F473072

General Info

Members Datasets Scaffolds Average Seq Length
657 328 657 132

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100598028|Ga0070714_1005980281
Length 145
Sequence VSERPRGAPSSLAGVKISQQLVDEMVAHAREDVPNECCGMVGGRDGVATKVVRVANSAASPLRYEMDPQGQFDALKEIEADGELLAIYHSHTKSAAYPSQTDVNQAQNWPEPIYVIVSLADSEKPDVQGFHLADLKIADAELEIG

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
173 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
183 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
184 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
185 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
190 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
247 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
322 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
323 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 1.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.59
Nodule 0
Rhizoplane 11.11
Rhizosphere 81.58
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1002147 3300000532 Bacteria 1461
2 LJNas_1003365 3300000546 Bacteria 1842
3 JGI24746J21847_1000366 3300001977 Bacteria 6612
4 JGI24740J21852_10003978 3300001979 Bacteria 6415
5 JGI24748J21848_1006175 3300002074 Bacteria 1395
6 JGI24034J26672_10000425 3300002239 Bacteria 5469
7 JGI24742J22300_10000739 3300002244 Bacteria 4944
8 JGI25404J52841_10004669 3300003659 Unclassified 2792
9 Ga0058860_11509575 3300004801 Bacteria 536
10 Ga0070658_10024325 3300005327 Bacteria 4860
11 Ga0070658_10696522 3300005327 Bacteria 882
12 Ga0070683_100001231 3300005329 Bacteria 19475
13 Ga0070683_100007506 3300005329 Bacteria 9216
14 Ga0070683_100113564 3300005329 Bacteria 2557
15 Ga0070683_100256994 3300005329 Bacteria 1661
16 Ga0070670_100036432 3300005331 Bacteria 4234
17 Ga0070677_10000956 3300005333 Bacteria 9336
18 Ga0068869_101210464 3300005334 Bacteria 664
19 Ga0070666_10021581 3300005335 Bacteria 4174
20 Ga0070666_10052132 3300005335 Bacteria 2757
21 Ga0070666_10832117 3300005335 Unclassified 681
22 Ga0070682_100000023 3300005337 Bacteria 206016
23 Ga0070682_100000061 3300005337 Bacteria 105134
24 Ga0070682_100621637 3300005337 Unclassified 856
25 Ga0070682_100751612 3300005337 Bacteria 787
26 Ga0068868_100001254 3300005338 Bacteria 17445
27 Ga0068868_100688014 3300005338 Bacteria 914
28 Ga0068868_100863852 3300005338 Bacteria 820
29 Ga0070689_100047666 3300005340 Bacteria 3304
30 Ga0070689_100050193 3300005340 Bacteria 3223
31 Ga0070691_10000004 3300005341 Bacteria 80156
32 Ga0070691_10123681 3300005341 Bacteria 1305
33 Ga0070692_10200319 3300005345 Bacteria 1169
34 Ga0070668_100020201 3300005347 Bacteria 5023
35 Ga0070668_100020238 3300005347 Bacteria 5020
36 Ga0070668_100589955 3300005347 Bacteria 971
37 Ga0070669_100040491 3300005353 Bacteria 3387
38 Ga0070675_100000091 3300005354 Bacteria 52149
39 Ga0070674_101519781 3300005356 Bacteria 602
40 Ga0070673_100016927 3300005364 Bacteria 5170
41 Ga0070688_100000077 3300005365 Bacteria 48743
42 Ga0070688_100000937 3300005365 Bacteria 14631
43 Ga0070659_100005636 3300005366 Bacteria 9005
44 Ga0070659_100062491 3300005366 Bacteria 2944
45 Ga0070667_100000597 3300005367 Bacteria 35219
46 Ga0070667_100004874 3300005367 Bacteria 11235
47 Ga0070667_100409667 3300005367 Unclassified 1235
48 Ga0070714_100098756 3300005435 Bacteria 2569
49 Ga0070714_100598028 3300005435 Bacteria 1059
50 Ga0070713_100000135 3300005436 Bacteria 48487
51 Ga0070711_100005739 3300005439 Bacteria 7446
52 Ga0070700_101189465 3300005441 Bacteria 636
53 Ga0070663_100000405 3300005455 Bacteria 22618
54 Ga0070678_100005719 3300005456 Bacteria 7224
55 Ga0070662_100000001 3300005457 Bacteria 317995
56 Ga0070662_101866939 3300005457 Unclassified 519
57 Ga0070681_10010648 3300005458 Bacteria 9088
58 Ga0070685_10000061 3300005466 Bacteria 63408
59 Ga0070685_10000965 3300005466 Bacteria 15453
60 Ga0070679_100000088 3300005530 Bacteria 69314
61 Ga0070679_100001611 3300005530 Bacteria 20284
62 Ga0070684_100012176 3300005535 Bacteria 6880
63 Ga0070684_100160553 3300005535 Bacteria 2039
64 Ga0070684_100180836 3300005535 Bacteria 1917
65 Ga0070684_100378015 3300005535 Bacteria 1304
66 Ga0070684_100444529 3300005535 Bacteria 1198
67 Ga0068853_100248975 3300005539 Unclassified 1630
68 Ga0068853_100910550 3300005539 Bacteria 845
69 Ga0070672_100000005 3300005543 Bacteria 121014
70 Ga0070693_100021873 3300005547 Bacteria 3394
71 Ga0070665_100000022 3300005548 Bacteria 379286
72 Ga0070665_100006490 3300005548 Bacteria 11899
73 Ga0070665_100020404 3300005548 Bacteria 6656
74 Ga0070665_100283438 3300005548 Bacteria 1659
75 Ga0070665_100326908 3300005548 Bacteria 1538
76 Ga0070665_102250261 3300005548 Unclassified 548
77 Ga0070704_100064390 3300005549 Bacteria 2635
78 Ga0070664_100067851 3300005564 Bacteria 3049
79 Ga0068854_100000838 3300005578 Bacteria 18397
80 Ga0068854_100021831 3300005578 Bacteria 4351
81 Ga0068856_100005996 3300005614 Bacteria 11963
82 Ga0068856_100095223 3300005614 Bacteria 2965
83 Ga0068856_100119729 3300005614 Bacteria 2634
84 Ga0068856_100260518 3300005614 Bacteria 1749
85 Ga0068852_100000037 3300005616 Bacteria 97602
86 Ga0068852_100009794 3300005616 Bacteria 7124
87 Ga0068859_100880054 3300005617 Unclassified 981
88 Ga0068866_10068635 3300005718 Bacteria 1865
89 Ga0068861_100044604 3300005719 Bacteria 3335
90 Ga0068851_10000741 3300005834 Bacteria 13966
91 Ga0068851_10010572 3300005834 Bacteria 4310
92 Ga0068863_100004891 3300005841 Bacteria 13205
93 Ga0068863_100022537 3300005841 Bacteria 6014
94 Ga0068858_100001657 3300005842 Bacteria 22764
95 Ga0068858_100120833 3300005842 Bacteria 2450
96 Ga0068862_100001558 3300005844 Bacteria 20944
97 Ga0081455_10004481 3300005937 Bacteria 15630
98 Ga0081455_10232360 3300005937 Bacteria 1360
99 Ga0081540_1000697 3300005983 Bacteria 31315
100 Ga0081540_1013456 3300005983 Bacteria 5313
101 Ga0081539_10016325 3300005985 Bacteria 5313
102 Ga0075365_10027783 3300006038 Bacteria 3604
103 Ga0075365_10046083 3300006038 Bacteria 2862
104 Ga0075364_10126824 3300006051 Bacteria 1712
105 Ga0075364_10382678 3300006051 Bacteria 960
106 Ga0070712_100005477 3300006175 Bacteria 7860
107 Ga0097621_100347149 3300006237 Bacteria 1319
108 Ga0075430_100071719 3300006846 Bacteria 2905
109 Ga0075431_100945956 3300006847 Bacteria 830
110 Ga0075433_10061844 3300006852 Bacteria 3280
111 Ga0075433_10063177 3300006852 Bacteria 3244
112 Ga0075433_10979438 3300006852 Bacteria 737
113 Ga0075434_100061202 3300006871 Bacteria 3745
114 Ga0075434_100121049 3300006871 Bacteria 2633
115 Ga0075429_100866153 3300006880 Unclassified 791
116 Ga0068865_100000089 3300006881 Bacteria 47955
117 Ga0068865_101369003 3300006881 Bacteria 631
118 Ga0097620_100879941 3300006931 Unclassified 981
119 Ga0075435_100012085 3300007076 Bacteria 6382
120 Ga0075435_100820820 3300007076 Bacteria 810
121 Ga0105245_10000640 3300009098 Bacteria 31823
122 Ga0105245_10001641 3300009098 Bacteria 20352
123 Ga0105245_10002937 3300009098 Bacteria 15306
124 Ga0105245_10020753 3300009098 Bacteria 5758
125 Ga0105245_10714357 3300009098 Bacteria 1036
126 Ga0105247_10000591 3300009101 Bacteria 29455
127 Ga0105247_10311573 3300009101 Bacteria 1095
128 Ga0114129_10003422 3300009147 Bacteria 22311
129 Ga0105243_10028842 3300009148 Bacteria 4264
130 Ga0105243_12969963 3300009148 Bacteria 514
131 Ga0105241_10831000 3300009174 Unclassified 853
132 Ga0105242_10008495 3300009176 Bacteria 7886
133 Ga0105242_10652420 3300009176 Bacteria 1023
134 Ga0105242_11634911 3300009176 Unclassified 679
135 Ga0105248_10000017 3300009177 Bacteria 298089
136 Ga0105237_10448368 3300009545 Bacteria 1296
137 Ga0105238_10000016 3300009551 Bacteria 236218
138 Ga0105238_10063863 3300009551 Bacteria 3683
139 Ga0105249_10000368 3300009553 Bacteria 44712
140 Ga0105249_10001411 3300009553 Bacteria 21021
141 Ga0105249_10394142 3300009553 Bacteria 1413
142 Ga0105249_12092226 3300009553 Bacteria 639
143 Ga0105239_10331079 3300010375 Bacteria 1718
144 Ga0105239_10358790 3300010375 Bacteria 1646
145 Ga0105239_10706075 3300010375 Unclassified 1153
146 Ga0105239_11293698 3300010375 Bacteria 841
147 Ga0105239_13655608 3300010375 Bacteria 500
148 Ga0105246_11125411 3300011119 Unclassified 718
149 Ga0157335_1044529 3300012492 Bacteria 511
150 Ga0157371_10021297 3300013102 Bacteria 4761
151 Ga0157370_10037760 3300013104 Bacteria 4678
152 Ga0157370_10141451 3300013104 Bacteria 2242
153 Ga0157369_10000105 3300013105 Bacteria 117996
154 Ga0157369_12188578 3300013105 Unclassified 561
155 Ga0157374_10000785 3300013296 Bacteria 27837
156 Ga0157374_10484385 3300013296 Bacteria 1240
157 Ga0157374_12142974 3300013296 Bacteria 586
158 Ga0157378_10016184 3300013297 Bacteria 6532
159 Ga0157378_10121113 3300013297 Bacteria 2412
160 Ga0157378_10191797 3300013297 Bacteria 1928
161 Ga0163162_10780520 3300013306 Bacteria 1074
162 Ga0157372_10001649 3300013307 Bacteria 24237
163 Ga0157375_10076554 3300013308 Unclassified 3373
164 Ga0157375_10488346 3300013308 Unclassified 1396
165 Ga0157375_13448716 3300013308 Unclassified 526
166 Ga0163163_11693332 3300014325 Bacteria 693
167 Ga0163163_12046880 3300014325 Bacteria 632
168 Ga0163163_12761428 3300014325 Unclassified 548
169 Ga0157380_10001737 3300014326 Bacteria 14372
170 Ga0157380_10051211 3300014326 Bacteria 3265
171 Ga0157380_11754446 3300014326 Bacteria 679
172 Ga0157380_12881778 3300014326 Bacteria 547
173 Ga0157379_10211792 3300014968 Bacteria 1754
174 Ga0157379_10305209 3300014968 Bacteria 1451
175 Ga0157379_11360198 3300014968 Unclassified 687
176 Ga0157379_12285552 3300014968 Bacteria 538
177 Ga0157376_10050590 3300014969 Bacteria 3448
178 Ga0163161_10000064 3300017792 Bacteria 108508
179 Ga0163161_10332348 3300017792 Unclassified 1204
180 Ga0206356_11041816 3300020070 Bacteria 1459
181 Ga0206351_10147608 3300020077 Bacteria 736
182 Ga0206352_10184859 3300020078 Bacteria 1577
183 Ga0206350_11448283 3300020080 Unclassified 595
184 Ga0154015_1384123 3300020610 Bacteria 3712
185 Ga0224712_10068679 3300022467 Bacteria 1433
186 Ga0207656_10001891 3300025321 Bacteria 6967
187 Ga0207656_10016340 3300025321 Bacteria 2889
188 Ga0207682_10000041 3300025893 Bacteria 52338
189 Ga0207642_10030362 3300025899 Bacteria 2250
190 Ga0207710_10000684 3300025900 Bacteria 19039
191 Ga0207710_10130282 3300025900 Bacteria 1207
192 Ga0207680_10002263 3300025903 Bacteria 8980
193 Ga0207680_10017281 3300025903 Unclassified 3808
194 Ga0207647_10260908 3300025904 Bacteria 992
195 Ga0207705_10037805 3300025909 Bacteria 3454
196 Ga0207654_10076779 3300025911 Bacteria 2000
197 Ga0207707_10007315 3300025912 Bacteria 9615
198 Ga0207671_10566576 3300025914 Bacteria 906
199 Ga0207693_10001233 3300025915 Bacteria 22785
200 Ga0207663_10000399 3300025916 Bacteria 18806
201 Ga0207660_10228988 3300025917 Bacteria 1461
202 Ga0207649_10000015 3300025920 Bacteria 245662
203 Ga0207652_10000286 3300025921 Bacteria 52725
204 Ga0207652_10001116 3300025921 Bacteria 24218
205 Ga0207694_10000012 3300025924 Bacteria 411218
206 Ga0207650_10101377 3300025925 Bacteria 2216
207 Ga0207659_10000147 3300025926 Bacteria 41347
208 Ga0207687_10000040 3300025927 Bacteria 113598
209 Ga0207687_10000331 3300025927 Bacteria 31810
210 Ga0207687_10001806 3300025927 Bacteria 14723
211 Ga0207687_10049609 3300025927 Bacteria 2919
212 Ga0207700_10000003 3300025928 Bacteria 500797
213 Ga0207664_10048306 3300025929 Bacteria 3346
214 Ga0207644_10398174 3300025931 Bacteria 1125
215 Ga0207690_10004100 3300025932 Bacteria 8604
216 Ga0207690_10115305 3300025932 Bacteria 1941
217 Ga0207706_10000003 3300025933 Bacteria 345011
218 Ga0207686_10003997 3300025934 Bacteria 7914
219 Ga0207686_10068904 3300025934 Bacteria 2268
220 Ga0207686_10155319 3300025934 Bacteria 1598
221 Ga0207709_10001985 3300025935 Bacteria 13342
222 Ga0207670_10018122 3300025936 Bacteria 4272
223 Ga0207670_10093989 3300025936 Bacteria 2126
224 Ga0207704_10000018 3300025938 Bacteria 153994
225 Ga0207665_10110437 3300025939 Bacteria 1931
226 Ga0207691_10000028 3300025940 Bacteria 121090
227 Ga0207711_10000011 3300025941 Bacteria 518817
228 Ga0207689_10354773 3300025942 Bacteria 1219
229 Ga0207689_10754297 3300025942 Bacteria 821
230 Ga0207661_10000714 3300025944 Bacteria 21578
231 Ga0207661_10003496 3300025944 Bacteria 10911
232 Ga0207661_10022934 3300025944 Bacteria 4709
233 Ga0207661_10032745 3300025944 Bacteria 4031
234 Ga0207661_10831287 3300025944 Bacteria 850
235 Ga0207679_10040523 3300025945 Bacteria 3335
236 Ga0207651_10002542 3300025960 Bacteria 8713
237 Ga0207712_10000027 3300025961 Bacteria 263739
238 Ga0207712_10002082 3300025961 Bacteria 13106
239 Ga0207712_10255024 3300025961 Bacteria 1420
240 Ga0207712_11113832 3300025961 Bacteria 703
241 Ga0207668_10008461 3300025972 Bacteria 6134
242 Ga0207668_10010007 3300025972 Bacteria 5708
243 Ga0207668_10506628 3300025972 Bacteria 1039
244 Ga0207640_10000205 3300025981 Bacteria 41887
245 Ga0207640_10066797 3300025981 Bacteria 2404
246 Ga0207658_10000465 3300025986 Bacteria 37863
247 Ga0207658_10005807 3300025986 Bacteria 8450
248 Ga0207658_10335726 3300025986 Unclassified 1312
249 Ga0207658_10459259 3300025986 Bacteria 1129
250 Ga0207658_10702690 3300025986 Unclassified 914
251 Ga0207677_10001420 3300026023 Bacteria 12761
252 Ga0207677_10009593 3300026023 Bacteria 5448
253 Ga0207703_10000020 3300026035 Bacteria 251603
254 Ga0207703_10738672 3300026035 Bacteria 937
255 Ga0207639_10185322 3300026041 Unclassified 1774
256 Ga0207639_11010971 3300026041 Bacteria 779
257 Ga0207678_10001534 3300026067 Bacteria 21208
258 Ga0207678_10363079 3300026067 Bacteria 1250
259 Ga0207708_10079636 3300026075 Bacteria 2517
260 Ga0207702_10000690 3300026078 Bacteria 36486
261 Ga0207702_10003502 3300026078 Bacteria 14309
262 Ga0207702_11103351 3300026078 Bacteria 787
263 Ga0207641_10001193 3300026088 Bacteria 26064
264 Ga0207641_10002149 3300026088 Bacteria 18577
265 Ga0207674_10587417 3300026116 Unclassified 1076
266 Ga0207675_100146155 3300026118 Bacteria 2248
267 Ga0207683_10003514 3300026121 Bacteria 13672
268 Ga0207698_10000015 3300026142 Bacteria 207368
269 Ga0207698_10018608 3300026142 Bacteria 4739
270 Ga0268266_10000029 3300028379 Bacteria 424015
271 Ga0268266_10001209 3300028379 Bacteria 31846
272 Ga0268266_10002632 3300028379 Bacteria 18955
273 Ga0268266_10058212 3300028379 Bacteria 3327
274 Ga0268266_11324723 3300028379 Bacteria 695
275 Ga0268265_10001048 3300028380 Bacteria 24851
276 Ga0268264_10064748 3300028381 Bacteria 3077
277 Ga0268264_10135194 3300028381 Bacteria 2191
278 Ga0265337_1000061 3300028556 Bacteria 49480
279 Ga0265326_10000067 3300028558 Bacteria 59507
280 Ga0265334_10117279 3300028573 Bacteria 953
281 Ga0265322_10000005 3300028654 Bacteria 246112
282 Ga0265338_10000051 3300028800 Bacteria 211202
283 Ga0265324_10000510 3300029957 Bacteria 26678
284 Ga0265324_10094406 3300029957 Bacteria 1017
285 Ga0265332_10131848 3300031238 Bacteria 1048
286 Ga0265328_10000563 3300031239 Bacteria 17200
287 Ga0265320_10000010 3300031240 Bacteria 250501
288 Ga0265325_10006156 3300031241 Bacteria 7321
289 Ga0265329_10014727 3300031242 Bacteria 2753
290 Ga0265339_10051355 3300031249 Bacteria 2250
291 Ga0265331_10003612 3300031250 Bacteria 9895
292 Ga0265327_10000040 3300031251 Bacteria 291052
293 Ga0265316_10036257 3300031344 Bacteria 3988
294 Ga0265314_10000208 3300031711 Bacteria 86855
295 Ga0316576_10005341 3300031727 Bacteria 7832
296 Ga0316578_10487678 3300031728 Bacteria 727
297 Ga0307405_10650807 3300031731 Bacteria 867
298 Ga0316577_10184447 3300031733 Bacteria 1179
299 Ga0307415_100001546 3300032126 Bacteria 11063
300 Ga0316583_10106778 3300032133 Bacteria 976
301 Ga0316574_0020645 3300035398 Bacteria 3901
302 Ga0316574_0885993 3300035398 Bacteria 540
303 Ga0373933_0102864 3300035724 Bacteria 1774
304 Ga0373937_0143413 3300036401 Bacteria 2235
305 Ga0373937_0312282 3300036401 Bacteria 1487
306 Ga0316584_0020165 3300036712 Bacteria 4829
307 Ga0451791_1304923 3300041451 Bacteria 834
308 Ga0451795_1439009 3300041456 Bacteria 551
309 Ga0451800_0767792 3300041459 Unclassified 792
310 Ga0451804_1055041 3300041463 Bacteria 504
311 Ga0451807_0854954 3300041486 Bacteria 1709
312 Ga0451807_2127737 3300041486 Bacteria 1189
313 Ga0451807_2260395 3300041486 Unclassified 1040
314 Ga0451835_0033024 3300041492 Bacteria 693
315 Ga0451837_0805574 3300041494 Unclassified 892
316 Ga0451849_0377150 3300041505 Bacteria 1019
317 Ga0451843_1693432 3300041509 Bacteria 753
318 Ga0451853_1950518 3300041512 Bacteria 1342
319 Ga0451853_2626091 3300041512 Bacteria 596
320 Ga0451853_3252069 3300041512 Bacteria 1270
321 Ga0466963_0002882 3300044694 Bacteria 9719
322 Ga0466963_0125338 3300044694 Bacteria 1770
323 Ga0466963_0197296 3300044694 Bacteria 1407
324 Ga0466957_0030890 3300044842 Bacteria 3199
325 Ga0466957_0184388 3300044842 Bacteria 1364
326 Ga0466958_0038088 3300045836 Bacteria 2884
327 Ga0466967_0000012 3300045976 Bacteria 104270
328 Ga0466967_0111590 3300045976 Bacteria 2513
329 Ga0466967_0243572 3300045976 Bacteria 1716
330 Ga0466967_0479102 3300045976 Bacteria 1219
331 Ga0466967_0995990 3300045976 Unclassified 834
332 Ga0495592_0000423 3300046454 Bacteria 32094
333 Ga0495592_0057352 3300046454 Bacteria 2875
334 Ga0495592_0801781 3300046454 Unclassified 559
335 Ga0495603_0000194 3300046455 Bacteria 31819
336 Ga0495629_0000806 3300046459 Bacteria 25376
337 Ga0495629_0003436 3300046459 Bacteria 11976
338 Ga0495629_0012055 3300046459 Bacteria 6266
339 Ga0495638_0048154 3300046460 Bacteria 2669
340 Ga0495641_0000004 3300046461 Bacteria 210501
341 Ga0495641_0025585 3300046461 Bacteria 2896
342 Ga0495641_0095674 3300046461 Bacteria 1326
343 Ga0495651_0037463 3300046462 Bacteria 3775
344 Ga0495651_0088358 3300046462 Unclassified 2329
345 Ga0495651_0342644 3300046462 Bacteria 990
346 Ga0495653_0052740 3300046463 Bacteria 3116
347 Ga0495653_0088263 3300046463 Bacteria 2275
348 Ga0495653_0134167 3300046463 Bacteria 1748
349 Ga0495653_0189604 3300046463 Bacteria 1404
350 Ga0495653_0303676 3300046463 Bacteria 1040
351 Ga0495653_0431541 3300046463 Bacteria 832
352 Ga0495639_0041462 3300046475 Bacteria 2073
353 Ga0495662_0000051 3300046476 Bacteria 40340
354 Ga0495662_0005718 3300046476 Bacteria 6217
355 Ga0495664_0378391 3300046477 Bacteria 851
356 Ga0495594_0000012 3300046499 Bacteria 105133
357 Ga0495606_0000895 3300046507 Bacteria 44393
358 Ga0495608_0000013 3300046511 Bacteria 228481
359 Ga0495608_0000092 3300046511 Bacteria 64795
360 Ga0495608_0011421 3300046511 Bacteria 6182
361 Ga0495618_0000094 3300046514 Bacteria 64293
362 Ga0495620_0001737 3300046515 Bacteria 12862
363 Ga0495628_0007879 3300046516 Bacteria 9179
364 Ga0495628_0069581 3300046516 Unclassified 2745
365 Ga0495628_0134161 3300046516 Bacteria 1893
366 Ga0495630_0000032 3300046517 Bacteria 134425
367 Ga0495630_0000519 3300046517 Bacteria 28420
368 Ga0495630_0001088 3300046517 Bacteria 18687
369 Ga0495630_0230802 3300046517 Bacteria 1414
370 Ga0495630_0245725 3300046517 Bacteria 1367
371 Ga0495644_0002998 3300046523 Bacteria 6691
372 Ga0495644_0154778 3300046523 Bacteria 878
373 Ga0495652_0000018 3300046529 Bacteria 201634
374 Ga0495652_0001501 3300046529 Bacteria 25686
375 Ga0495652_0083319 3300046529 Unclassified 2633
376 Ga0495652_0172158 3300046529 Bacteria 1670
377 Ga0495640_0006754 3300046533 Bacteria 9054
378 Ga0495640_0089880 3300046533 Unclassified 2028
379 Ga0495586_0001742 3300046535 Bacteria 11874
380 Ga0495587_0028299 3300046536 Bacteria 3408
381 Ga0495587_0075141 3300046536 Bacteria 1962
382 Ga0495587_0093925 3300046536 Bacteria 1732
383 Ga0495598_0001408 3300046537 Bacteria 4757
384 Ga0495621_0001476 3300046539 Bacteria 6101
385 Ga0495645_0091667 3300046543 Unclassified 2170
386 Ga0495645_0233335 3300046543 Bacteria 1231
387 Ga0495645_0441170 3300046543 Bacteria 823
388 Ga0495622_0000353 3300046557 Bacteria 32367
389 Ga0495633_0103902 3300046558 Bacteria 1318
390 Ga0495667_0000265 3300046559 Bacteria 34047
391 Ga0495634_0000191 3300046642 Bacteria 56356
392 Ga0495634_0188219 3300046642 Bacteria 1289
393 Ga0495625_0000243 3300046660 Bacteria 85589
394 Ga0495625_0439668 3300046660 Bacteria 808
395 Ga0495635_0000182 3300046663 Bacteria 39469
396 Ga0495635_0107909 3300046663 Bacteria 1902
397 Ga0495588_0000266 3300046674 Bacteria 40474
398 Ga0495657_0000003 3300046675 Bacteria 279680
399 Ga0495657_0009610 3300046675 Bacteria 7324
400 Ga0495657_0325707 3300046675 Bacteria 912
401 Ga0495599_0110208 3300046678 Bacteria 1715
402 Ga0495599_0270545 3300046678 Bacteria 1031
403 Ga0495646_0222613 3300046680 Bacteria 1020
404 Ga0495647_0000005 3300046681 Bacteria 125996
405 Ga0495647_0001427 3300046681 Bacteria 7390
406 Ga0495647_0011078 3300046681 Bacteria 3082
407 Ga0495658_0089324 3300046683 Bacteria 1823
408 Ga0495669_0000248 3300046684 Bacteria 31659
409 Ga0495669_0018718 3300046684 Bacteria 2980
410 Ga0495613_0000173 3300046689 Bacteria 62463
411 Ga0495613_0000233 3300046689 Bacteria 53074
412 Ga0495613_0341865 3300046689 Bacteria 1029
413 Ga0495624_0000563 3300046690 Bacteria 29131
414 Ga0495624_0000600 3300046690 Bacteria 28092
415 Ga0495670_0104819 3300046691 Bacteria 1459
416 Ga0495649_0007268 3300046694 Bacteria 6776
417 Ga0495600_0002279 3300046809 Bacteria 10937
418 Ga0495600_0007184 3300046809 Bacteria 6801
419 Ga0495581_0169689 3300047315 Bacteria 1276
420 Ga0495604_0000437 3300047317 Bacteria 37081
421 Ga0495604_0000509 3300047317 Bacteria 34149
422 Ga0495604_0049629 3300047317 Bacteria 3259
423 Ga0495604_0101081 3300047317 Bacteria 2118
424 Ga0495674_0000039 3300047319 Bacteria 97645
425 Ga0495672_0043357 3300047320 Unclassified 2706
426 Ga0495672_0103231 3300047320 Bacteria 1542
427 Ga0495676_0000320 3300047321 Bacteria 38969
428 Ga0495676_0009275 3300047321 Bacteria 8964
429 Ga0495676_0057377 3300047321 Bacteria 3072
430 Ga0495676_0153025 3300047321 Bacteria 1639
431 Ga0495676_0445721 3300047321 Bacteria 854
432 Ga0495680_0000113 3300047322 Bacteria 76525
433 Ga0495680_0000513 3300047322 Bacteria 43869
434 Ga0495680_0005366 3300047322 Bacteria 12092
435 Ga0495680_0047844 3300047322 Bacteria 3361
436 Ga0495680_0094480 3300047322 Bacteria 2237
437 Ga0495680_0608104 3300047322 Bacteria 731
438 Ga0495680_0802749 3300047322 Bacteria 614
439 Ga0495675_0000002 3300047444 Bacteria 216469
440 Ga0495675_0123958 3300047444 Bacteria 1608
441 Ga0495679_015058 3300047446 Bacteria 2840
442 Ga0495685_065761 3300047447 Bacteria 1219
443 Ga0495684_0755433 3300047471 Unclassified 639
444 Ga0495686_0009817 3300047472 Bacteria 6867
445 Ga0495686_0018236 3300047472 Bacteria 4714
446 Ga0495686_0102809 3300047472 Unclassified 1721
447 Ga0495686_0590810 3300047472 Unclassified 576
448 Ga0495593_0263367 3300047673 Bacteria 863
449 Ga0495602_0000034 3300048088 Bacteria 140722
450 Ga0495602_0000315 3300048088 Bacteria 44563
451 Ga0495602_0102049 3300048088 Bacteria 2352
452 Ga0495602_0178057 3300048088 Unclassified 1643
453 Ga0495602_0413779 3300048088 Bacteria 959
454 Ga0496100_0000001 3300048903 Bacteria 530179
455 Ga0496100_0000234 3300048903 Bacteria 29327
456 Ga0496101_0000028 3300048904 Bacteria 198664
457 Ga0496101_0000382 3300048904 Bacteria 29327
458 Ga0496102_0056244 3300048905 Bacteria 3588
459 Ga0496102_0256229 3300048905 Bacteria 1649
460 Ga0496102_0411497 3300048905 Bacteria 1271
461 Ga0496102_0636199 3300048905 Bacteria 990
462 Ga0496103_0026396 3300048906 Bacteria 3516
463 Ga0496103_0227247 3300048906 Bacteria 1200
464 Ga0496103_0603262 3300048906 Unclassified 699
465 Ga0496104_0000008 3300048907 Bacteria 516976
466 Ga0496104_0000010 3300048907 Bacteria 475255
467 Ga0496104_0043010 3300048907 Bacteria 4241
468 Ga0496104_0075362 3300048907 Bacteria 3212
469 Ga0496105_0000003 3300048908 Bacteria 713251
470 Ga0496105_0000005 3300048908 Bacteria 475797
471 Ga0496105_0000051 3300048908 Bacteria 90365
472 Ga0496105_0014512 3300048908 Bacteria 6271
473 Ga0496106_0000134 3300048909 Bacteria 55531
474 Ga0496106_0000172 3300048909 Bacteria 47232
475 Ga0496106_0000455 3300048909 Bacteria 29281
476 Ga0496107_0000002 3300048910 Bacteria 320871
477 Ga0496107_0000234 3300048910 Bacteria 29310
478 Ga0496107_0009773 3300048910 Bacteria 6654
479 Ga0496108_0000004 3300048911 Bacteria 545055
480 Ga0496108_0000005 3300048911 Bacteria 535059
481 Ga0496108_0013089 3300048911 Bacteria 6761
482 Ga0496108_0340522 3300048911 Bacteria 1308
483 Ga0496108_0342103 3300048911 Unclassified 1305
484 Ga0496109_0000002 3300048912 Bacteria 443393
485 Ga0496109_0000011 3300048912 Bacteria 234908
486 Ga0496109_0000013 3300048912 Bacteria 227469
487 Ga0496109_0209810 3300048912 Bacteria 1832
488 Ga0496109_0388835 3300048912 Bacteria 1318
489 Ga0496109_1096187 3300048912 Bacteria 733
490 Ga0496109_2022082 3300048912 Bacteria 508
491 Ga0496110_0000185 3300048913 Bacteria 39094
492 Ga0496110_0001335 3300048913 Bacteria 17714
493 Ga0496110_0023711 3300048913 Bacteria 5221
494 Ga0496110_0061760 3300048913 Bacteria 3308
495 Ga0496110_0853698 3300048913 Bacteria 816
496 Ga0496110_1081795 3300048913 Bacteria 710
497 Ga0496111_0000103 3300048914 Bacteria 36804
498 Ga0496111_0312986 3300048914 Bacteria 1163
499 Ga0496111_0376921 3300048914 Bacteria 1049
500 Ga0496111_0583240 3300048914 Bacteria 819
501 Ga0496111_0900609 3300048914 Unclassified 637
502 Ga0496112_0000026 3300048915 Bacteria 144758
503 Ga0496112_0000661 3300048915 Bacteria 23981
504 Ga0496112_0281563 3300048915 Bacteria 1610
505 Ga0496112_0385140 3300048915 Bacteria 1343
506 Ga0496112_1011216 3300048915 Bacteria 751
507 Ga0496112_1198059 3300048915 Bacteria 676
508 Ga0496112_1644325 3300048915 Unclassified 555
509 Ga0496113_0000017 3300048916 Bacteria 74327
510 Ga0496113_0005910 3300048916 Bacteria 7687
511 Ga0496113_0093778 3300048916 Bacteria 2318
512 Ga0496113_0245149 3300048916 Bacteria 1430
513 Ga0496113_0592722 3300048916 Unclassified 888
514 Ga0496114_0037828 3300048917 Bacteria 3992
515 Ga0496114_0310955 3300048917 Bacteria 1392
516 Ga0496114_1212321 3300048917 Unclassified 641
517 Ga0496115_0000022 3300048918 Bacteria 164224
518 Ga0496115_0015665 3300048918 Bacteria 5756
519 Ga0496115_0768427 3300048918 Bacteria 752
520 Ga0496117_0001965 3300048920 Bacteria 27342
521 Ga0496118_0004106 3300048921 Bacteria 17626
522 Ga0496119_0001195 3300048922 Bacteria 32488
523 Ga0496119_0015154 3300048922 Bacteria 5965
524 Ga0496119_0017814 3300048922 Bacteria 5324
525 Ga0496119_0114683 3300048922 Unclassified 1490
526 Ga0496120_0002756 3300048923 Bacteria 17134
527 Ga0496120_0031163 3300048923 Bacteria 3233
528 Ga0496120_0426465 3300048923 Unclassified 581
529 Ga0496121_0015761 3300048924 Bacteria 7875
530 Ga0496121_0036117 3300048924 Bacteria 4409
531 Ga0496121_0124862 3300048924 Unclassified 1937
532 Ga0496121_0151799 3300048924 Bacteria 1704
533 Ga0496121_0254448 3300048924 Bacteria 1216
534 Ga0496124_0015496 3300048927 Bacteria 7303
535 Ga0496124_0051873 3300048927 Bacteria 3488
536 Ga0496124_0274072 3300048927 Bacteria 1234
537 Ga0496125_0116705 3300048928 Bacteria 1916
538 Ga0496125_0296877 3300048928 Unclassified 992
539 Ga0496126_0015537 3300048929 Bacteria 7650
540 Ga0496126_0035695 3300048929 Bacteria 4657
541 Ga0496126_0541064 3300048929 Bacteria 925
542 Ga0496126_0623562 3300048929 Bacteria 847
543 Ga0501031_0004579 3300049568 Bacteria 8968
544 Ga0501032_0002738 3300049569 Bacteria 13725
545 Ga0501033_0006871 3300049570 Bacteria 8883
546 Ga0501034_0002876 3300049571 Bacteria 20017
547 Ga0501034_0029572 3300049571 Bacteria 5570
548 Ga0501034_0035223 3300049571 Bacteria 5075
549 Ga0501034_0092678 3300049571 Bacteria 3018
550 Ga0501034_0169010 3300049571 Bacteria 2154
551 Ga0501034_0176227 3300049571 Bacteria 2104
552 Ga0501034_0968362 3300049571 Bacteria 736
553 Ga0501036_0001783 3300049572 Bacteria 16706
554 Ga0501037_0005959 3300049573 Bacteria 8903
555 Ga0501038_0009090 3300049574 Bacteria 9121
556 Ga0501039_0008428 3300049575 Bacteria 7857
557 Ga0501040_0032498 3300049576 Bacteria 3531
558 Ga0501041_0963639 3300049577 Bacteria 549
559 Ga0501042_0014137 3300049578 Bacteria 5443
560 Ga0501042_0086233 3300049578 Bacteria 2252
561 Ga0501042_0126989 3300049578 Unclassified 1836
562 Ga0501042_0308659 3300049578 Bacteria 1143
563 Ga0501043_0001000 3300049579 Bacteria 24865
564 Ga0501046_0008562 3300049580 Bacteria 8903
565 Ga0501046_0235418 3300049580 Bacteria 1352
566 Ga0501047_0003193 3300049581 Bacteria 15541
567 Ga0501047_0028699 3300049581 Bacteria 5366
568 Ga0501047_0051756 3300049581 Bacteria 3969
569 Ga0501047_0246062 3300049581 Bacteria 1637
570 Ga0501047_0276027 3300049581 Bacteria 1526
571 Ga0501048_0006544 3300049582 Bacteria 8854
572 Ga0501067_0011384 3300049583 Bacteria 4926
573 Ga0501067_0082768 3300049583 Bacteria 1780
574 Ga0501068_0024152 3300049584 Unclassified 3568
575 Ga0501068_0158624 3300049584 Bacteria 1425
576 Ga0501068_0180836 3300049584 Bacteria 1333
577 Ga0501068_0242891 3300049584 Bacteria 1146
578 Ga0501069_0014239 3300049585 Bacteria 4248
579 Ga0501069_0081767 3300049585 Bacteria 1820
580 Ga0501070_0000603 3300049586 Bacteria 32865
581 Ga0501070_0056882 3300049586 Bacteria 3242
582 Ga0501070_0076277 3300049586 Bacteria 2775
583 Ga0501070_0134886 3300049586 Bacteria 2038
584 Ga0501070_0171733 3300049586 Bacteria 1785
585 Ga0501071_0412377 3300049587 Unclassified 1032
586 Ga0501071_0520078 3300049587 Bacteria 913
587 Ga0501072_0007991 3300049588 Bacteria 8029
588 Ga0501072_0194070 3300049588 Bacteria 1619
589 Ga0501072_0474369 3300049588 Bacteria 990
590 Ga0501072_1396853 3300049588 Bacteria 542
591 Ga0501073_0012442 3300049589 Bacteria 6208
592 Ga0501073_0403410 3300049589 Bacteria 944
593 Ga0501074_0017277 3300049590 Bacteria 5233
594 Ga0501074_0035338 3300049590 Bacteria 3620
595 Ga0501074_0067100 3300049590 Bacteria 2580
596 Ga0501074_0165172 3300049590 Bacteria 1581
597 Ga0501074_0200930 3300049590 Bacteria 1420
598 Ga0501075_0001603 3300049591 Bacteria 14813
599 Ga0501076_0100114 3300049592 Bacteria 2335
600 Ga0501076_0852228 3300049592 Bacteria 752
601 Ga0501079_0018348 3300049741 Bacteria 5348
602 Ga0501079_0745431 3300049741 Unclassified 771
603 Ga0501080_0041381 3300049742 Bacteria 4294
604 Ga0501080_0198304 3300049742 Bacteria 1843
605 Ga0501080_0220594 3300049742 Bacteria 1735
606 Ga0501081_0573425 3300049743 Unclassified 844
607 Ga0501083_0009148 3300049744 Bacteria 6998
608 Ga0501083_0036922 3300049744 Bacteria 3329
609 Ga0501083_0041592 3300049744 Bacteria 3116
610 Ga0501083_0572237 3300049744 Bacteria 735
611 Ga0501035_0000873 3300049822 Bacteria 32037
612 Ga0501035_0034885 3300049822 Bacteria 4570
613 Ga0501035_1194400 3300049822 Bacteria 590
614 Ga0501044_0003139 3300049823 Bacteria 18693
615 Ga0501044_0036180 3300049823 Bacteria 5165
616 Ga0501044_1143201 3300049823 Bacteria 647
617 Ga0501045_0090325 3300049824 Bacteria 2263
618 nmdc:mga00v17_12096_c1 3300050491 Bacteria 4754
619 nmdc:mga00v17_527018_c1 3300050491 Bacteria 765
620 nmdc:mga00v17_68915_c1 3300050491 Bacteria 2187
621 nmdc:mga00v17_85669_c1 3300050491 Bacteria 1973
622 nmdc:mga0yw44_15653_c1 3300050492 Bacteria 4070
623 nmdc:mga0yw44_201986_c1 3300050492 Bacteria 1313
624 nmdc:mga05p37_156002_c1 3300050507 Bacteria 2790
625 nmdc:mga0qj67_20491_c1 3300050509 Bacteria 5063
626 nmdc:mga06r32_1489750_c1 3300050510 Bacteria 617
627 nmdc:mga0n895_106073_c1 3300050512 Bacteria 2822
628 nmdc:mga0n895_45699_c1 3300050512 Bacteria 4274
629 nmdc:mga0a205_281_c1 3300050515 Bacteria 37267
630 nmdc:mga0a205_45873_c1 3300050515 Bacteria 4215
631 Ga0495601_0000029 3300053077 Bacteria 111437
632 Ga0495601_0000444 3300053077 Bacteria 21636
633 Ga0495601_0008993 3300053077 Bacteria 5897
634 Ga0495601_0014716 3300053077 Bacteria 4720
635 Ga0495601_0101836 3300053077 Bacteria 1855
636 Ga0495601_0390189 3300053077 Bacteria 903
637 Ga0495612_0001200 3300053078 Bacteria 10676
638 Ga0495612_0004444 3300053078 Bacteria 5819
639 Ga0495612_0025544 3300053078 Bacteria 2372
640 Ga0495595_0000007 3300053084 Bacteria 228504
641 Ga0495595_0000547 3300053084 Bacteria 14350
642 Ga0495595_0052701 3300053084 Bacteria 1888
643 Ga0495619_0000026 3300053085 Bacteria 167387
644 Ga0495619_0000067 3300053085 Bacteria 83418
645 Ga0495619_0000205 3300053085 Bacteria 42913
646 Ga0495619_0002937 3300053085 Bacteria 11078
647 Ga0500583_0370720 3300053092 Bacteria 691
648 Ga0500566_0001360 3300053094 Bacteria 14314
649 Ga0500641_0003315 3300053096 Bacteria 5697
650 Ga0500650_0163534 3300053098 Unclassified 1026
651 Ga0500614_000263 3300053123 Bacteria 13569
652 Ga0500658_0221181 3300053134 Bacteria 868
653 Ga0500568_0173437 3300053139 Bacteria 793
654 Ga0501084_1032848 3300054114 Unclassified 690
655 Ga0501082_0023859 3300060353 Bacteria 5274
656 Ga0501082_0560331 3300060353 Bacteria 1000
657 Ga0530510_0669914 3300061734 Unclassified 790

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_10049609 Ga0207687_100496093 98
2 3300049590 Ga0501074_0165172 Ga0501074_0165172_127_525 105
3 3300041456 Ga0451795_1439009 Ga0451795_1439009_145_540 106
4 3300046461 Ga0495641_0025585 Ga0495641_0025585_275_685 106
5 3300025961 Ga0207712_11113832 Ga0207712_111138322 107
6 3300036401 Ga0373937_0143413 Ga0373937_0143413_31_366 107
7 3300049743 Ga0501081_0573425 Ga0501081_0573425_63_419 108
8 3300013296 Ga0157374_12142974 Ga0157374_121429741 115
9 3300048929 Ga0496126_0035695 Ga0496126_0035695_2804_3160 118
10 3300050491 nmdc:mga00v17_527018_c1 nmdc:mga00v17_527018_c1_357_749 120
11 3300005335 Ga0070666_10021581 Ga0070666_100215813 121
12 3300005335 Ga0070666_10832117 Ga0070666_108321171 121
13 3300005367 Ga0070667_100004874 Ga0070667_1000048746 121
14 3300005435 Ga0070714_100598028 Ga0070714_1005980281 121
15 3300005455 Ga0070663_100000405 Ga0070663_1000004058 121
16 3300005530 Ga0070679_100001611 Ga0070679_10000161115 121
17 3300005535 Ga0070684_100444529 Ga0070684_1004445292 121
18 3300005548 Ga0070665_100020404 Ga0070665_1000204046 121
19 3300005548 Ga0070665_102250261 Ga0070665_1022502611 121
20 3300005617 Ga0068859_100880054 Ga0068859_1008800542 121
21 3300005937 Ga0081455_10004481 Ga0081455_100044817 121
22 3300005937 Ga0081455_10232360 Ga0081455_102323602 121
23 3300006931 Ga0097620_100879941 Ga0097620_1008799412 121
24 3300009545 Ga0105237_10448368 Ga0105237_104483682 121
25 3300009551 Ga0105238_10063863 Ga0105238_100638635 121
26 3300010375 Ga0105239_10358790 Ga0105239_103587902 121
27 3300010375 Ga0105239_13655608 Ga0105239_136556081 121
28 3300013105 Ga0157369_12188578 Ga0157369_121885781 121
29 3300014968 Ga0157379_12285552 Ga0157379_122855522 121
30 3300020080 Ga0206350_11448283 Ga0206350_114482831 121
31 3300020610 Ga0154015_1384123 Ga0154015_13841231 121
32 3300025903 Ga0207680_10017281 Ga0207680_100172813 121
33 3300025914 Ga0207671_10566576 Ga0207671_105665762 121
34 3300025921 Ga0207652_10001116 Ga0207652_1000111620 121
35 3300025931 Ga0207644_10398174 Ga0207644_103981742 121
36 3300025942 Ga0207689_10354773 Ga0207689_103547732 121
37 3300025944 Ga0207661_10032745 Ga0207661_100327453 121
38 3300025986 Ga0207658_10005807 Ga0207658_100058076 121
39 3300025986 Ga0207658_10459259 Ga0207658_104592592 121
40 3300026067 Ga0207678_10001534 Ga0207678_100015348 121
41 3300028379 Ga0268266_10002632 Ga0268266_100026326 121
42 3300046463 Ga0495653_0088263 Ga0495653_0088263_1678_2073 121
43 3300046529 Ga0495652_0172158 Ga0495652_0172158_964_1359 121
44 3300046660 Ga0495625_0439668 Ga0495625_0439668_375_770 121
45 3300047444 Ga0495675_0123958 Ga0495675_0123958_535_930 121
46 3300047472 Ga0495686_0009817 Ga0495686_0009817_3942_4340 121
47 3300047472 Ga0495686_0018236 Ga0495686_0018236_3508_3906 121
48 3300047472 Ga0495686_0590810 Ga0495686_0590810_157_555 121
49 3300048905 Ga0496102_0256229 Ga0496102_0256229_786_1181 121
50 3300048906 Ga0496103_0026396 Ga0496103_0026396_1359_1754 121
51 3300048906 Ga0496103_0603262 Ga0496103_0603262_135_530 121
52 3300048907 Ga0496104_0075362 Ga0496104_0075362_784_1179 121
53 3300048908 Ga0496105_0014512 Ga0496105_0014512_61_456 121
54 3300048911 Ga0496108_0342103 Ga0496108_0342103_900_1295 121
55 3300048912 Ga0496109_1096187 Ga0496109_1096187_222_617 121
56 3300048914 Ga0496111_0376921 Ga0496111_0376921_362_757 121
57 3300048917 Ga0496114_0310955 Ga0496114_0310955_29_424 121
58 3300048917 Ga0496114_1212321 Ga0496114_1212321_113_508 121
59 3300048918 Ga0496115_0768427 Ga0496115_0768427_156_551 121
60 3300048920 Ga0496117_0001965 Ga0496117_0001965_1961_2356 121
61 3300048921 Ga0496118_0004106 Ga0496118_0004106_1686_2081 121
62 3300048922 Ga0496119_0001195 Ga0496119_0001195_31223_31621 121
63 3300048922 Ga0496119_0017814 Ga0496119_0017814_3421_3816 121
64 3300048922 Ga0496119_0114683 Ga0496119_0114683_993_1388 121
65 3300048923 Ga0496120_0002756 Ga0496120_0002756_4730_5125 121
66 3300048923 Ga0496120_0426465 Ga0496120_0426465_34_429 121
67 3300048924 Ga0496121_0015761 Ga0496121_0015761_2590_2985 121
68 3300048924 Ga0496121_0036117 Ga0496121_0036117_1443_1838 121
69 3300048924 Ga0496121_0124862 Ga0496121_0124862_1229_1624 121
70 3300048924 Ga0496121_0151799 Ga0496121_0151799_809_1204 121
71 3300048924 Ga0496121_0254448 Ga0496121_0254448_522_917 121
72 3300048927 Ga0496124_0015496 Ga0496124_0015496_1780_2175 121
73 3300048927 Ga0496124_0051873 Ga0496124_0051873_437_832 121
74 3300048928 Ga0496125_0116705 Ga0496125_0116705_933_1328 121
75 3300048929 Ga0496126_0015537 Ga0496126_0015537_3189_3584 121
76 3300048929 Ga0496126_0541064 Ga0496126_0541064_215_610 121
77 3300048929 Ga0496126_0623562 Ga0496126_0623562_273_668 121
78 3300049568 Ga0501031_0004579 Ga0501031_0004579_5887_6282 121
79 3300049569 Ga0501032_0002738 Ga0501032_0002738_7516_7911 121
80 3300049570 Ga0501033_0006871 Ga0501033_0006871_2676_3071 121
81 3300049571 Ga0501034_0029572 Ga0501034_0029572_3458_3853 121
82 3300049571 Ga0501034_0169010 Ga0501034_0169010_1109_1504 121
83 3300049572 Ga0501036_0001783 Ga0501036_0001783_10537_10932 121
84 3300049573 Ga0501037_0005959 Ga0501037_0005959_5804_6199 121
85 3300049574 Ga0501038_0009090 Ga0501038_0009090_5776_6171 121
86 3300049575 Ga0501039_0008428 Ga0501039_0008428_4927_5322 121
87 3300049576 Ga0501040_0032498 Ga0501040_0032498_1881_2276 121
88 3300049577 Ga0501041_0963639 Ga0501041_0963639_49_444 121
89 3300049578 Ga0501042_0126989 Ga0501042_0126989_774_1169 121
90 3300049579 Ga0501043_0001000 Ga0501043_0001000_2710_3105 121
91 3300049580 Ga0501046_0008562 Ga0501046_0008562_2703_3098 121
92 3300049580 Ga0501046_0235418 Ga0501046_0235418_649_1050 121
93 3300049581 Ga0501047_0003193 Ga0501047_0003193_7068_7463 121
94 3300049581 Ga0501047_0028699 Ga0501047_0028699_4183_4578 121
95 3300049581 Ga0501047_0246062 Ga0501047_0246062_514_909 121
96 3300049581 Ga0501047_0276027 Ga0501047_0276027_712_1107 121
97 3300049582 Ga0501048_0006544 Ga0501048_0006544_2700_3095 121
98 3300049583 Ga0501067_0011384 Ga0501067_0011384_995_1390 121
99 3300049584 Ga0501068_0024152 Ga0501068_0024152_831_1226 121
100 3300049585 Ga0501069_0014239 Ga0501069_0014239_103_498 121
101 3300049586 Ga0501070_0000603 Ga0501070_0000603_15733_16128 121
102 3300049586 Ga0501070_0076277 Ga0501070_0076277_1811_2206 121
103 3300049586 Ga0501070_0134886 Ga0501070_0134886_1210_1605 121
104 3300049587 Ga0501071_0412377 Ga0501071_0412377_72_467 121
105 3300049588 Ga0501072_0007991 Ga0501072_0007991_2456_2851 121
106 3300049589 Ga0501073_0012442 Ga0501073_0012442_3122_3517 121
107 3300049590 Ga0501074_0017277 Ga0501074_0017277_2731_3126 121
108 3300049590 Ga0501074_0035338 Ga0501074_0035338_126_521 121
109 3300049590 Ga0501074_0067100 Ga0501074_0067100_2102_2497 121
110 3300049741 Ga0501079_0018348 Ga0501079_0018348_2303_2698 121
111 3300049742 Ga0501080_0041381 Ga0501080_0041381_1193_1588 121
112 3300049742 Ga0501080_0198304 Ga0501080_0198304_216_611 121
113 3300049744 Ga0501083_0009148 Ga0501083_0009148_2967_3368 121
114 3300049744 Ga0501083_0036922 Ga0501083_0036922_1544_1939 121
115 3300049744 Ga0501083_0041592 Ga0501083_0041592_1756_2151 121
116 3300049822 Ga0501035_0000873 Ga0501035_0000873_2696_3091 121
117 3300049822 Ga0501035_0034885 Ga0501035_0034885_109_504 121
118 3300049823 Ga0501044_0003139 Ga0501044_0003139_2566_2961 121
119 3300049823 Ga0501044_0036180 Ga0501044_0036180_2499_2894 121
120 3300049823 Ga0501044_1143201 Ga0501044_1143201_231_626 121
121 3300049824 Ga0501045_0090325 Ga0501045_0090325_1271_1666 121
122 3300053077 Ga0495601_0008993 Ga0495601_0008993_807_1202 121
123 3300053084 Ga0495595_0000547 Ga0495595_0000547_6335_6730 121
124 3300053092 Ga0500583_0370720 Ga0500583_0370720_46_441 121
125 3300053096 Ga0500641_0003315 Ga0500641_0003315_2388_2783 121
126 3300053098 Ga0500650_0163534 Ga0500650_0163534_359_736 121
127 3300053134 Ga0500658_0221181 Ga0500658_0221181_270_665 121
128 3300053139 Ga0500568_0173437 Ga0500568_0173437_113_508 121
129 3300054114 Ga0501084_1032848 Ga0501084_1032848_13_408 121
130 3300060353 Ga0501082_0023859 Ga0501082_0023859_2342_2737 121
131 3300060353 Ga0501082_0560331 Ga0501082_0560331_399_794 121
132 3300000532 CNAas_1002147 CNAas_10021472 122
133 3300000546 LJNas_1003365 LJNas_10033652 122
134 3300001977 JGI24746J21847_1000366 JGI24746J21847_10003666 122
135 3300001979 JGI24740J21852_10003978 JGI24740J21852_100039784 122
136 3300002074 JGI24748J21848_1006175 JGI24748J21848_10061752 122
137 3300002239 JGI24034J26672_10000425 JGI24034J26672_100004258 122
138 3300002244 JGI24742J22300_10000739 JGI24742J22300_100007397 122
139 3300003659 JGI25404J52841_10004669 JGI25404J52841_100046691 122
140 3300004801 Ga0058860_11509575 Ga0058860_115095751 122
141 3300005327 Ga0070658_10024325 Ga0070658_100243255 122
142 3300005327 Ga0070658_10696522 Ga0070658_106965222 122
143 3300005329 Ga0070683_100001231 Ga0070683_10000123118 122
144 3300005329 Ga0070683_100007506 Ga0070683_1000075062 122
145 3300005329 Ga0070683_100113564 Ga0070683_1001135643 122
146 3300005329 Ga0070683_100256994 Ga0070683_1002569943 122
147 3300005331 Ga0070670_100036432 Ga0070670_1000364325 122
148 3300005333 Ga0070677_10000956 Ga0070677_100009565 122
149 3300005334 Ga0068869_101210464 Ga0068869_1012104642 122
150 3300005335 Ga0070666_10052132 Ga0070666_100521325 122
151 3300005337 Ga0070682_100000023 Ga0070682_100000023220 122
152 3300005337 Ga0070682_100000061 Ga0070682_10000006185 122
153 3300005337 Ga0070682_100621637 Ga0070682_1006216372 122
154 3300005337 Ga0070682_100751612 Ga0070682_1007516121 122
155 3300005338 Ga0068868_100001254 Ga0068868_10000125422 122
156 3300005338 Ga0068868_100688014 Ga0068868_1006880142 122
157 3300005338 Ga0068868_100863852 Ga0068868_1008638521 122
158 3300005340 Ga0070689_100047666 Ga0070689_1000476662 122
159 3300005340 Ga0070689_100050193 Ga0070689_1000501935 122
160 3300005341 Ga0070691_10000004 Ga0070691_1000000482 122
161 3300005341 Ga0070691_10123681 Ga0070691_101236812 122
162 3300005345 Ga0070692_10200319 Ga0070692_102003192 122
163 3300005347 Ga0070668_100020201 Ga0070668_1000202014 122
164 3300005347 Ga0070668_100020238 Ga0070668_1000202382 122
165 3300005347 Ga0070668_100589955 Ga0070668_1005899552 122
166 3300005353 Ga0070669_100040491 Ga0070669_1000404912 122
167 3300005354 Ga0070675_100000091 Ga0070675_10000009137 122
168 3300005356 Ga0070674_101519781 Ga0070674_1015197811 122
169 3300005364 Ga0070673_100016927 Ga0070673_1000169272 122
170 3300005365 Ga0070688_100000077 Ga0070688_10000007713 122
171 3300005365 Ga0070688_100000937 Ga0070688_1000009374 122
172 3300005366 Ga0070659_100005636 Ga0070659_10000563610 122
173 3300005366 Ga0070659_100062491 Ga0070659_1000624913 122
174 3300005367 Ga0070667_100000597 Ga0070667_1000005977 122
175 3300005367 Ga0070667_100409667 Ga0070667_1004096672 122
176 3300005435 Ga0070714_100098756 Ga0070714_1000987564 122
177 3300005436 Ga0070713_100000135 Ga0070713_10000013536 122
178 3300005439 Ga0070711_100005739 Ga0070711_1000057398 122
179 3300005441 Ga0070700_101189465 Ga0070700_1011894652 122
180 3300005456 Ga0070678_100005719 Ga0070678_1000057197 122
181 3300005457 Ga0070662_100000001 Ga0070662_100000001142 122
182 3300005457 Ga0070662_101866939 Ga0070662_1018669391 122
183 3300005458 Ga0070681_10010648 Ga0070681_100106487 122
184 3300005466 Ga0070685_10000061 Ga0070685_1000006117 122
185 3300005466 Ga0070685_10000965 Ga0070685_1000096518 122
186 3300005530 Ga0070679_100000088 Ga0070679_10000008844 122
187 3300005535 Ga0070684_100012176 Ga0070684_1000121765 122
188 3300005535 Ga0070684_100160553 Ga0070684_1001605533 122
189 3300005535 Ga0070684_100180836 Ga0070684_1001808363 122
190 3300005535 Ga0070684_100378015 Ga0070684_1003780152 122
191 3300005539 Ga0068853_100248975 Ga0068853_1002489754 122
192 3300005539 Ga0068853_100910550 Ga0068853_1009105503 122
193 3300005543 Ga0070672_100000005 Ga0070672_10000000589 122
194 3300005547 Ga0070693_100021873 Ga0070693_1000218734 122
195 3300005548 Ga0070665_100000022 Ga0070665_10000002277 122
196 3300005548 Ga0070665_100006490 Ga0070665_1000064904 122
197 3300005548 Ga0070665_100283438 Ga0070665_1002834382 122
198 3300005548 Ga0070665_100326908 Ga0070665_1003269082 122
199 3300005549 Ga0070704_100064390 Ga0070704_1000643902 122
200 3300005564 Ga0070664_100067851 Ga0070664_1000678512 122
201 3300005578 Ga0068854_100000838 Ga0068854_10000083815 122
202 3300005578 Ga0068854_100021831 Ga0068854_1000218313 122
203 3300005614 Ga0068856_100005996 Ga0068856_1000059966 122
204 3300005614 Ga0068856_100095223 Ga0068856_1000952232 122
205 3300005614 Ga0068856_100119729 Ga0068856_1001197295 122
206 3300005614 Ga0068856_100260518 Ga0068856_1002605182 122
207 3300005616 Ga0068852_100000037 Ga0068852_10000003740 122
208 3300005616 Ga0068852_100009794 Ga0068852_1000097944 122
209 3300005718 Ga0068866_10068635 Ga0068866_100686352 122
210 3300005719 Ga0068861_100044604 Ga0068861_1000446043 122
211 3300005834 Ga0068851_10000741 Ga0068851_100007414 122
212 3300005834 Ga0068851_10010572 Ga0068851_100105725 122
213 3300005841 Ga0068863_100004891 Ga0068863_1000048916 122
214 3300005841 Ga0068863_100022537 Ga0068863_1000225377 122
215 3300005842 Ga0068858_100001657 Ga0068858_1000016575 122
216 3300005842 Ga0068858_100120833 Ga0068858_1001208332 122
217 3300005844 Ga0068862_100001558 Ga0068862_10000155823 122
218 3300005983 Ga0081540_1000697 Ga0081540_100069715 122
219 3300005983 Ga0081540_1013456 Ga0081540_10134562 122
220 3300005985 Ga0081539_10016325 Ga0081539_100163256 122
221 3300006038 Ga0075365_10027783 Ga0075365_100277834 122
222 3300006038 Ga0075365_10046083 Ga0075365_100460834 122
223 3300006051 Ga0075364_10126824 Ga0075364_101268242 122
224 3300006051 Ga0075364_10382678 Ga0075364_103826783 122
225 3300006175 Ga0070712_100005477 Ga0070712_1000054777 122
226 3300006237 Ga0097621_100347149 Ga0097621_1003471493 122
227 3300006846 Ga0075430_100071719 Ga0075430_1000717195 122
228 3300006847 Ga0075431_100945956 Ga0075431_1009459562 122
229 3300006852 Ga0075433_10061844 Ga0075433_100618444 122
230 3300006852 Ga0075433_10063177 Ga0075433_100631776 122
231 3300006852 Ga0075433_10979438 Ga0075433_109794382 122
232 3300006871 Ga0075434_100061202 Ga0075434_1000612025 122
233 3300006871 Ga0075434_100121049 Ga0075434_1001210494 122
234 3300006880 Ga0075429_100866153 Ga0075429_1008661532 122
235 3300006881 Ga0068865_100000089 Ga0068865_10000008926 122
236 3300006881 Ga0068865_101369003 Ga0068865_1013690032 122
237 3300007076 Ga0075435_100012085 Ga0075435_1000120853 122
238 3300007076 Ga0075435_100820820 Ga0075435_1008208202 122
239 3300009098 Ga0105245_10000640 Ga0105245_1000064021 122
240 3300009098 Ga0105245_10001641 Ga0105245_100016417 122
241 3300009098 Ga0105245_10002937 Ga0105245_1000293722 122
242 3300009098 Ga0105245_10020753 Ga0105245_100207533 122
243 3300009098 Ga0105245_10714357 Ga0105245_107143572 122
244 3300009101 Ga0105247_10000591 Ga0105247_100005919 122
245 3300009101 Ga0105247_10311573 Ga0105247_103115732 122
246 3300009147 Ga0114129_10003422 Ga0114129_100034223 122
247 3300009148 Ga0105243_10028842 Ga0105243_100288425 122
248 3300009148 Ga0105243_12969963 Ga0105243_129699631 122
249 3300009174 Ga0105241_10831000 Ga0105241_108310002 122
250 3300009176 Ga0105242_10008495 Ga0105242_100084955 122
251 3300009176 Ga0105242_10652420 Ga0105242_106524201 122
252 3300009176 Ga0105242_11634911 Ga0105242_116349112 122
253 3300009177 Ga0105248_10000017 Ga0105248_10000017265 122
254 3300009551 Ga0105238_10000016 Ga0105238_10000016224 122
255 3300009553 Ga0105249_10000368 Ga0105249_100003687 122
256 3300009553 Ga0105249_10001411 Ga0105249_1000141120 122
257 3300009553 Ga0105249_10394142 Ga0105249_103941423 122
258 3300009553 Ga0105249_12092226 Ga0105249_120922262 122
259 3300010375 Ga0105239_10331079 Ga0105239_103310792 122
260 3300010375 Ga0105239_10706075 Ga0105239_107060751 122
261 3300010375 Ga0105239_11293698 Ga0105239_112936982 122
262 3300011119 Ga0105246_11125411 Ga0105246_111254112 122
263 3300012492 Ga0157335_1044529 Ga0157335_10445291 122
264 3300013102 Ga0157371_10021297 Ga0157371_100212972 122
265 3300013104 Ga0157370_10037760 Ga0157370_100377604 122
266 3300013104 Ga0157370_10141451 Ga0157370_101414512 122
267 3300013105 Ga0157369_10000105 Ga0157369_1000010533 122
268 3300013296 Ga0157374_10000785 Ga0157374_1000078510 122
269 3300013296 Ga0157374_10484385 Ga0157374_104843852 122
270 3300013297 Ga0157378_10016184 Ga0157378_100161841 122
271 3300013297 Ga0157378_10121113 Ga0157378_101211133 122
272 3300013297 Ga0157378_10191797 Ga0157378_101917974 122
273 3300013306 Ga0163162_10780520 Ga0163162_107805202 122
274 3300013307 Ga0157372_10001649 Ga0157372_1000164928 122
275 3300013308 Ga0157375_10076554 Ga0157375_100765544 122
276 3300013308 Ga0157375_10488346 Ga0157375_104883462 122
277 3300013308 Ga0157375_13448716 Ga0157375_134487161 122
278 3300014325 Ga0163163_11693332 Ga0163163_116933322 122
279 3300014325 Ga0163163_12046880 Ga0163163_120468802 122
280 3300014325 Ga0163163_12761428 Ga0163163_127614282 122
281 3300014326 Ga0157380_10001737 Ga0157380_1000173715 122
282 3300014326 Ga0157380_10051211 Ga0157380_100512112 122
283 3300014326 Ga0157380_11754446 Ga0157380_117544461 122
284 3300014326 Ga0157380_12881778 Ga0157380_128817781 122
285 3300014968 Ga0157379_10211792 Ga0157379_102117922 122
286 3300014968 Ga0157379_10305209 Ga0157379_103052092 122
287 3300014968 Ga0157379_11360198 Ga0157379_113601982 122
288 3300014969 Ga0157376_10050590 Ga0157376_100505903 122
289 3300017792 Ga0163161_10000064 Ga0163161_1000006452 122
290 3300017792 Ga0163161_10332348 Ga0163161_103323482 122
291 3300020070 Ga0206356_11041816 Ga0206356_110418162 122
292 3300020077 Ga0206351_10147608 Ga0206351_101476082 122
293 3300020078 Ga0206352_10184859 Ga0206352_101848592 122
294 3300022467 Ga0224712_10068679 Ga0224712_100686791 122
295 3300025321 Ga0207656_10001891 Ga0207656_100018914 122
296 3300025321 Ga0207656_10016340 Ga0207656_100163404 122
297 3300025893 Ga0207682_10000041 Ga0207682_100000418 122
298 3300025899 Ga0207642_10030362 Ga0207642_100303624 122
299 3300025900 Ga0207710_10000684 Ga0207710_100006847 122
300 3300025900 Ga0207710_10130282 Ga0207710_101302822 122
301 3300025903 Ga0207680_10002263 Ga0207680_1000226310 122
302 3300025904 Ga0207647_10260908 Ga0207647_102609082 122
303 3300025909 Ga0207705_10037805 Ga0207705_100378055 122
304 3300025911 Ga0207654_10076779 Ga0207654_100767793 122
305 3300025912 Ga0207707_10007315 Ga0207707_100073155 122
306 3300025915 Ga0207693_10001233 Ga0207693_1000123325 122
307 3300025916 Ga0207663_10000399 Ga0207663_100003998 122
308 3300025917 Ga0207660_10228988 Ga0207660_102289882 122
309 3300025920 Ga0207649_10000015 Ga0207649_10000015235 122
310 3300025921 Ga0207652_10000286 Ga0207652_1000028646 122
311 3300025924 Ga0207694_10000012 Ga0207694_10000012198 122
312 3300025925 Ga0207650_10101377 Ga0207650_101013772 122
313 3300025926 Ga0207659_10000147 Ga0207659_1000014726 122
314 3300025927 Ga0207687_10000040 Ga0207687_1000004058 122
315 3300025927 Ga0207687_10000331 Ga0207687_1000033110 122
316 3300025927 Ga0207687_10001806 Ga0207687_100018064 122
317 3300025928 Ga0207700_10000003 Ga0207700_10000003119 122
318 3300025929 Ga0207664_10048306 Ga0207664_100483065 122
319 3300025932 Ga0207690_10004100 Ga0207690_1000410011 122
320 3300025932 Ga0207690_10115305 Ga0207690_101153052 122
321 3300025933 Ga0207706_10000003 Ga0207706_10000003186 122
322 3300025934 Ga0207686_10003997 Ga0207686_100039976 122
323 3300025934 Ga0207686_10068904 Ga0207686_100689042 122
324 3300025934 Ga0207686_10155319 Ga0207686_101553193 122
325 3300025935 Ga0207709_10001985 Ga0207709_1000198514 122
326 3300025936 Ga0207670_10018122 Ga0207670_100181223 122
327 3300025936 Ga0207670_10093989 Ga0207670_100939892 122
328 3300025938 Ga0207704_10000018 Ga0207704_10000018123 122
329 3300025939 Ga0207665_10110437 Ga0207665_101104373 122
330 3300025940 Ga0207691_10000028 Ga0207691_1000002841 122
331 3300025941 Ga0207711_10000011 Ga0207711_10000011312 122
332 3300025942 Ga0207689_10754297 Ga0207689_107542972 122
333 3300025944 Ga0207661_10000714 Ga0207661_1000071418 122
334 3300025944 Ga0207661_10003496 Ga0207661_1000349614 122
335 3300025944 Ga0207661_10022934 Ga0207661_100229345 122
336 3300025944 Ga0207661_10831287 Ga0207661_108312872 122
337 3300025945 Ga0207679_10040523 Ga0207679_100405235 122
338 3300025960 Ga0207651_10002542 Ga0207651_100025423 122
339 3300025961 Ga0207712_10000027 Ga0207712_10000027302 122
340 3300025961 Ga0207712_10002082 Ga0207712_1000208211 122
341 3300025961 Ga0207712_10255024 Ga0207712_102550243 122
342 3300025972 Ga0207668_10008461 Ga0207668_100084613 122
343 3300025972 Ga0207668_10010007 Ga0207668_100100072 122
344 3300025972 Ga0207668_10506628 Ga0207668_105066282 122
345 3300025981 Ga0207640_10000205 Ga0207640_100002059 122
346 3300025981 Ga0207640_10066797 Ga0207640_100667974 122
347 3300025986 Ga0207658_10000465 Ga0207658_100004656 122
348 3300025986 Ga0207658_10335726 Ga0207658_103357262 122
349 3300025986 Ga0207658_10702690 Ga0207658_107026902 122
350 3300026023 Ga0207677_10001420 Ga0207677_100014202 122
351 3300026023 Ga0207677_10009593 Ga0207677_100095935 122
352 3300026035 Ga0207703_10000020 Ga0207703_10000020130 122
353 3300026035 Ga0207703_10738672 Ga0207703_107386722 122
354 3300026041 Ga0207639_10185322 Ga0207639_101853221 122
355 3300026041 Ga0207639_11010971 Ga0207639_110109712 122
356 3300026067 Ga0207678_10363079 Ga0207678_103630793 122
357 3300026075 Ga0207708_10079636 Ga0207708_100796364 122
358 3300026078 Ga0207702_10000690 Ga0207702_1000069024 122
359 3300026078 Ga0207702_10003502 Ga0207702_1000350215 122
360 3300026078 Ga0207702_11103351 Ga0207702_111033512 122
361 3300026088 Ga0207641_10001193 Ga0207641_1000119317 122
362 3300026088 Ga0207641_10002149 Ga0207641_100021498 122
363 3300026116 Ga0207674_10587417 Ga0207674_105874172 122
364 3300026118 Ga0207675_100146155 Ga0207675_1001461552 122
365 3300026121 Ga0207683_10003514 Ga0207683_100035147 122
366 3300026142 Ga0207698_10000015 Ga0207698_10000015162 122
367 3300026142 Ga0207698_10018608 Ga0207698_100186084 122
368 3300028379 Ga0268266_10000029 Ga0268266_10000029373 122
369 3300028379 Ga0268266_10001209 Ga0268266_100012094 122
370 3300028379 Ga0268266_10058212 Ga0268266_100582124 122
371 3300028379 Ga0268266_11324723 Ga0268266_113247231 122
372 3300028380 Ga0268265_10001048 Ga0268265_1000104826 122
373 3300028381 Ga0268264_10064748 Ga0268264_100647482 122
374 3300028381 Ga0268264_10135194 Ga0268264_101351943 122
375 3300028556 Ga0265337_1000061 Ga0265337_100006129 122
376 3300028558 Ga0265326_10000067 Ga0265326_1000006714 122
377 3300028573 Ga0265334_10117279 Ga0265334_101172792 122
378 3300028654 Ga0265322_10000005 Ga0265322_1000000595 122
379 3300028800 Ga0265338_10000051 Ga0265338_100000516 122
380 3300029957 Ga0265324_10000510 Ga0265324_1000051021 122
381 3300029957 Ga0265324_10094406 Ga0265324_100944062 122
382 3300031238 Ga0265332_10131848 Ga0265332_101318482 122
383 3300031239 Ga0265328_10000563 Ga0265328_100005638 122
384 3300031240 Ga0265320_10000010 Ga0265320_10000010141 122
385 3300031241 Ga0265325_10006156 Ga0265325_100061566 122
386 3300031242 Ga0265329_10014727 Ga0265329_100147273 122
387 3300031249 Ga0265339_10051355 Ga0265339_100513552 122
388 3300031250 Ga0265331_10003612 Ga0265331_100036128 122
389 3300031251 Ga0265327_10000040 Ga0265327_10000040165 122
390 3300031344 Ga0265316_10036257 Ga0265316_100362572 122
391 3300031711 Ga0265314_10000208 Ga0265314_1000020875 122
392 3300031727 Ga0316576_10005341 Ga0316576_100053418 122
393 3300031728 Ga0316578_10487678 Ga0316578_104876781 122
394 3300031731 Ga0307405_10650807 Ga0307405_106508072 122
395 3300031733 Ga0316577_10184447 Ga0316577_101844472 122
396 3300032126 Ga0307415_100001546 Ga0307415_1000015469 122
397 3300032133 Ga0316583_10106778 Ga0316583_101067782 122
398 3300035398 Ga0316574_0020645 Ga0316574_0020645_617_1015 122
399 3300035398 Ga0316574_0885993 Ga0316574_0885993_146_514 122
400 3300035724 Ga0373933_0102864 Ga0373933_0102864_278_676 122
401 3300036401 Ga0373937_0312282 Ga0373937_0312282_354_752 122
402 3300036712 Ga0316584_0020165 Ga0316584_0020165_2551_2949 122
403 3300041451 Ga0451791_1304923 Ga0451791_1304923_361_795 122
404 3300041459 Ga0451800_0767792 Ga0451800_0767792_191_589 122
405 3300041463 Ga0451804_1055041 Ga0451804_1055041_73_471 122
406 3300041486 Ga0451807_0854954 Ga0451807_0854954_1260_1658 122
407 3300041486 Ga0451807_2127737 Ga0451807_2127737_739_1137 122
408 3300041486 Ga0451807_2260395 Ga0451807_2260395_333_737 122
409 3300041492 Ga0451835_0033024 Ga0451835_0033024_270_668 122
410 3300041494 Ga0451837_0805574 Ga0451837_0805574_231_665 122
411 3300041505 Ga0451849_0377150 Ga0451849_0377150_544_942 122
412 3300041509 Ga0451843_1693432 Ga0451843_1693432_49_429 122
413 3300041512 Ga0451853_1950518 Ga0451853_1950518_622_1020 122
414 3300041512 Ga0451853_2626091 Ga0451853_2626091_78_476 122
415 3300041512 Ga0451853_3252069 Ga0451853_3252069_421_819 122
416 3300044694 Ga0466963_0002882 Ga0466963_0002882_8557_8955 122
417 3300044694 Ga0466963_0125338 Ga0466963_0125338_227_625 122
418 3300044694 Ga0466963_0197296 Ga0466963_0197296_212_610 122
419 3300044842 Ga0466957_0030890 Ga0466957_0030890_1818_2216 122
420 3300044842 Ga0466957_0184388 Ga0466957_0184388_212_610 122
421 3300045836 Ga0466958_0038088 Ga0466958_0038088_1735_2136 122
422 3300045976 Ga0466967_0000012 Ga0466967_0000012_92994_93392 122
423 3300045976 Ga0466967_0111590 Ga0466967_0111590_553_951 122
424 3300045976 Ga0466967_0243572 Ga0466967_0243572_1086_1484 122
425 3300045976 Ga0466967_0479102 Ga0466967_0479102_251_649 122
426 3300045976 Ga0466967_0995990 Ga0466967_0995990_134_532 122
427 3300046454 Ga0495592_0000423 Ga0495592_0000423_435_833 122
428 3300046454 Ga0495592_0057352 Ga0495592_0057352_161_559 122
429 3300046454 Ga0495592_0801781 Ga0495592_0801781_23_421 122
430 3300046455 Ga0495603_0000194 Ga0495603_0000194_19260_19658 122
431 3300046459 Ga0495629_0000806 Ga0495629_0000806_19070_19468 122
432 3300046459 Ga0495629_0003436 Ga0495629_0003436_7978_8376 122
433 3300046459 Ga0495629_0012055 Ga0495629_0012055_4645_5043 122
434 3300046460 Ga0495638_0048154 Ga0495638_0048154_1813_2211 122
435 3300046461 Ga0495641_0000004 Ga0495641_0000004_134875_135273 122
436 3300046461 Ga0495641_0095674 Ga0495641_0095674_90_494 122
437 3300046462 Ga0495651_0037463 Ga0495651_0037463_1080_1478 122
438 3300046462 Ga0495651_0088358 Ga0495651_0088358_495_893 122
439 3300046462 Ga0495651_0342644 Ga0495651_0342644_407_805 122
440 3300046463 Ga0495653_0052740 Ga0495653_0052740_1324_1722 122
441 3300046463 Ga0495653_0134167 Ga0495653_0134167_525_923 122
442 3300046463 Ga0495653_0189604 Ga0495653_0189604_402_800 122
443 3300046463 Ga0495653_0303676 Ga0495653_0303676_493_891 122
444 3300046463 Ga0495653_0431541 Ga0495653_0431541_339_737 122
445 3300046475 Ga0495639_0041462 Ga0495639_0041462_426_824 122
446 3300046476 Ga0495662_0000051 Ga0495662_0000051_2527_2925 122
447 3300046476 Ga0495662_0005718 Ga0495662_0005718_1408_1806 122
448 3300046477 Ga0495664_0378391 Ga0495664_0378391_388_786 122
449 3300046499 Ga0495594_0000012 Ga0495594_0000012_77155_77553 122
450 3300046507 Ga0495606_0000895 Ga0495606_0000895_37788_38186 122
451 3300046511 Ga0495608_0000013 Ga0495608_0000013_159138_159509 122
452 3300046511 Ga0495608_0000092 Ga0495608_0000092_12868_13266 122
453 3300046511 Ga0495608_0011421 Ga0495608_0011421_4839_5237 122
454 3300046514 Ga0495618_0000094 Ga0495618_0000094_46917_47315 122
455 3300046515 Ga0495620_0001737 Ga0495620_0001737_1097_1495 122
456 3300046516 Ga0495628_0007879 Ga0495628_0007879_2049_2447 122
457 3300046516 Ga0495628_0069581 Ga0495628_0069581_1734_2132 122
458 3300046516 Ga0495628_0134161 Ga0495628_0134161_1041_1442 122
459 3300046517 Ga0495630_0000032 Ga0495630_0000032_16770_17168 122
460 3300046517 Ga0495630_0000519 Ga0495630_0000519_1285_1683 122
461 3300046517 Ga0495630_0001088 Ga0495630_0001088_17327_17725 122
462 3300046517 Ga0495630_0230802 Ga0495630_0230802_343_741 122
463 3300046517 Ga0495630_0245725 Ga0495630_0245725_461_859 122
464 3300046523 Ga0495644_0002998 Ga0495644_0002998_2905_3303 122
465 3300046523 Ga0495644_0154778 Ga0495644_0154778_377_805 122
466 3300046529 Ga0495652_0000018 Ga0495652_0000018_147844_148242 122
467 3300046529 Ga0495652_0001501 Ga0495652_0001501_10248_10658 122
468 3300046529 Ga0495652_0083319 Ga0495652_0083319_546_944 122
469 3300046533 Ga0495640_0006754 Ga0495640_0006754_6189_6587 122
470 3300046533 Ga0495640_0089880 Ga0495640_0089880_15_413 122
471 3300046535 Ga0495586_0001742 Ga0495586_0001742_10807_11205 122
472 3300046536 Ga0495587_0028299 Ga0495587_0028299_1036_1437 122
473 3300046536 Ga0495587_0075141 Ga0495587_0075141_1413_1811 122
474 3300046536 Ga0495587_0093925 Ga0495587_0093925_371_769 122
475 3300046537 Ga0495598_0001408 Ga0495598_0001408_1975_2373 122
476 3300046539 Ga0495621_0001476 Ga0495621_0001476_5235_5633 122
477 3300046543 Ga0495645_0091667 Ga0495645_0091667_949_1359 122
478 3300046543 Ga0495645_0233335 Ga0495645_0233335_537_935 122
479 3300046543 Ga0495645_0441170 Ga0495645_0441170_158_556 122
480 3300046557 Ga0495622_0000353 Ga0495622_0000353_6780_7178 122
481 3300046558 Ga0495633_0103902 Ga0495633_0103902_785_1183 122
482 3300046559 Ga0495667_0000265 Ga0495667_0000265_19732_20130 122
483 3300046642 Ga0495634_0000191 Ga0495634_0000191_12230_12628 122
484 3300046642 Ga0495634_0188219 Ga0495634_0188219_184_582 122
485 3300046660 Ga0495625_0000243 Ga0495625_0000243_16534_16932 122
486 3300046663 Ga0495635_0000182 Ga0495635_0000182_8690_9088 122
487 3300046663 Ga0495635_0107909 Ga0495635_0107909_915_1316 122
488 3300046674 Ga0495588_0000266 Ga0495588_0000266_13728_14126 122
489 3300046675 Ga0495657_0000003 Ga0495657_0000003_210337_210708 122
490 3300046675 Ga0495657_0009610 Ga0495657_0009610_4786_5184 122
491 3300046675 Ga0495657_0325707 Ga0495657_0325707_279_677 122
492 3300046678 Ga0495599_0110208 Ga0495599_0110208_1255_1653 122
493 3300046678 Ga0495599_0270545 Ga0495599_0270545_261_671 122
494 3300046680 Ga0495646_0222613 Ga0495646_0222613_159_557 122
495 3300046681 Ga0495647_0000005 Ga0495647_0000005_38177_38575 122
496 3300046681 Ga0495647_0001427 Ga0495647_0001427_4072_4470 122
497 3300046681 Ga0495647_0011078 Ga0495647_0011078_1139_1537 122
498 3300046683 Ga0495658_0089324 Ga0495658_0089324_88_486 122
499 3300046684 Ga0495669_0000248 Ga0495669_0000248_1520_1918 122
500 3300046684 Ga0495669_0018718 Ga0495669_0018718_2210_2608 122
501 3300046689 Ga0495613_0000173 Ga0495613_0000173_49954_50352 122
502 3300046689 Ga0495613_0000233 Ga0495613_0000233_6140_6538 122
503 3300046689 Ga0495613_0341865 Ga0495613_0341865_497_865 122
504 3300046690 Ga0495624_0000563 Ga0495624_0000563_9707_10105 122
505 3300046690 Ga0495624_0000600 Ga0495624_0000600_12056_12454 122
506 3300046691 Ga0495670_0104819 Ga0495670_0104819_679_1077 122
507 3300046694 Ga0495649_0007268 Ga0495649_0007268_437_835 122
508 3300046809 Ga0495600_0002279 Ga0495600_0002279_1646_2044 122
509 3300046809 Ga0495600_0007184 Ga0495600_0007184_155_559 122
510 3300047315 Ga0495581_0169689 Ga0495581_0169689_599_997 122
511 3300047317 Ga0495604_0000437 Ga0495604_0000437_28065_28463 122
512 3300047317 Ga0495604_0000509 Ga0495604_0000509_29778_30176 122
513 3300047317 Ga0495604_0049629 Ga0495604_0049629_2429_2827 122
514 3300047317 Ga0495604_0101081 Ga0495604_0101081_694_1092 122
515 3300047319 Ga0495674_0000039 Ga0495674_0000039_27064_27462 122
516 3300047320 Ga0495672_0043357 Ga0495672_0043357_1759_2157 122
517 3300047320 Ga0495672_0103231 Ga0495672_0103231_688_1086 122
518 3300047321 Ga0495676_0000320 Ga0495676_0000320_21121_21519 122
519 3300047321 Ga0495676_0009275 Ga0495676_0009275_7368_7766 122
520 3300047321 Ga0495676_0057377 Ga0495676_0057377_2468_2866 122
521 3300047321 Ga0495676_0153025 Ga0495676_0153025_296_694 122
522 3300047321 Ga0495676_0445721 Ga0495676_0445721_173_571 122
523 3300047322 Ga0495680_0000113 Ga0495680_0000113_53144_53542 122
524 3300047322 Ga0495680_0000513 Ga0495680_0000513_10758_11156 122
525 3300047322 Ga0495680_0005366 Ga0495680_0005366_8355_8753 122
526 3300047322 Ga0495680_0047844 Ga0495680_0047844_2451_2849 122
527 3300047322 Ga0495680_0094480 Ga0495680_0094480_1686_2084 122
528 3300047322 Ga0495680_0608104 Ga0495680_0608104_263_661 122
529 3300047322 Ga0495680_0802749 Ga0495680_0802749_163_561 122
530 3300047444 Ga0495675_0000002 Ga0495675_0000002_210337_210708 122
531 3300047446 Ga0495679_015058 Ga0495679_015058_1045_1443 122
532 3300047447 Ga0495685_065761 Ga0495685_065761_473_871 122
533 3300047471 Ga0495684_0755433 Ga0495684_0755433_193_591 122
534 3300047472 Ga0495686_0102809 Ga0495686_0102809_871_1269 122
535 3300047673 Ga0495593_0263367 Ga0495593_0263367_50_448 122
536 3300048088 Ga0495602_0000034 Ga0495602_0000034_24852_25250 122
537 3300048088 Ga0495602_0000315 Ga0495602_0000315_31289_31687 122
538 3300048088 Ga0495602_0102049 Ga0495602_0102049_1267_1665 122
539 3300048088 Ga0495602_0178057 Ga0495602_0178057_618_1016 122
540 3300048088 Ga0495602_0413779 Ga0495602_0413779_535_933 122
541 3300048903 Ga0496100_0000001 Ga0496100_0000001_28308_28706 122
542 3300048903 Ga0496100_0000234 Ga0496100_0000234_6737_7135 122
543 3300048904 Ga0496101_0000028 Ga0496101_0000028_28297_28695 122
544 3300048904 Ga0496101_0000382 Ga0496101_0000382_6737_7135 122
545 3300048905 Ga0496102_0056244 Ga0496102_0056244_1381_1779 122
546 3300048905 Ga0496102_0411497 Ga0496102_0411497_81_482 122
547 3300048905 Ga0496102_0636199 Ga0496102_0636199_179_580 122
548 3300048906 Ga0496103_0227247 Ga0496103_0227247_608_1006 122
549 3300048907 Ga0496104_0000008 Ga0496104_0000008_183708_184106 122
550 3300048907 Ga0496104_0000010 Ga0496104_0000010_278530_278928 122
551 3300048907 Ga0496104_0043010 Ga0496104_0043010_1272_1697 122
552 3300048908 Ga0496105_0000003 Ga0496105_0000003_183708_184106 122
553 3300048908 Ga0496105_0000005 Ga0496105_0000005_278530_278928 122
554 3300048908 Ga0496105_0000051 Ga0496105_0000051_12345_12770 122
555 3300048909 Ga0496106_0000134 Ga0496106_0000134_38367_38765 122
556 3300048909 Ga0496106_0000172 Ga0496106_0000172_28948_29346 122
557 3300048909 Ga0496106_0000455 Ga0496106_0000455_22174_22572 122
558 3300048910 Ga0496107_0000002 Ga0496107_0000002_219782_220180 122
559 3300048910 Ga0496107_0000234 Ga0496107_0000234_6725_7123 122
560 3300048910 Ga0496107_0009773 Ga0496107_0009773_5992_6390 122
561 3300048911 Ga0496108_0000004 Ga0496108_0000004_409631_410029 122
562 3300048911 Ga0496108_0000005 Ga0496108_0000005_498481_498879 122
563 3300048911 Ga0496108_0013089 Ga0496108_0013089_88_486 122
564 3300048911 Ga0496108_0340522 Ga0496108_0340522_730_1128 122
565 3300048912 Ga0496109_0000002 Ga0496109_0000002_36213_36611 122
566 3300048912 Ga0496109_0000011 Ga0496109_0000011_13167_13565 122
567 3300048912 Ga0496109_0000013 Ga0496109_0000013_92072_92470 122
568 3300048912 Ga0496109_0209810 Ga0496109_0209810_679_1080 122
569 3300048912 Ga0496109_0388835 Ga0496109_0388835_256_654 122
570 3300048912 Ga0496109_2022082 Ga0496109_2022082_55_453 122
571 3300048913 Ga0496110_0000185 Ga0496110_0000185_3880_4278 122
572 3300048913 Ga0496110_0001335 Ga0496110_0001335_7876_8274 122
573 3300048913 Ga0496110_0023711 Ga0496110_0023711_2915_3316 122
574 3300048913 Ga0496110_0061760 Ga0496110_0061760_421_819 122
575 3300048913 Ga0496110_0853698 Ga0496110_0853698_71_472 122
576 3300048913 Ga0496110_1081795 Ga0496110_1081795_255_653 122
577 3300048914 Ga0496111_0000103 Ga0496111_0000103_12535_12933 122
578 3300048914 Ga0496111_0312986 Ga0496111_0312986_434_832 122
579 3300048914 Ga0496111_0583240 Ga0496111_0583240_313_711 122
580 3300048914 Ga0496111_0900609 Ga0496111_0900609_14_412 122
581 3300048915 Ga0496112_0000026 Ga0496112_0000026_85649_86047 122
582 3300048915 Ga0496112_0000661 Ga0496112_0000661_10262_10660 122
583 3300048915 Ga0496112_0281563 Ga0496112_0281563_638_1036 122
584 3300048915 Ga0496112_0385140 Ga0496112_0385140_68_469 122
585 3300048915 Ga0496112_1011216 Ga0496112_1011216_166_564 122
586 3300048915 Ga0496112_1198059 Ga0496112_1198059_81_479 122
587 3300048915 Ga0496112_1644325 Ga0496112_1644325_81_479 122
588 3300048916 Ga0496113_0000017 Ga0496113_0000017_70460_70858 122
589 3300048916 Ga0496113_0005910 Ga0496113_0005910_6289_6687 122
590 3300048916 Ga0496113_0093778 Ga0496113_0093778_1418_1816 122
591 3300048916 Ga0496113_0245149 Ga0496113_0245149_488_889 122
592 3300048916 Ga0496113_0592722 Ga0496113_0592722_245_643 122
593 3300048917 Ga0496114_0037828 Ga0496114_0037828_18_416 122
594 3300048918 Ga0496115_0000022 Ga0496115_0000022_125945_126343 122
595 3300048918 Ga0496115_0015665 Ga0496115_0015665_4604_5002 122
596 3300048922 Ga0496119_0015154 Ga0496119_0015154_4394_4792 122
597 3300048923 Ga0496120_0031163 Ga0496120_0031163_1760_2158 122
598 3300048927 Ga0496124_0274072 Ga0496124_0274072_78_476 122
599 3300048928 Ga0496125_0296877 Ga0496125_0296877_204_602 122
600 3300049571 Ga0501034_0002876 Ga0501034_0002876_6005_6403 122
601 3300049571 Ga0501034_0035223 Ga0501034_0035223_1814_2212 122
602 3300049571 Ga0501034_0092678 Ga0501034_0092678_2248_2646 122
603 3300049571 Ga0501034_0176227 Ga0501034_0176227_1406_1804 122
604 3300049571 Ga0501034_0968362 Ga0501034_0968362_216_614 122
605 3300049578 Ga0501042_0014137 Ga0501042_0014137_536_934 122
606 3300049578 Ga0501042_0086233 Ga0501042_0086233_1397_1795 122
607 3300049578 Ga0501042_0308659 Ga0501042_0308659_592_990 122
608 3300049581 Ga0501047_0051756 Ga0501047_0051756_488_886 122
609 3300049583 Ga0501067_0082768 Ga0501067_0082768_916_1314 122
610 3300049584 Ga0501068_0158624 Ga0501068_0158624_860_1258 122
611 3300049584 Ga0501068_0180836 Ga0501068_0180836_596_994 122
612 3300049584 Ga0501068_0242891 Ga0501068_0242891_219_617 122
613 3300049585 Ga0501069_0081767 Ga0501069_0081767_846_1244 122
614 3300049586 Ga0501070_0056882 Ga0501070_0056882_2067_2465 122
615 3300049586 Ga0501070_0171733 Ga0501070_0171733_723_1121 122
616 3300049587 Ga0501071_0520078 Ga0501071_0520078_442_840 122
617 3300049588 Ga0501072_0194070 Ga0501072_0194070_525_923 122
618 3300049588 Ga0501072_0474369 Ga0501072_0474369_445_843 122
619 3300049588 Ga0501072_1396853 Ga0501072_1396853_105_509 122
620 3300049589 Ga0501073_0403410 Ga0501073_0403410_322_720 122
621 3300049590 Ga0501074_0200930 Ga0501074_0200930_651_1049 122
622 3300049591 Ga0501075_0001603 Ga0501075_0001603_11186_11584 122
623 3300049592 Ga0501076_0100114 Ga0501076_0100114_1902_2300 122
624 3300049592 Ga0501076_0852228 Ga0501076_0852228_229_633 122
625 3300049741 Ga0501079_0745431 Ga0501079_0745431_25_405 122
626 3300049742 Ga0501080_0220594 Ga0501080_0220594_453_851 122
627 3300049744 Ga0501083_0572237 Ga0501083_0572237_76_474 122
628 3300049822 Ga0501035_1194400 Ga0501035_1194400_88_486 122
629 3300050491 nmdc:mga00v17_12096_c1 nmdc:mga00v17_12096_c1_180_578 122
630 3300050491 nmdc:mga00v17_68915_c1 nmdc:mga00v17_68915_c1_895_1293 122
631 3300050491 nmdc:mga00v17_85669_c1 nmdc:mga00v17_85669_c1_686_1084 122
632 3300050492 nmdc:mga0yw44_15653_c1 nmdc:mga0yw44_15653_c1_1540_1938 122
633 3300050492 nmdc:mga0yw44_201986_c1 nmdc:mga0yw44_201986_c1_440_838 122
634 3300050507 nmdc:mga05p37_156002_c1 nmdc:mga05p37_156002_c1_1238_1639 122
635 3300050509 nmdc:mga0qj67_20491_c1 nmdc:mga0qj67_20491_c1_2623_3021 122
636 3300050510 nmdc:mga06r32_1489750_c1 nmdc:mga06r32_1489750_c1_116_517 122
637 3300050512 nmdc:mga0n895_106073_c1 nmdc:mga0n895_106073_c1_508_909 122
638 3300050512 nmdc:mga0n895_45699_c1 nmdc:mga0n895_45699_c1_330_731 122
639 3300050515 nmdc:mga0a205_281_c1 nmdc:mga0a205_281_c1_34470_34853 122
640 3300050515 nmdc:mga0a205_45873_c1 nmdc:mga0a205_45873_c1_925_1326 122
641 3300053077 Ga0495601_0000029 Ga0495601_0000029_64617_65015 122
642 3300053077 Ga0495601_0000444 Ga0495601_0000444_15934_16332 122
643 3300053077 Ga0495601_0014716 Ga0495601_0014716_3374_3742 122
644 3300053077 Ga0495601_0101836 Ga0495601_0101836_634_1032 122
645 3300053077 Ga0495601_0390189 Ga0495601_0390189_377_775 122
646 3300053078 Ga0495612_0001200 Ga0495612_0001200_7415_7813 122
647 3300053078 Ga0495612_0004444 Ga0495612_0004444_4080_4478 122
648 3300053078 Ga0495612_0025544 Ga0495612_0025544_313_711 122
649 3300053084 Ga0495595_0000007 Ga0495595_0000007_159161_159532 122
650 3300053084 Ga0495595_0052701 Ga0495595_0052701_825_1223 122
651 3300053085 Ga0495619_0000026 Ga0495619_0000026_13032_13403 122
652 3300053085 Ga0495619_0000067 Ga0495619_0000067_48657_49055 122
653 3300053085 Ga0495619_0000205 Ga0495619_0000205_19846_20244 122
654 3300053085 Ga0495619_0002937 Ga0495619_0002937_4804_5202 122
655 3300053094 Ga0500566_0001360 Ga0500566_0001360_555_953 122
656 3300053123 Ga0500614_000263 Ga0500614_000263_6505_6903 122
657 3300061734 Ga0530510_0669914 Ga0530510_0669914_83_481 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14464

Prok-JAB

Prokaryotic homologs of the JAB domain

18

132

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.9427 11 122
5ld9-assembly1.cif.gz_A structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.9215 11 122
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.9135 1 122
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.9067 1 122
5cw4-assembly1.cif.gz_A structure of cfbrcc36-cfkiaa0157 complex (selenium edge) 0.8315 4 122
ID Description Score Start End Superfamily
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9135 1 122 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9128 1 118 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9067 1 122 3.40.140.10
af_Q54Z40_718_975_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8797 11 111 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8778 1 118 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A1M3BKG2-F1-model_v4 MPN domain-containing protein 0.9938 1 122 GO:0006508
GO:0008235
GO:0008270
AF-A0A1M3BKG2-F1-model_v4 MPN domain-containing protein 0.9857 1 122 GO:0006508
GO:0008235
GO:0008270
AF-A0A532U8W9-F1-model_v4 MPN domain-containing protein 0.9836 1 122 GO:0006508
GO:0008235
GO:0008270
AF-A0A354C0H7-F1-model_v4 MPN domain-containing protein 0.9808 2 122 GO:0006508
GO:0008235
GO:0008270
AF-A0A1W1VZD0-F1-model_v4 Proteasome lid subunit RPN8/RPN11, contains Jab1/MPN metalloenzyme (JAMM) motif 0.9807 2 122 GO:0000502
GO:0006508
GO:0008235
GO:0008270

Feature Viewer

pLDDT pTM Quality
95.31 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map