Ga0163162_10295359
953 Ga0163162_11302481
954 Ga0157372_10146048
955 Ga0157372_10177177
956 Ga0157372_10835004
957 Ga0157372_11583732
958 Ga0157375_10002650
959 Ga0157375_10800539
960 Ga0157375_10805194
961 Ga0163163_10004847
962 Ga0163163_12533766
963 Ga0157380_10855504
964 Ga0157380_11670675
965 Ga0182008_10032235
966 Ga0157377_10272575
967 Ga0157379_10004600
968 Ga0157379_10035587
969 Ga0157379_10265081
970 Ga0157379_10570550
971 Ga0157379_10698459
972 Ga0157376_12532668
973 Ga0163161_10298050
974 Ga0213875_10004474
975 Ga0207656_10224241
976 Ga0207656_10461184
977 Ga0207642_10093419
978 Ga0207688_10049640
979 Ga0207688_10164421
980 Ga0207680_10056345
981 Ga0207680_10096691
982 Ga0207680_10794399
983 Ga0207647_10000895
984 Ga0207647_10131947
985 Ga0207647_10220263
986 Ga0207645_10010085
987 Ga0207643_10411536
988 Ga0207705_10004948
989 Ga0207705_10010864
990 Ga0207705_10010892
991 Ga0207705_10266575
992 Ga0207705_10657255
993 Ga0207654_10060261
994 Ga0207654_11283744
995 Ga0207707_10344288
996 Ga0207707_10411315
997 Ga0207707_10714474
998 Ga0207707_11179920
999 Ga0207695_10172802
1000 Ga0207671_10242414
1001 Ga0207671_10454677
1002 Ga0207660_10058423
1003 Ga0207660_10192730
1004 Ga0207660_10201524
1005 Ga0207660_10415605
1006 Ga0207660_10515781
1007 Ga0207660_10607412
1008 Ga0207660_11219009
1009 Ga0207662_10891234
1010 Ga0207657_10001607
1011 Ga0207657_10003527
1012 Ga0207657_10004093
1013 Ga0207657_10010740
1014 Ga0207657_10013799
1015 Ga0207657_10026373
1016 Ga0207657_10086664
1017 Ga0207657_10382467
1018 Ga0207657_11244937
1019 Ga0207649_10021692
1020 Ga0207649_10029670
1021 Ga0207649_10050753
1022 Ga0207649_10193050
1023 Ga0207649_11345931
1024 Ga0207649_11348970
1025 Ga0207649_11377129
1026 Ga0207652_10194734
1027 Ga0207652_10418018
1028 Ga0207652_10608697
1029 Ga0207652_10689335
1030 Ga0207652_10791413
1031 Ga0207652_10958808
1032 Ga0207652_11852508
1033 Ga0207681_10073324
1034 Ga0207681_10153250
1035 Ga0207681_10244353
1036 Ga0207650_10014281
1037 Ga0207650_10206919
1038 Ga0207650_10304431
1039 Ga0207659_10018867
1040 Ga0207659_10075143
1041 Ga0207659_11472060
1042 Ga0207687_10046010
1043 Ga0207700_10263345
1044 Ga0207700_11307083
1045 Ga0207664_10059022
1046 Ga0207644_10001503
1047 Ga0207644_10018846
1048 Ga0207644_10113639
1049 Ga0207644_10128821
1050 Ga0207644_10376082
1051 Ga0207644_10624893
1052 Ga0207690_10072927
1053 Ga0207690_10171945
1054 Ga0207690_10226604
1055 Ga0207690_10791534
1056 Ga0207690_11179783
1057 Ga0207690_11184059
1058 Ga0207706_10000916
1059 Ga0207706_10001240
1060 Ga0207706_10023987
1061 Ga0207706_10036889
1062 Ga0207706_10129300
1063 Ga0207706_10245699
1064 Ga0207706_10688885
1065 Ga0207706_11326049
1066 Ga0207686_10724382
1067 Ga0207709_10052008
1068 Ga0207709_10511406
1069 Ga0207670_11737962
1070 Ga0207704_10141299
1071 Ga0207665_11311167
1072 Ga0207691_10003394
1073 Ga0207691_10017860
1074 Ga0207691_10153047
1075 Ga0207691_10326084
1076 Ga0207711_10002443
1077 Ga0207711_10005220
1078 Ga0207711_10006899
1079 Ga0207711_10024043
1080 Ga0207711_10084550
1081 Ga0207711_10131087
1082 Ga0207711_10135670
1083 Ga0207689_10328746
1084 Ga0207689_10474183
1085 Ga0207679_10003645
1086 Ga0207679_10011154
1087 Ga0207679_10348243
1088 Ga0207679_10388389
1089 Ga0207679_10395325
1090 Ga0207679_10468891
1091 Ga0207679_10754849
1092 Ga0207667_10328225
1093 Ga0207667_10371091
1094 Ga0207667_10934906
1095 Ga0207667_11311348
1096 Ga0207651_10017304
1097 Ga0207651_10257660
1098 Ga0207651_10281203
1099 Ga0207651_11309316
1100 Ga0207651_11906596
1101 Ga0207712_10008682
1102 Ga0207712_10019337
1103 Ga0207712_10400977
1104 Ga0207668_10233148
1105 Ga0207668_12033670
1106 Ga0207640_10634839
1107 Ga0207640_10784860
1108 Ga0207640_10978901
1109 Ga0207658_10003200
1110 Ga0207658_10008180
1111 Ga0207658_10045728
1112 Ga0207658_10463178
1113 Ga0207658_10793368
1114 Ga0207677_10080133
1115 Ga0207677_10249136
1116 Ga0207677_11477090
1117 Ga0207703_10006045
1118 Ga0207703_10008602
1119 Ga0207703_10023576
1120 Ga0207703_10044560
1121 Ga0207703_10056304
1122 Ga0207703_10125323
1123 Ga0207703_10586572
1124 Ga0207703_10723452
1125 Ga0207703_10992765
1126 Ga0207703_11104608
1127 Ga0207703_12229742
1128 Ga0207639_10052523
1129 Ga0207639_10158959
1130 Ga0207639_10413509
1131 Ga0207639_10766850
1132 Ga0207639_11136189
1133 Ga0207678_10007743
1134 Ga0207678_10024018
1135 Ga0207678_10087208
1136 Ga0207678_10467893
1137 Ga0207678_10552598
1138 Ga0207702_10174999
1139 Ga0207702_12307474
1140 Ga0207641_10007551
1141 Ga0207641_10009794
1142 Ga0207641_10016299
1143 Ga0207641_10034236
1144 Ga0207641_10146192
1145 Ga0207648_10285746
1146 Ga0207648_11921199
1147 Ga0207676_10002391
1148 Ga0207676_10005216
1149 Ga0207676_10072142
1150 Ga0207674_10000284
1151 Ga0207674_10003751
1152 Ga0207674_10093502
1153 Ga0207674_10290947
1154 Ga0207674_10356794
1155 Ga0207675_100059054
1156 Ga0207683_10001131
1157 Ga0207683_11196521
1158 Ga0207698_10043247
1159 Ga0207698_10091586
1160 Ga0207698_10112816
1161 Ga0207698_10610398
1162 Ga0207698_11562915
1163 Ga0209971_1144158
1164 Ga0209974_10007397
1165 Ga0209974_10330575
1166 Ga0268266_10072791
1167 Ga0268266_10844070
1168 Ga0268265_10003354
1169 Ga0268265_10005551
1170 Ga0268265_10049632
1171 Ga0268265_10088314
1172 Ga0268265_10455227
1173 Ga0268265_10522196
1174 Ga0268264_10000268
1175 Ga0268264_10009057
1176 Ga0268264_10052405
1177 Ga0268264_10180016
1178 Ga0268264_10310152
1179 Ga0268264_10535844
1180 Ga0268264_10639440
1181 Ga0316182_1040096
1182 Ga0307408_100339361
1183 Ga0307405_10003275
1184 Ga0307405_10711031
1185 Ga0307413_10003153
1186 Ga0307413_10085415
1187 Ga0307413_10723562
1188 Ga0307410_10020044
1189 Ga0307410_10173120
1190 Ga0307406_10004802
1191 Ga0307406_10094149
1192 Ga0307406_10327016
1193 Ga0307406_10677320
1194 Ga0307407_10023861
1195 Ga0307407_10584753
1196 Ga0307412_10019572
1197 Ga0307412_10228106
1198 Ga0307412_11493155
1199 Ga0307409_100006377
1200 Ga0307409_100120424
1201 Ga0307409_101056072
1202 Ga0307409_101241065
1203 Ga0307416_100047203
1204 Ga0307416_101621190
1205 Ga0307416_102909649
1206 Ga0307416_102960441
1207 Ga0307414_10024631
1208 Ga0307414_11489930
1209 Ga0307414_12149397
1210 Ga0307411_10239501
1211 Ga0307411_10328104
1212 Ga0307411_11747129
1213 Ga0307415_100017785
1214 Ga0307415_100510276
1215 Ga0307415_101758917
1216 Ga0373930_0177000
1217 Ga0373940_0320937
1218 Ga0373951_0189705
1219 Ga0373939_0119774
1220 Ga0373941_0278463
1221 Ga0373962_0104024
1222 Ga0373962_0306016
1223 Ga0373931_1239151
1224 Ga0395899_0093846
1225 Ga0395899_0147874
1226 Ga0395899_0234931
1227 Ga0395899_0323597
1228 Ga0395899_0876920
1229 Ga0395900_0002620
1230 Ga0395900_0029134
1231 Ga0395900_0049692
1232 Ga0395900_0139880
1233 Ga0395900_0284020
1234 Ga0395900_0361959
1235 Ga0395900_0465552
1236 Ga0395900_0471263
1237 Ga0395900_1337942
1238 Ga0395900_1490486
1239 Ga0395898_0012923
1240 Ga0395898_0095035
1241 Ga0395905_0010391
1242 Ga0395905_0052465
1243 Ga0395905_0706571
1244 Ga0395905_0983300
1245 Ga0395905_1338913
1246 Ga0436364_0490014
1247 Ga0395901_0002295
1248 Ga0395901_0069900
1249 Ga0395901_0318930
1250 Ga0395901_0342825
1251 Ga0395901_0989036
1252 Ga0395901_1053448
1253 Ga0395901_1954402
1254 Ga0439465_0349163
1255 Ga0451793_0802542
1256 Ga0439432_017996
1257 Ga0439464_0000510
1258 Ga0466965_0190988
1259 Ga0466965_0192610
1260 Ga0466966_0158438
1261 Ga0466961_0035536
1262 Ga0466961_0293078
1263 Ga0466963_0103381
1264 Ga0466963_0814556
1265 Ga0466970_0029530
1266 Ga0466970_0305213
1267 Ga0466960_0432055
1268 Ga0466959_0874892
1269 Ga0466958_0040793
1270 Ga0466967_0012002
1271 Ga0466967_0051276
1272 Ga0466967_0105405
1273 Ga0466967_1247322
1274 Ga0495668_0023055
1275 Ga0495659_0309958
1276 Ga0495669_0649310
1277 Ga0496100_0005711
1278 Ga0496101_0012570
1279 Ga0496101_0196889
1280 Ga0496102_0018195
1281 Ga0496102_0087064
1282 Ga0496103_0009605
1283 Ga0496104_0066704
1284 Ga0496105_0157458
1285 Ga0496106_0510873
1286 Ga0496107_0068584
1287 Ga0496107_0500321
1288 Ga0496107_0603511
1289 Ga0496108_0005805
1290 Ga0496108_0024653
1291 Ga0496109_0008694
1292 Ga0496109_0048582
1293 Ga0496109_0070634
1294 Ga0496109_0871327
1295 Ga0496110_0016281
1296 Ga0496111_0037904
1297 Ga0496111_0944669
1298 Ga0496112_0049069
1299 Ga0496112_0090336
1300 Ga0496112_1427431
1301 Ga0496113_0002132
1302 Ga0496113_0057431
1303 Ga0496114_0683622
1304 Ga0496115_0039617
1305 Ga0501067_0266803
1306 Ga0501270_078987
1307 nmdc:mga05p37_623346_c1
1308 nmdc:mga06r32_992327_c1
1309 nmdc:mga08y16_174598_c1
1310 nmdc:mga0rr50_807833_c1
1311 nmdc:mga08x19_1169435_c1
1312 nmdc:mga0a205_3851_c2
1313 Ga0500658_0000128
1314 Ga0587073_0295445
1315 Ga0587113_050331
1316 Ga0587072_157996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04024

PspC

PspC domain

13

70

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sps-assembly1.cif.gz_M high resolution structure of esrrb nucleosome bound oct4 at site a and site b 0.7955 15 34
1wud-assembly1.cif.gz_A e. coli recq hrdc domain 0.7955 12 31
3g2b-assembly1.cif.gz_A-2 crystal structure of pqqd from xanthomonas campestris 0.7753 14 47
7ekq-assembly1.cif.gz_I crclpp-s2c 0.7409 2 31
5hev-assembly1.cif.gz_A crystal structure of the beryllofluoride-activated liar from enterococcus faecium 0.4903 1 40
ID Description Score Start End Superfamily
af_E7F3W3_1_68_1.20.5.420 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.8222 11 43 1.20.5.420
1qo0E02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8049 11 41 1.10.10.10
1qo0D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8025 11 43 1.10.10.10
1bazB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8014 13 41 1.10.1220.10
5cp1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8005 14 45 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A518BRI8-F1-model_v4 PspC domain protein 0.7296 1 59 GO:0016020
AF-A0A518BRI8-F1-model_v4 PspC domain protein 0.6895 1 59 GO:0016020
AF-E7RLI2-F1-model_v4 PspC domain protein 0.669 14 56 GO:0005886
AF-M6JEU0-F1-model_v4 Uncharacterized protein 0.5896 1 61
AF-A0A2D7KA56-F1-model_v4 PspC family transcriptional regulator 0.5879 1 56 GO:0016020

Map