F473072
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 657 | 328 | 657 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100598028|Ga0070714_1005980281 |
| Length | 145 |
| Sequence | VSERPRGAPSSLAGVKISQQLVDEMVAHAREDVPNECCGMVGGRDGVATKVVRVANSAASPLRYEMDPQGQFDALKEIEADGELLAIYHSHTKSAAYPSQTDVNQAQNWPEPIYVIVSLADSEKPDVQGFHLADLKIADAELEIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 173 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 178 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 188 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 189 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 190 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 191 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 269 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 270 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 271 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 272 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 320 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 322 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 323 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 324 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.93 |
| Metatranscriptomes | 1.07 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.59 |
| Nodule | 0 |
| Rhizoplane | 11.11 |
| Rhizosphere | 81.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1002147 | 3300000532 | Bacteria | 1461 |
| 2 | LJNas_1003365 | 3300000546 | Bacteria | 1842 |
| 3 | JGI24746J21847_1000366 | 3300001977 | Bacteria | 6612 |
| 4 | JGI24740J21852_10003978 | 3300001979 | Bacteria | 6415 |
| 5 | JGI24748J21848_1006175 | 3300002074 | Bacteria | 1395 |
| 6 | JGI24034J26672_10000425 | 3300002239 | Bacteria | 5469 |
| 7 | JGI24742J22300_10000739 | 3300002244 | Bacteria | 4944 |
| 8 | JGI25404J52841_10004669 | 3300003659 | Unclassified | 2792 |
| 9 | Ga0058860_11509575 | 3300004801 | Bacteria | 536 |
| 10 | Ga0070658_10024325 | 3300005327 | Bacteria | 4860 |
| 11 | Ga0070658_10696522 | 3300005327 | Bacteria | 882 |
| 12 | Ga0070683_100001231 | 3300005329 | Bacteria | 19475 |
| 13 | Ga0070683_100007506 | 3300005329 | Bacteria | 9216 |
| 14 | Ga0070683_100113564 | 3300005329 | Bacteria | 2557 |
| 15 | Ga0070683_100256994 | 3300005329 | Bacteria | 1661 |
| 16 | Ga0070670_100036432 | 3300005331 | Bacteria | 4234 |
| 17 | Ga0070677_10000956 | 3300005333 | Bacteria | 9336 |
| 18 | Ga0068869_101210464 | 3300005334 | Bacteria | 664 |
| 19 | Ga0070666_10021581 | 3300005335 | Bacteria | 4174 |
| 20 | Ga0070666_10052132 | 3300005335 | Bacteria | 2757 |
| 21 | Ga0070666_10832117 | 3300005335 | Unclassified | 681 |
| 22 | Ga0070682_100000023 | 3300005337 | Bacteria | 206016 |
| 23 | Ga0070682_100000061 | 3300005337 | Bacteria | 105134 |
| 24 | Ga0070682_100621637 | 3300005337 | Unclassified | 856 |
| 25 | Ga0070682_100751612 | 3300005337 | Bacteria | 787 |
| 26 | Ga0068868_100001254 | 3300005338 | Bacteria | 17445 |
| 27 | Ga0068868_100688014 | 3300005338 | Bacteria | 914 |
| 28 | Ga0068868_100863852 | 3300005338 | Bacteria | 820 |
| 29 | Ga0070689_100047666 | 3300005340 | Bacteria | 3304 |
| 30 | Ga0070689_100050193 | 3300005340 | Bacteria | 3223 |
| 31 | Ga0070691_10000004 | 3300005341 | Bacteria | 80156 |
| 32 | Ga0070691_10123681 | 3300005341 | Bacteria | 1305 |
| 33 | Ga0070692_10200319 | 3300005345 | Bacteria | 1169 |
| 34 | Ga0070668_100020201 | 3300005347 | Bacteria | 5023 |
| 35 | Ga0070668_100020238 | 3300005347 | Bacteria | 5020 |
| 36 | Ga0070668_100589955 | 3300005347 | Bacteria | 971 |
| 37 | Ga0070669_100040491 | 3300005353 | Bacteria | 3387 |
| 38 | Ga0070675_100000091 | 3300005354 | Bacteria | 52149 |
| 39 | Ga0070674_101519781 | 3300005356 | Bacteria | 602 |
| 40 | Ga0070673_100016927 | 3300005364 | Bacteria | 5170 |
| 41 | Ga0070688_100000077 | 3300005365 | Bacteria | 48743 |
| 42 | Ga0070688_100000937 | 3300005365 | Bacteria | 14631 |
| 43 | Ga0070659_100005636 | 3300005366 | Bacteria | 9005 |
| 44 | Ga0070659_100062491 | 3300005366 | Bacteria | 2944 |
| 45 | Ga0070667_100000597 | 3300005367 | Bacteria | 35219 |
| 46 | Ga0070667_100004874 | 3300005367 | Bacteria | 11235 |
| 47 | Ga0070667_100409667 | 3300005367 | Unclassified | 1235 |
| 48 | Ga0070714_100098756 | 3300005435 | Bacteria | 2569 |
| 49 | Ga0070714_100598028 | 3300005435 | Bacteria | 1059 |
| 50 | Ga0070713_100000135 | 3300005436 | Bacteria | 48487 |
| 51 | Ga0070711_100005739 | 3300005439 | Bacteria | 7446 |
| 52 | Ga0070700_101189465 | 3300005441 | Bacteria | 636 |
| 53 | Ga0070663_100000405 | 3300005455 | Bacteria | 22618 |
| 54 | Ga0070678_100005719 | 3300005456 | Bacteria | 7224 |
| 55 | Ga0070662_100000001 | 3300005457 | Bacteria | 317995 |
| 56 | Ga0070662_101866939 | 3300005457 | Unclassified | 519 |
| 57 | Ga0070681_10010648 | 3300005458 | Bacteria | 9088 |
| 58 | Ga0070685_10000061 | 3300005466 | Bacteria | 63408 |
| 59 | Ga0070685_10000965 | 3300005466 | Bacteria | 15453 |
| 60 | Ga0070679_100000088 | 3300005530 | Bacteria | 69314 |
| 61 | Ga0070679_100001611 | 3300005530 | Bacteria | 20284 |
| 62 | Ga0070684_100012176 | 3300005535 | Bacteria | 6880 |
| 63 | Ga0070684_100160553 | 3300005535 | Bacteria | 2039 |
| 64 | Ga0070684_100180836 | 3300005535 | Bacteria | 1917 |
| 65 | Ga0070684_100378015 | 3300005535 | Bacteria | 1304 |
| 66 | Ga0070684_100444529 | 3300005535 | Bacteria | 1198 |
| 67 | Ga0068853_100248975 | 3300005539 | Unclassified | 1630 |
| 68 | Ga0068853_100910550 | 3300005539 | Bacteria | 845 |
| 69 | Ga0070672_100000005 | 3300005543 | Bacteria | 121014 |
| 70 | Ga0070693_100021873 | 3300005547 | Bacteria | 3394 |
| 71 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 72 | Ga0070665_100006490 | 3300005548 | Bacteria | 11899 |
| 73 | Ga0070665_100020404 | 3300005548 | Bacteria | 6656 |
| 74 | Ga0070665_100283438 | 3300005548 | Bacteria | 1659 |
| 75 | Ga0070665_100326908 | 3300005548 | Bacteria | 1538 |
| 76 | Ga0070665_102250261 | 3300005548 | Unclassified | 548 |
| 77 | Ga0070704_100064390 | 3300005549 | Bacteria | 2635 |
| 78 | Ga0070664_100067851 | 3300005564 | Bacteria | 3049 |
| 79 | Ga0068854_100000838 | 3300005578 | Bacteria | 18397 |
| 80 | Ga0068854_100021831 | 3300005578 | Bacteria | 4351 |
| 81 | Ga0068856_100005996 | 3300005614 | Bacteria | 11963 |
| 82 | Ga0068856_100095223 | 3300005614 | Bacteria | 2965 |
| 83 | Ga0068856_100119729 | 3300005614 | Bacteria | 2634 |
| 84 | Ga0068856_100260518 | 3300005614 | Bacteria | 1749 |
| 85 | Ga0068852_100000037 | 3300005616 | Bacteria | 97602 |
| 86 | Ga0068852_100009794 | 3300005616 | Bacteria | 7124 |
| 87 | Ga0068859_100880054 | 3300005617 | Unclassified | 981 |
| 88 | Ga0068866_10068635 | 3300005718 | Bacteria | 1865 |
| 89 | Ga0068861_100044604 | 3300005719 | Bacteria | 3335 |
| 90 | Ga0068851_10000741 | 3300005834 | Bacteria | 13966 |
| 91 | Ga0068851_10010572 | 3300005834 | Bacteria | 4310 |
| 92 | Ga0068863_100004891 | 3300005841 | Bacteria | 13205 |
| 93 | Ga0068863_100022537 | 3300005841 | Bacteria | 6014 |
| 94 | Ga0068858_100001657 | 3300005842 | Bacteria | 22764 |
| 95 | Ga0068858_100120833 | 3300005842 | Bacteria | 2450 |
| 96 | Ga0068862_100001558 | 3300005844 | Bacteria | 20944 |
| 97 | Ga0081455_10004481 | 3300005937 | Bacteria | 15630 |
| 98 | Ga0081455_10232360 | 3300005937 | Bacteria | 1360 |
| 99 | Ga0081540_1000697 | 3300005983 | Bacteria | 31315 |
| 100 | Ga0081540_1013456 | 3300005983 | Bacteria | 5313 |
| 101 | Ga0081539_10016325 | 3300005985 | Bacteria | 5313 |
| 102 | Ga0075365_10027783 | 3300006038 | Bacteria | 3604 |
| 103 | Ga0075365_10046083 | 3300006038 | Bacteria | 2862 |
| 104 | Ga0075364_10126824 | 3300006051 | Bacteria | 1712 |
| 105 | Ga0075364_10382678 | 3300006051 | Bacteria | 960 |
| 106 | Ga0070712_100005477 | 3300006175 | Bacteria | 7860 |
| 107 | Ga0097621_100347149 | 3300006237 | Bacteria | 1319 |
| 108 | Ga0075430_100071719 | 3300006846 | Bacteria | 2905 |
| 109 | Ga0075431_100945956 | 3300006847 | Bacteria | 830 |
| 110 | Ga0075433_10061844 | 3300006852 | Bacteria | 3280 |
| 111 | Ga0075433_10063177 | 3300006852 | Bacteria | 3244 |
| 112 | Ga0075433_10979438 | 3300006852 | Bacteria | 737 |
| 113 | Ga0075434_100061202 | 3300006871 | Bacteria | 3745 |
| 114 | Ga0075434_100121049 | 3300006871 | Bacteria | 2633 |
| 115 | Ga0075429_100866153 | 3300006880 | Unclassified | 791 |
| 116 | Ga0068865_100000089 | 3300006881 | Bacteria | 47955 |
| 117 | Ga0068865_101369003 | 3300006881 | Bacteria | 631 |
| 118 | Ga0097620_100879941 | 3300006931 | Unclassified | 981 |
| 119 | Ga0075435_100012085 | 3300007076 | Bacteria | 6382 |
| 120 | Ga0075435_100820820 | 3300007076 | Bacteria | 810 |
| 121 | Ga0105245_10000640 | 3300009098 | Bacteria | 31823 |
| 122 | Ga0105245_10001641 | 3300009098 | Bacteria | 20352 |
| 123 | Ga0105245_10002937 | 3300009098 | Bacteria | 15306 |
| 124 | Ga0105245_10020753 | 3300009098 | Bacteria | 5758 |
| 125 | Ga0105245_10714357 | 3300009098 | Bacteria | 1036 |
| 126 | Ga0105247_10000591 | 3300009101 | Bacteria | 29455 |
| 127 | Ga0105247_10311573 | 3300009101 | Bacteria | 1095 |
| 128 | Ga0114129_10003422 | 3300009147 | Bacteria | 22311 |
| 129 | Ga0105243_10028842 | 3300009148 | Bacteria | 4264 |
| 130 | Ga0105243_12969963 | 3300009148 | Bacteria | 514 |
| 131 | Ga0105241_10831000 | 3300009174 | Unclassified | 853 |
| 132 | Ga0105242_10008495 | 3300009176 | Bacteria | 7886 |
| 133 | Ga0105242_10652420 | 3300009176 | Bacteria | 1023 |
| 134 | Ga0105242_11634911 | 3300009176 | Unclassified | 679 |
| 135 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 136 | Ga0105237_10448368 | 3300009545 | Bacteria | 1296 |
| 137 | Ga0105238_10000016 | 3300009551 | Bacteria | 236218 |
| 138 | Ga0105238_10063863 | 3300009551 | Bacteria | 3683 |
| 139 | Ga0105249_10000368 | 3300009553 | Bacteria | 44712 |
| 140 | Ga0105249_10001411 | 3300009553 | Bacteria | 21021 |
| 141 | Ga0105249_10394142 | 3300009553 | Bacteria | 1413 |
| 142 | Ga0105249_12092226 | 3300009553 | Bacteria | 639 |
| 143 | Ga0105239_10331079 | 3300010375 | Bacteria | 1718 |
| 144 | Ga0105239_10358790 | 3300010375 | Bacteria | 1646 |
| 145 | Ga0105239_10706075 | 3300010375 | Unclassified | 1153 |
| 146 | Ga0105239_11293698 | 3300010375 | Bacteria | 841 |
| 147 | Ga0105239_13655608 | 3300010375 | Bacteria | 500 |
| 148 | Ga0105246_11125411 | 3300011119 | Unclassified | 718 |
| 149 | Ga0157335_1044529 | 3300012492 | Bacteria | 511 |
| 150 | Ga0157371_10021297 | 3300013102 | Bacteria | 4761 |
| 151 | Ga0157370_10037760 | 3300013104 | Bacteria | 4678 |
| 152 | Ga0157370_10141451 | 3300013104 | Bacteria | 2242 |
| 153 | Ga0157369_10000105 | 3300013105 | Bacteria | 117996 |
| 154 | Ga0157369_12188578 | 3300013105 | Unclassified | 561 |
| 155 | Ga0157374_10000785 | 3300013296 | Bacteria | 27837 |
| 156 | Ga0157374_10484385 | 3300013296 | Bacteria | 1240 |
| 157 | Ga0157374_12142974 | 3300013296 | Bacteria | 586 |
| 158 | Ga0157378_10016184 | 3300013297 | Bacteria | 6532 |
| 159 | Ga0157378_10121113 | 3300013297 | Bacteria | 2412 |
| 160 | Ga0157378_10191797 | 3300013297 | Bacteria | 1928 |
| 161 | Ga0163162_10780520 | 3300013306 | Bacteria | 1074 |
| 162 | Ga0157372_10001649 | 3300013307 | Bacteria | 24237 |
| 163 | Ga0157375_10076554 | 3300013308 | Unclassified | 3373 |
| 164 | Ga0157375_10488346 | 3300013308 | Unclassified | 1396 |
| 165 | Ga0157375_13448716 | 3300013308 | Unclassified | 526 |
| 166 | Ga0163163_11693332 | 3300014325 | Bacteria | 693 |
| 167 | Ga0163163_12046880 | 3300014325 | Bacteria | 632 |
| 168 | Ga0163163_12761428 | 3300014325 | Unclassified | 548 |
| 169 | Ga0157380_10001737 | 3300014326 | Bacteria | 14372 |
| 170 | Ga0157380_10051211 | 3300014326 | Bacteria | 3265 |
| 171 | Ga0157380_11754446 | 3300014326 | Bacteria | 679 |
| 172 | Ga0157380_12881778 | 3300014326 | Bacteria | 547 |
| 173 | Ga0157379_10211792 | 3300014968 | Bacteria | 1754 |
| 174 | Ga0157379_10305209 | 3300014968 | Bacteria | 1451 |
| 175 | Ga0157379_11360198 | 3300014968 | Unclassified | 687 |
| 176 | Ga0157379_12285552 | 3300014968 | Bacteria | 538 |
| 177 | Ga0157376_10050590 | 3300014969 | Bacteria | 3448 |
| 178 | Ga0163161_10000064 | 3300017792 | Bacteria | 108508 |
| 179 | Ga0163161_10332348 | 3300017792 | Unclassified | 1204 |
| 180 | Ga0206356_11041816 | 3300020070 | Bacteria | 1459 |
| 181 | Ga0206351_10147608 | 3300020077 | Bacteria | 736 |
| 182 | Ga0206352_10184859 | 3300020078 | Bacteria | 1577 |
| 183 | Ga0206350_11448283 | 3300020080 | Unclassified | 595 |
| 184 | Ga0154015_1384123 | 3300020610 | Bacteria | 3712 |
| 185 | Ga0224712_10068679 | 3300022467 | Bacteria | 1433 |
| 186 | Ga0207656_10001891 | 3300025321 | Bacteria | 6967 |
| 187 | Ga0207656_10016340 | 3300025321 | Bacteria | 2889 |
| 188 | Ga0207682_10000041 | 3300025893 | Bacteria | 52338 |
| 189 | Ga0207642_10030362 | 3300025899 | Bacteria | 2250 |
| 190 | Ga0207710_10000684 | 3300025900 | Bacteria | 19039 |
| 191 | Ga0207710_10130282 | 3300025900 | Bacteria | 1207 |
| 192 | Ga0207680_10002263 | 3300025903 | Bacteria | 8980 |
| 193 | Ga0207680_10017281 | 3300025903 | Unclassified | 3808 |
| 194 | Ga0207647_10260908 | 3300025904 | Bacteria | 992 |
| 195 | Ga0207705_10037805 | 3300025909 | Bacteria | 3454 |
| 196 | Ga0207654_10076779 | 3300025911 | Bacteria | 2000 |
| 197 | Ga0207707_10007315 | 3300025912 | Bacteria | 9615 |
| 198 | Ga0207671_10566576 | 3300025914 | Bacteria | 906 |
| 199 | Ga0207693_10001233 | 3300025915 | Bacteria | 22785 |
| 200 | Ga0207663_10000399 | 3300025916 | Bacteria | 18806 |
| 201 | Ga0207660_10228988 | 3300025917 | Bacteria | 1461 |
| 202 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 203 | Ga0207652_10000286 | 3300025921 | Bacteria | 52725 |
| 204 | Ga0207652_10001116 | 3300025921 | Bacteria | 24218 |
| 205 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 206 | Ga0207650_10101377 | 3300025925 | Bacteria | 2216 |
| 207 | Ga0207659_10000147 | 3300025926 | Bacteria | 41347 |
| 208 | Ga0207687_10000040 | 3300025927 | Bacteria | 113598 |
| 209 | Ga0207687_10000331 | 3300025927 | Bacteria | 31810 |
| 210 | Ga0207687_10001806 | 3300025927 | Bacteria | 14723 |
| 211 | Ga0207687_10049609 | 3300025927 | Bacteria | 2919 |
| 212 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 213 | Ga0207664_10048306 | 3300025929 | Bacteria | 3346 |
| 214 | Ga0207644_10398174 | 3300025931 | Bacteria | 1125 |
| 215 | Ga0207690_10004100 | 3300025932 | Bacteria | 8604 |
| 216 | Ga0207690_10115305 | 3300025932 | Bacteria | 1941 |
| 217 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 218 | Ga0207686_10003997 | 3300025934 | Bacteria | 7914 |
| 219 | Ga0207686_10068904 | 3300025934 | Bacteria | 2268 |
| 220 | Ga0207686_10155319 | 3300025934 | Bacteria | 1598 |
| 221 | Ga0207709_10001985 | 3300025935 | Bacteria | 13342 |
| 222 | Ga0207670_10018122 | 3300025936 | Bacteria | 4272 |
| 223 | Ga0207670_10093989 | 3300025936 | Bacteria | 2126 |
| 224 | Ga0207704_10000018 | 3300025938 | Bacteria | 153994 |
| 225 | Ga0207665_10110437 | 3300025939 | Bacteria | 1931 |
| 226 | Ga0207691_10000028 | 3300025940 | Bacteria | 121090 |
| 227 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 228 | Ga0207689_10354773 | 3300025942 | Bacteria | 1219 |
| 229 | Ga0207689_10754297 | 3300025942 | Bacteria | 821 |
| 230 | Ga0207661_10000714 | 3300025944 | Bacteria | 21578 |
| 231 | Ga0207661_10003496 | 3300025944 | Bacteria | 10911 |
| 232 | Ga0207661_10022934 | 3300025944 | Bacteria | 4709 |
| 233 | Ga0207661_10032745 | 3300025944 | Bacteria | 4031 |
| 234 | Ga0207661_10831287 | 3300025944 | Bacteria | 850 |
| 235 | Ga0207679_10040523 | 3300025945 | Bacteria | 3335 |
| 236 | Ga0207651_10002542 | 3300025960 | Bacteria | 8713 |
| 237 | Ga0207712_10000027 | 3300025961 | Bacteria | 263739 |
| 238 | Ga0207712_10002082 | 3300025961 | Bacteria | 13106 |
| 239 | Ga0207712_10255024 | 3300025961 | Bacteria | 1420 |
| 240 | Ga0207712_11113832 | 3300025961 | Bacteria | 703 |
| 241 | Ga0207668_10008461 | 3300025972 | Bacteria | 6134 |
| 242 | Ga0207668_10010007 | 3300025972 | Bacteria | 5708 |
| 243 | Ga0207668_10506628 | 3300025972 | Bacteria | 1039 |
| 244 | Ga0207640_10000205 | 3300025981 | Bacteria | 41887 |
| 245 | Ga0207640_10066797 | 3300025981 | Bacteria | 2404 |
| 246 | Ga0207658_10000465 | 3300025986 | Bacteria | 37863 |
| 247 | Ga0207658_10005807 | 3300025986 | Bacteria | 8450 |
| 248 | Ga0207658_10335726 | 3300025986 | Unclassified | 1312 |
| 249 | Ga0207658_10459259 | 3300025986 | Bacteria | 1129 |
| 250 | Ga0207658_10702690 | 3300025986 | Unclassified | 914 |
| 251 | Ga0207677_10001420 | 3300026023 | Bacteria | 12761 |
| 252 | Ga0207677_10009593 | 3300026023 | Bacteria | 5448 |
| 253 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 254 | Ga0207703_10738672 | 3300026035 | Bacteria | 937 |
| 255 | Ga0207639_10185322 | 3300026041 | Unclassified | 1774 |
| 256 | Ga0207639_11010971 | 3300026041 | Bacteria | 779 |
| 257 | Ga0207678_10001534 | 3300026067 | Bacteria | 21208 |
| 258 | Ga0207678_10363079 | 3300026067 | Bacteria | 1250 |
| 259 | Ga0207708_10079636 | 3300026075 | Bacteria | 2517 |
| 260 | Ga0207702_10000690 | 3300026078 | Bacteria | 36486 |
| 261 | Ga0207702_10003502 | 3300026078 | Bacteria | 14309 |
| 262 | Ga0207702_11103351 | 3300026078 | Bacteria | 787 |
| 263 | Ga0207641_10001193 | 3300026088 | Bacteria | 26064 |
| 264 | Ga0207641_10002149 | 3300026088 | Bacteria | 18577 |
| 265 | Ga0207674_10587417 | 3300026116 | Unclassified | 1076 |
| 266 | Ga0207675_100146155 | 3300026118 | Bacteria | 2248 |
| 267 | Ga0207683_10003514 | 3300026121 | Bacteria | 13672 |
| 268 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 269 | Ga0207698_10018608 | 3300026142 | Bacteria | 4739 |
| 270 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 271 | Ga0268266_10001209 | 3300028379 | Bacteria | 31846 |
| 272 | Ga0268266_10002632 | 3300028379 | Bacteria | 18955 |
| 273 | Ga0268266_10058212 | 3300028379 | Bacteria | 3327 |
| 274 | Ga0268266_11324723 | 3300028379 | Bacteria | 695 |
| 275 | Ga0268265_10001048 | 3300028380 | Bacteria | 24851 |
| 276 | Ga0268264_10064748 | 3300028381 | Bacteria | 3077 |
| 277 | Ga0268264_10135194 | 3300028381 | Bacteria | 2191 |
| 278 | Ga0265337_1000061 | 3300028556 | Bacteria | 49480 |
| 279 | Ga0265326_10000067 | 3300028558 | Bacteria | 59507 |
| 280 | Ga0265334_10117279 | 3300028573 | Bacteria | 953 |
| 281 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 282 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 283 | Ga0265324_10000510 | 3300029957 | Bacteria | 26678 |
| 284 | Ga0265324_10094406 | 3300029957 | Bacteria | 1017 |
| 285 | Ga0265332_10131848 | 3300031238 | Bacteria | 1048 |
| 286 | Ga0265328_10000563 | 3300031239 | Bacteria | 17200 |
| 287 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 288 | Ga0265325_10006156 | 3300031241 | Bacteria | 7321 |
| 289 | Ga0265329_10014727 | 3300031242 | Bacteria | 2753 |
| 290 | Ga0265339_10051355 | 3300031249 | Bacteria | 2250 |
| 291 | Ga0265331_10003612 | 3300031250 | Bacteria | 9895 |
| 292 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 293 | Ga0265316_10036257 | 3300031344 | Bacteria | 3988 |
| 294 | Ga0265314_10000208 | 3300031711 | Bacteria | 86855 |
| 295 | Ga0316576_10005341 | 3300031727 | Bacteria | 7832 |
| 296 | Ga0316578_10487678 | 3300031728 | Bacteria | 727 |
| 297 | Ga0307405_10650807 | 3300031731 | Bacteria | 867 |
| 298 | Ga0316577_10184447 | 3300031733 | Bacteria | 1179 |
| 299 | Ga0307415_100001546 | 3300032126 | Bacteria | 11063 |
| 300 | Ga0316583_10106778 | 3300032133 | Bacteria | 976 |
| 301 | Ga0316574_0020645 | 3300035398 | Bacteria | 3901 |
| 302 | Ga0316574_0885993 | 3300035398 | Bacteria | 540 |
| 303 | Ga0373933_0102864 | 3300035724 | Bacteria | 1774 |
| 304 | Ga0373937_0143413 | 3300036401 | Bacteria | 2235 |
| 305 | Ga0373937_0312282 | 3300036401 | Bacteria | 1487 |
| 306 | Ga0316584_0020165 | 3300036712 | Bacteria | 4829 |
| 307 | Ga0451791_1304923 | 3300041451 | Bacteria | 834 |
| 308 | Ga0451795_1439009 | 3300041456 | Bacteria | 551 |
| 309 | Ga0451800_0767792 | 3300041459 | Unclassified | 792 |
| 310 | Ga0451804_1055041 | 3300041463 | Bacteria | 504 |
| 311 | Ga0451807_0854954 | 3300041486 | Bacteria | 1709 |
| 312 | Ga0451807_2127737 | 3300041486 | Bacteria | 1189 |
| 313 | Ga0451807_2260395 | 3300041486 | Unclassified | 1040 |
| 314 | Ga0451835_0033024 | 3300041492 | Bacteria | 693 |
| 315 | Ga0451837_0805574 | 3300041494 | Unclassified | 892 |
| 316 | Ga0451849_0377150 | 3300041505 | Bacteria | 1019 |
| 317 | Ga0451843_1693432 | 3300041509 | Bacteria | 753 |
| 318 | Ga0451853_1950518 | 3300041512 | Bacteria | 1342 |
| 319 | Ga0451853_2626091 | 3300041512 | Bacteria | 596 |
| 320 | Ga0451853_3252069 | 3300041512 | Bacteria | 1270 |
| 321 | Ga0466963_0002882 | 3300044694 | Bacteria | 9719 |
| 322 | Ga0466963_0125338 | 3300044694 | Bacteria | 1770 |
| 323 | Ga0466963_0197296 | 3300044694 | Bacteria | 1407 |
| 324 | Ga0466957_0030890 | 3300044842 | Bacteria | 3199 |
| 325 | Ga0466957_0184388 | 3300044842 | Bacteria | 1364 |
| 326 | Ga0466958_0038088 | 3300045836 | Bacteria | 2884 |
| 327 | Ga0466967_0000012 | 3300045976 | Bacteria | 104270 |
| 328 | Ga0466967_0111590 | 3300045976 | Bacteria | 2513 |
| 329 | Ga0466967_0243572 | 3300045976 | Bacteria | 1716 |
| 330 | Ga0466967_0479102 | 3300045976 | Bacteria | 1219 |
| 331 | Ga0466967_0995990 | 3300045976 | Unclassified | 834 |
| 332 | Ga0495592_0000423 | 3300046454 | Bacteria | 32094 |
| 333 | Ga0495592_0057352 | 3300046454 | Bacteria | 2875 |
| 334 | Ga0495592_0801781 | 3300046454 | Unclassified | 559 |
| 335 | Ga0495603_0000194 | 3300046455 | Bacteria | 31819 |
| 336 | Ga0495629_0000806 | 3300046459 | Bacteria | 25376 |
| 337 | Ga0495629_0003436 | 3300046459 | Bacteria | 11976 |
| 338 | Ga0495629_0012055 | 3300046459 | Bacteria | 6266 |
| 339 | Ga0495638_0048154 | 3300046460 | Bacteria | 2669 |
| 340 | Ga0495641_0000004 | 3300046461 | Bacteria | 210501 |
| 341 | Ga0495641_0025585 | 3300046461 | Bacteria | 2896 |
| 342 | Ga0495641_0095674 | 3300046461 | Bacteria | 1326 |
| 343 | Ga0495651_0037463 | 3300046462 | Bacteria | 3775 |
| 344 | Ga0495651_0088358 | 3300046462 | Unclassified | 2329 |
| 345 | Ga0495651_0342644 | 3300046462 | Bacteria | 990 |
| 346 | Ga0495653_0052740 | 3300046463 | Bacteria | 3116 |
| 347 | Ga0495653_0088263 | 3300046463 | Bacteria | 2275 |
| 348 | Ga0495653_0134167 | 3300046463 | Bacteria | 1748 |
| 349 | Ga0495653_0189604 | 3300046463 | Bacteria | 1404 |
| 350 | Ga0495653_0303676 | 3300046463 | Bacteria | 1040 |
| 351 | Ga0495653_0431541 | 3300046463 | Bacteria | 832 |
| 352 | Ga0495639_0041462 | 3300046475 | Bacteria | 2073 |
| 353 | Ga0495662_0000051 | 3300046476 | Bacteria | 40340 |
| 354 | Ga0495662_0005718 | 3300046476 | Bacteria | 6217 |
| 355 | Ga0495664_0378391 | 3300046477 | Bacteria | 851 |
| 356 | Ga0495594_0000012 | 3300046499 | Bacteria | 105133 |
| 357 | Ga0495606_0000895 | 3300046507 | Bacteria | 44393 |
| 358 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 359 | Ga0495608_0000092 | 3300046511 | Bacteria | 64795 |
| 360 | Ga0495608_0011421 | 3300046511 | Bacteria | 6182 |
| 361 | Ga0495618_0000094 | 3300046514 | Bacteria | 64293 |
| 362 | Ga0495620_0001737 | 3300046515 | Bacteria | 12862 |
| 363 | Ga0495628_0007879 | 3300046516 | Bacteria | 9179 |
| 364 | Ga0495628_0069581 | 3300046516 | Unclassified | 2745 |
| 365 | Ga0495628_0134161 | 3300046516 | Bacteria | 1893 |
| 366 | Ga0495630_0000032 | 3300046517 | Bacteria | 134425 |
| 367 | Ga0495630_0000519 | 3300046517 | Bacteria | 28420 |
| 368 | Ga0495630_0001088 | 3300046517 | Bacteria | 18687 |
| 369 | Ga0495630_0230802 | 3300046517 | Bacteria | 1414 |
| 370 | Ga0495630_0245725 | 3300046517 | Bacteria | 1367 |
| 371 | Ga0495644_0002998 | 3300046523 | Bacteria | 6691 |
| 372 | Ga0495644_0154778 | 3300046523 | Bacteria | 878 |
| 373 | Ga0495652_0000018 | 3300046529 | Bacteria | 201634 |
| 374 | Ga0495652_0001501 | 3300046529 | Bacteria | 25686 |
| 375 | Ga0495652_0083319 | 3300046529 | Unclassified | 2633 |
| 376 | Ga0495652_0172158 | 3300046529 | Bacteria | 1670 |
| 377 | Ga0495640_0006754 | 3300046533 | Bacteria | 9054 |
| 378 | Ga0495640_0089880 | 3300046533 | Unclassified | 2028 |
| 379 | Ga0495586_0001742 | 3300046535 | Bacteria | 11874 |
| 380 | Ga0495587_0028299 | 3300046536 | Bacteria | 3408 |
| 381 | Ga0495587_0075141 | 3300046536 | Bacteria | 1962 |
| 382 | Ga0495587_0093925 | 3300046536 | Bacteria | 1732 |
| 383 | Ga0495598_0001408 | 3300046537 | Bacteria | 4757 |
| 384 | Ga0495621_0001476 | 3300046539 | Bacteria | 6101 |
| 385 | Ga0495645_0091667 | 3300046543 | Unclassified | 2170 |
| 386 | Ga0495645_0233335 | 3300046543 | Bacteria | 1231 |
| 387 | Ga0495645_0441170 | 3300046543 | Bacteria | 823 |
| 388 | Ga0495622_0000353 | 3300046557 | Bacteria | 32367 |
| 389 | Ga0495633_0103902 | 3300046558 | Bacteria | 1318 |
| 390 | Ga0495667_0000265 | 3300046559 | Bacteria | 34047 |
| 391 | Ga0495634_0000191 | 3300046642 | Bacteria | 56356 |
| 392 | Ga0495634_0188219 | 3300046642 | Bacteria | 1289 |
| 393 | Ga0495625_0000243 | 3300046660 | Bacteria | 85589 |
| 394 | Ga0495625_0439668 | 3300046660 | Bacteria | 808 |
| 395 | Ga0495635_0000182 | 3300046663 | Bacteria | 39469 |
| 396 | Ga0495635_0107909 | 3300046663 | Bacteria | 1902 |
| 397 | Ga0495588_0000266 | 3300046674 | Bacteria | 40474 |
| 398 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 399 | Ga0495657_0009610 | 3300046675 | Bacteria | 7324 |
| 400 | Ga0495657_0325707 | 3300046675 | Bacteria | 912 |
| 401 | Ga0495599_0110208 | 3300046678 | Bacteria | 1715 |
| 402 | Ga0495599_0270545 | 3300046678 | Bacteria | 1031 |
| 403 | Ga0495646_0222613 | 3300046680 | Bacteria | 1020 |
| 404 | Ga0495647_0000005 | 3300046681 | Bacteria | 125996 |
| 405 | Ga0495647_0001427 | 3300046681 | Bacteria | 7390 |
| 406 | Ga0495647_0011078 | 3300046681 | Bacteria | 3082 |
| 407 | Ga0495658_0089324 | 3300046683 | Bacteria | 1823 |
| 408 | Ga0495669_0000248 | 3300046684 | Bacteria | 31659 |
| 409 | Ga0495669_0018718 | 3300046684 | Bacteria | 2980 |
| 410 | Ga0495613_0000173 | 3300046689 | Bacteria | 62463 |
| 411 | Ga0495613_0000233 | 3300046689 | Bacteria | 53074 |
| 412 | Ga0495613_0341865 | 3300046689 | Bacteria | 1029 |
| 413 | Ga0495624_0000563 | 3300046690 | Bacteria | 29131 |
| 414 | Ga0495624_0000600 | 3300046690 | Bacteria | 28092 |
| 415 | Ga0495670_0104819 | 3300046691 | Bacteria | 1459 |
| 416 | Ga0495649_0007268 | 3300046694 | Bacteria | 6776 |
| 417 | Ga0495600_0002279 | 3300046809 | Bacteria | 10937 |
| 418 | Ga0495600_0007184 | 3300046809 | Bacteria | 6801 |
| 419 | Ga0495581_0169689 | 3300047315 | Bacteria | 1276 |
| 420 | Ga0495604_0000437 | 3300047317 | Bacteria | 37081 |
| 421 | Ga0495604_0000509 | 3300047317 | Bacteria | 34149 |
| 422 | Ga0495604_0049629 | 3300047317 | Bacteria | 3259 |
| 423 | Ga0495604_0101081 | 3300047317 | Bacteria | 2118 |
| 424 | Ga0495674_0000039 | 3300047319 | Bacteria | 97645 |
| 425 | Ga0495672_0043357 | 3300047320 | Unclassified | 2706 |
| 426 | Ga0495672_0103231 | 3300047320 | Bacteria | 1542 |
| 427 | Ga0495676_0000320 | 3300047321 | Bacteria | 38969 |
| 428 | Ga0495676_0009275 | 3300047321 | Bacteria | 8964 |
| 429 | Ga0495676_0057377 | 3300047321 | Bacteria | 3072 |
| 430 | Ga0495676_0153025 | 3300047321 | Bacteria | 1639 |
| 431 | Ga0495676_0445721 | 3300047321 | Bacteria | 854 |
| 432 | Ga0495680_0000113 | 3300047322 | Bacteria | 76525 |
| 433 | Ga0495680_0000513 | 3300047322 | Bacteria | 43869 |
| 434 | Ga0495680_0005366 | 3300047322 | Bacteria | 12092 |
| 435 | Ga0495680_0047844 | 3300047322 | Bacteria | 3361 |
| 436 | Ga0495680_0094480 | 3300047322 | Bacteria | 2237 |
| 437 | Ga0495680_0608104 | 3300047322 | Bacteria | 731 |
| 438 | Ga0495680_0802749 | 3300047322 | Bacteria | 614 |
| 439 | Ga0495675_0000002 | 3300047444 | Bacteria | 216469 |
| 440 | Ga0495675_0123958 | 3300047444 | Bacteria | 1608 |
| 441 | Ga0495679_015058 | 3300047446 | Bacteria | 2840 |
| 442 | Ga0495685_065761 | 3300047447 | Bacteria | 1219 |
| 443 | Ga0495684_0755433 | 3300047471 | Unclassified | 639 |
| 444 | Ga0495686_0009817 | 3300047472 | Bacteria | 6867 |
| 445 | Ga0495686_0018236 | 3300047472 | Bacteria | 4714 |
| 446 | Ga0495686_0102809 | 3300047472 | Unclassified | 1721 |
| 447 | Ga0495686_0590810 | 3300047472 | Unclassified | 576 |
| 448 | Ga0495593_0263367 | 3300047673 | Bacteria | 863 |
| 449 | Ga0495602_0000034 | 3300048088 | Bacteria | 140722 |
| 450 | Ga0495602_0000315 | 3300048088 | Bacteria | 44563 |
| 451 | Ga0495602_0102049 | 3300048088 | Bacteria | 2352 |
| 452 | Ga0495602_0178057 | 3300048088 | Unclassified | 1643 |
| 453 | Ga0495602_0413779 | 3300048088 | Bacteria | 959 |
| 454 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 455 | Ga0496100_0000234 | 3300048903 | Bacteria | 29327 |
| 456 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 457 | Ga0496101_0000382 | 3300048904 | Bacteria | 29327 |
| 458 | Ga0496102_0056244 | 3300048905 | Bacteria | 3588 |
| 459 | Ga0496102_0256229 | 3300048905 | Bacteria | 1649 |
| 460 | Ga0496102_0411497 | 3300048905 | Bacteria | 1271 |
| 461 | Ga0496102_0636199 | 3300048905 | Bacteria | 990 |
| 462 | Ga0496103_0026396 | 3300048906 | Bacteria | 3516 |
| 463 | Ga0496103_0227247 | 3300048906 | Bacteria | 1200 |
| 464 | Ga0496103_0603262 | 3300048906 | Unclassified | 699 |
| 465 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 466 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 467 | Ga0496104_0043010 | 3300048907 | Bacteria | 4241 |
| 468 | Ga0496104_0075362 | 3300048907 | Bacteria | 3212 |
| 469 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 470 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 471 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 472 | Ga0496105_0014512 | 3300048908 | Bacteria | 6271 |
| 473 | Ga0496106_0000134 | 3300048909 | Bacteria | 55531 |
| 474 | Ga0496106_0000172 | 3300048909 | Bacteria | 47232 |
| 475 | Ga0496106_0000455 | 3300048909 | Bacteria | 29281 |
| 476 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 477 | Ga0496107_0000234 | 3300048910 | Bacteria | 29310 |
| 478 | Ga0496107_0009773 | 3300048910 | Bacteria | 6654 |
| 479 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 480 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 481 | Ga0496108_0013089 | 3300048911 | Bacteria | 6761 |
| 482 | Ga0496108_0340522 | 3300048911 | Bacteria | 1308 |
| 483 | Ga0496108_0342103 | 3300048911 | Unclassified | 1305 |
| 484 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 485 | Ga0496109_0000011 | 3300048912 | Bacteria | 234908 |
| 486 | Ga0496109_0000013 | 3300048912 | Bacteria | 227469 |
| 487 | Ga0496109_0209810 | 3300048912 | Bacteria | 1832 |
| 488 | Ga0496109_0388835 | 3300048912 | Bacteria | 1318 |
| 489 | Ga0496109_1096187 | 3300048912 | Bacteria | 733 |
| 490 | Ga0496109_2022082 | 3300048912 | Bacteria | 508 |
| 491 | Ga0496110_0000185 | 3300048913 | Bacteria | 39094 |
| 492 | Ga0496110_0001335 | 3300048913 | Bacteria | 17714 |
| 493 | Ga0496110_0023711 | 3300048913 | Bacteria | 5221 |
| 494 | Ga0496110_0061760 | 3300048913 | Bacteria | 3308 |
| 495 | Ga0496110_0853698 | 3300048913 | Bacteria | 816 |
| 496 | Ga0496110_1081795 | 3300048913 | Bacteria | 710 |
| 497 | Ga0496111_0000103 | 3300048914 | Bacteria | 36804 |
| 498 | Ga0496111_0312986 | 3300048914 | Bacteria | 1163 |
| 499 | Ga0496111_0376921 | 3300048914 | Bacteria | 1049 |
| 500 | Ga0496111_0583240 | 3300048914 | Bacteria | 819 |
| 501 | Ga0496111_0900609 | 3300048914 | Unclassified | 637 |
| 502 | Ga0496112_0000026 | 3300048915 | Bacteria | 144758 |
| 503 | Ga0496112_0000661 | 3300048915 | Bacteria | 23981 |
| 504 | Ga0496112_0281563 | 3300048915 | Bacteria | 1610 |
| 505 | Ga0496112_0385140 | 3300048915 | Bacteria | 1343 |
| 506 | Ga0496112_1011216 | 3300048915 | Bacteria | 751 |
| 507 | Ga0496112_1198059 | 3300048915 | Bacteria | 676 |
| 508 | Ga0496112_1644325 | 3300048915 | Unclassified | 555 |
| 509 | Ga0496113_0000017 | 3300048916 | Bacteria | 74327 |
| 510 | Ga0496113_0005910 | 3300048916 | Bacteria | 7687 |
| 511 | Ga0496113_0093778 | 3300048916 | Bacteria | 2318 |
| 512 | Ga0496113_0245149 | 3300048916 | Bacteria | 1430 |
| 513 | Ga0496113_0592722 | 3300048916 | Unclassified | 888 |
| 514 | Ga0496114_0037828 | 3300048917 | Bacteria | 3992 |
| 515 | Ga0496114_0310955 | 3300048917 | Bacteria | 1392 |
| 516 | Ga0496114_1212321 | 3300048917 | Unclassified | 641 |
| 517 | Ga0496115_0000022 | 3300048918 | Bacteria | 164224 |
| 518 | Ga0496115_0015665 | 3300048918 | Bacteria | 5756 |
| 519 | Ga0496115_0768427 | 3300048918 | Bacteria | 752 |
| 520 | Ga0496117_0001965 | 3300048920 | Bacteria | 27342 |
| 521 | Ga0496118_0004106 | 3300048921 | Bacteria | 17626 |
| 522 | Ga0496119_0001195 | 3300048922 | Bacteria | 32488 |
| 523 | Ga0496119_0015154 | 3300048922 | Bacteria | 5965 |
| 524 | Ga0496119_0017814 | 3300048922 | Bacteria | 5324 |
| 525 | Ga0496119_0114683 | 3300048922 | Unclassified | 1490 |
| 526 | Ga0496120_0002756 | 3300048923 | Bacteria | 17134 |
| 527 | Ga0496120_0031163 | 3300048923 | Bacteria | 3233 |
| 528 | Ga0496120_0426465 | 3300048923 | Unclassified | 581 |
| 529 | Ga0496121_0015761 | 3300048924 | Bacteria | 7875 |
| 530 | Ga0496121_0036117 | 3300048924 | Bacteria | 4409 |
| 531 | Ga0496121_0124862 | 3300048924 | Unclassified | 1937 |
| 532 | Ga0496121_0151799 | 3300048924 | Bacteria | 1704 |
| 533 | Ga0496121_0254448 | 3300048924 | Bacteria | 1216 |
| 534 | Ga0496124_0015496 | 3300048927 | Bacteria | 7303 |
| 535 | Ga0496124_0051873 | 3300048927 | Bacteria | 3488 |
| 536 | Ga0496124_0274072 | 3300048927 | Bacteria | 1234 |
| 537 | Ga0496125_0116705 | 3300048928 | Bacteria | 1916 |
| 538 | Ga0496125_0296877 | 3300048928 | Unclassified | 992 |
| 539 | Ga0496126_0015537 | 3300048929 | Bacteria | 7650 |
| 540 | Ga0496126_0035695 | 3300048929 | Bacteria | 4657 |
| 541 | Ga0496126_0541064 | 3300048929 | Bacteria | 925 |
| 542 | Ga0496126_0623562 | 3300048929 | Bacteria | 847 |
| 543 | Ga0501031_0004579 | 3300049568 | Bacteria | 8968 |
| 544 | Ga0501032_0002738 | 3300049569 | Bacteria | 13725 |
| 545 | Ga0501033_0006871 | 3300049570 | Bacteria | 8883 |
| 546 | Ga0501034_0002876 | 3300049571 | Bacteria | 20017 |
| 547 | Ga0501034_0029572 | 3300049571 | Bacteria | 5570 |
| 548 | Ga0501034_0035223 | 3300049571 | Bacteria | 5075 |
| 549 | Ga0501034_0092678 | 3300049571 | Bacteria | 3018 |
| 550 | Ga0501034_0169010 | 3300049571 | Bacteria | 2154 |
| 551 | Ga0501034_0176227 | 3300049571 | Bacteria | 2104 |
| 552 | Ga0501034_0968362 | 3300049571 | Bacteria | 736 |
| 553 | Ga0501036_0001783 | 3300049572 | Bacteria | 16706 |
| 554 | Ga0501037_0005959 | 3300049573 | Bacteria | 8903 |
| 555 | Ga0501038_0009090 | 3300049574 | Bacteria | 9121 |
| 556 | Ga0501039_0008428 | 3300049575 | Bacteria | 7857 |
| 557 | Ga0501040_0032498 | 3300049576 | Bacteria | 3531 |
| 558 | Ga0501041_0963639 | 3300049577 | Bacteria | 549 |
| 559 | Ga0501042_0014137 | 3300049578 | Bacteria | 5443 |
| 560 | Ga0501042_0086233 | 3300049578 | Bacteria | 2252 |
| 561 | Ga0501042_0126989 | 3300049578 | Unclassified | 1836 |
| 562 | Ga0501042_0308659 | 3300049578 | Bacteria | 1143 |
| 563 | Ga0501043_0001000 | 3300049579 | Bacteria | 24865 |
| 564 | Ga0501046_0008562 | 3300049580 | Bacteria | 8903 |
| 565 | Ga0501046_0235418 | 3300049580 | Bacteria | 1352 |
| 566 | Ga0501047_0003193 | 3300049581 | Bacteria | 15541 |
| 567 | Ga0501047_0028699 | 3300049581 | Bacteria | 5366 |
| 568 | Ga0501047_0051756 | 3300049581 | Bacteria | 3969 |
| 569 | Ga0501047_0246062 | 3300049581 | Bacteria | 1637 |
| 570 | Ga0501047_0276027 | 3300049581 | Bacteria | 1526 |
| 571 | Ga0501048_0006544 | 3300049582 | Bacteria | 8854 |
| 572 | Ga0501067_0011384 | 3300049583 | Bacteria | 4926 |
| 573 | Ga0501067_0082768 | 3300049583 | Bacteria | 1780 |
| 574 | Ga0501068_0024152 | 3300049584 | Unclassified | 3568 |
| 575 | Ga0501068_0158624 | 3300049584 | Bacteria | 1425 |
| 576 | Ga0501068_0180836 | 3300049584 | Bacteria | 1333 |
| 577 | Ga0501068_0242891 | 3300049584 | Bacteria | 1146 |
| 578 | Ga0501069_0014239 | 3300049585 | Bacteria | 4248 |
| 579 | Ga0501069_0081767 | 3300049585 | Bacteria | 1820 |
| 580 | Ga0501070_0000603 | 3300049586 | Bacteria | 32865 |
| 581 | Ga0501070_0056882 | 3300049586 | Bacteria | 3242 |
| 582 | Ga0501070_0076277 | 3300049586 | Bacteria | 2775 |
| 583 | Ga0501070_0134886 | 3300049586 | Bacteria | 2038 |
| 584 | Ga0501070_0171733 | 3300049586 | Bacteria | 1785 |
| 585 | Ga0501071_0412377 | 3300049587 | Unclassified | 1032 |
| 586 | Ga0501071_0520078 | 3300049587 | Bacteria | 913 |
| 587 | Ga0501072_0007991 | 3300049588 | Bacteria | 8029 |
| 588 | Ga0501072_0194070 | 3300049588 | Bacteria | 1619 |
| 589 | Ga0501072_0474369 | 3300049588 | Bacteria | 990 |
| 590 | Ga0501072_1396853 | 3300049588 | Bacteria | 542 |
| 591 | Ga0501073_0012442 | 3300049589 | Bacteria | 6208 |
| 592 | Ga0501073_0403410 | 3300049589 | Bacteria | 944 |
| 593 | Ga0501074_0017277 | 3300049590 | Bacteria | 5233 |
| 594 | Ga0501074_0035338 | 3300049590 | Bacteria | 3620 |
| 595 | Ga0501074_0067100 | 3300049590 | Bacteria | 2580 |
| 596 | Ga0501074_0165172 | 3300049590 | Bacteria | 1581 |
| 597 | Ga0501074_0200930 | 3300049590 | Bacteria | 1420 |
| 598 | Ga0501075_0001603 | 3300049591 | Bacteria | 14813 |
| 599 | Ga0501076_0100114 | 3300049592 | Bacteria | 2335 |
| 600 | Ga0501076_0852228 | 3300049592 | Bacteria | 752 |
| 601 | Ga0501079_0018348 | 3300049741 | Bacteria | 5348 |
| 602 | Ga0501079_0745431 | 3300049741 | Unclassified | 771 |
| 603 | Ga0501080_0041381 | 3300049742 | Bacteria | 4294 |
| 604 | Ga0501080_0198304 | 3300049742 | Bacteria | 1843 |
| 605 | Ga0501080_0220594 | 3300049742 | Bacteria | 1735 |
| 606 | Ga0501081_0573425 | 3300049743 | Unclassified | 844 |
| 607 | Ga0501083_0009148 | 3300049744 | Bacteria | 6998 |
| 608 | Ga0501083_0036922 | 3300049744 | Bacteria | 3329 |
| 609 | Ga0501083_0041592 | 3300049744 | Bacteria | 3116 |
| 610 | Ga0501083_0572237 | 3300049744 | Bacteria | 735 |
| 611 | Ga0501035_0000873 | 3300049822 | Bacteria | 32037 |
| 612 | Ga0501035_0034885 | 3300049822 | Bacteria | 4570 |
| 613 | Ga0501035_1194400 | 3300049822 | Bacteria | 590 |
| 614 | Ga0501044_0003139 | 3300049823 | Bacteria | 18693 |
| 615 | Ga0501044_0036180 | 3300049823 | Bacteria | 5165 |
| 616 | Ga0501044_1143201 | 3300049823 | Bacteria | 647 |
| 617 | Ga0501045_0090325 | 3300049824 | Bacteria | 2263 |
| 618 | nmdc:mga00v17_12096_c1 | 3300050491 | Bacteria | 4754 |
| 619 | nmdc:mga00v17_527018_c1 | 3300050491 | Bacteria | 765 |
| 620 | nmdc:mga00v17_68915_c1 | 3300050491 | Bacteria | 2187 |
| 621 | nmdc:mga00v17_85669_c1 | 3300050491 | Bacteria | 1973 |
| 622 | nmdc:mga0yw44_15653_c1 | 3300050492 | Bacteria | 4070 |
| 623 | nmdc:mga0yw44_201986_c1 | 3300050492 | Bacteria | 1313 |
| 624 | nmdc:mga05p37_156002_c1 | 3300050507 | Bacteria | 2790 |
| 625 | nmdc:mga0qj67_20491_c1 | 3300050509 | Bacteria | 5063 |
| 626 | nmdc:mga06r32_1489750_c1 | 3300050510 | Bacteria | 617 |
| 627 | nmdc:mga0n895_106073_c1 | 3300050512 | Bacteria | 2822 |
| 628 | nmdc:mga0n895_45699_c1 | 3300050512 | Bacteria | 4274 |
| 629 | nmdc:mga0a205_281_c1 | 3300050515 | Bacteria | 37267 |
| 630 | nmdc:mga0a205_45873_c1 | 3300050515 | Bacteria | 4215 |
| 631 | Ga0495601_0000029 | 3300053077 | Bacteria | 111437 |
| 632 | Ga0495601_0000444 | 3300053077 | Bacteria | 21636 |
| 633 | Ga0495601_0008993 | 3300053077 | Bacteria | 5897 |
| 634 | Ga0495601_0014716 | 3300053077 | Bacteria | 4720 |
| 635 | Ga0495601_0101836 | 3300053077 | Bacteria | 1855 |
| 636 | Ga0495601_0390189 | 3300053077 | Bacteria | 903 |
| 637 | Ga0495612_0001200 | 3300053078 | Bacteria | 10676 |
| 638 | Ga0495612_0004444 | 3300053078 | Bacteria | 5819 |
| 639 | Ga0495612_0025544 | 3300053078 | Bacteria | 2372 |
| 640 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 641 | Ga0495595_0000547 | 3300053084 | Bacteria | 14350 |
| 642 | Ga0495595_0052701 | 3300053084 | Bacteria | 1888 |
| 643 | Ga0495619_0000026 | 3300053085 | Bacteria | 167387 |
| 644 | Ga0495619_0000067 | 3300053085 | Bacteria | 83418 |
| 645 | Ga0495619_0000205 | 3300053085 | Bacteria | 42913 |
| 646 | Ga0495619_0002937 | 3300053085 | Bacteria | 11078 |
| 647 | Ga0500583_0370720 | 3300053092 | Bacteria | 691 |
| 648 | Ga0500566_0001360 | 3300053094 | Bacteria | 14314 |
| 649 | Ga0500641_0003315 | 3300053096 | Bacteria | 5697 |
| 650 | Ga0500650_0163534 | 3300053098 | Unclassified | 1026 |
| 651 | Ga0500614_000263 | 3300053123 | Bacteria | 13569 |
| 652 | Ga0500658_0221181 | 3300053134 | Bacteria | 868 |
| 653 | Ga0500568_0173437 | 3300053139 | Bacteria | 793 |
| 654 | Ga0501084_1032848 | 3300054114 | Unclassified | 690 |
| 655 | Ga0501082_0023859 | 3300060353 | Bacteria | 5274 |
| 656 | Ga0501082_0560331 | 3300060353 | Bacteria | 1000 |
| 657 | Ga0530510_0669914 | 3300061734 | Unclassified | 790 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025927 | Ga0207687_10049609 | Ga0207687_100496093 | 98 |
| 2 | 3300049590 | Ga0501074_0165172 | Ga0501074_0165172_127_525 | 105 |
| 3 | 3300041456 | Ga0451795_1439009 | Ga0451795_1439009_145_540 | 106 |
| 4 | 3300046461 | Ga0495641_0025585 | Ga0495641_0025585_275_685 | 106 |
| 5 | 3300025961 | Ga0207712_11113832 | Ga0207712_111138322 | 107 |
| 6 | 3300036401 | Ga0373937_0143413 | Ga0373937_0143413_31_366 | 107 |
| 7 | 3300049743 | Ga0501081_0573425 | Ga0501081_0573425_63_419 | 108 |
| 8 | 3300013296 | Ga0157374_12142974 | Ga0157374_121429741 | 115 |
| 9 | 3300048929 | Ga0496126_0035695 | Ga0496126_0035695_2804_3160 | 118 |
| 10 | 3300050491 | nmdc:mga00v17_527018_c1 | nmdc:mga00v17_527018_c1_357_749 | 120 |
| 11 | 3300005335 | Ga0070666_10021581 | Ga0070666_100215813 | 121 |
| 12 | 3300005335 | Ga0070666_10832117 | Ga0070666_108321171 | 121 |
| 13 | 3300005367 | Ga0070667_100004874 | Ga0070667_1000048746 | 121 |
| 14 | 3300005435 | Ga0070714_100598028 | Ga0070714_1005980281 | 121 |
| 15 | 3300005455 | Ga0070663_100000405 | Ga0070663_1000004058 | 121 |
| 16 | 3300005530 | Ga0070679_100001611 | Ga0070679_10000161115 | 121 |
| 17 | 3300005535 | Ga0070684_100444529 | Ga0070684_1004445292 | 121 |
| 18 | 3300005548 | Ga0070665_100020404 | Ga0070665_1000204046 | 121 |
| 19 | 3300005548 | Ga0070665_102250261 | Ga0070665_1022502611 | 121 |
| 20 | 3300005617 | Ga0068859_100880054 | Ga0068859_1008800542 | 121 |
| 21 | 3300005937 | Ga0081455_10004481 | Ga0081455_100044817 | 121 |
| 22 | 3300005937 | Ga0081455_10232360 | Ga0081455_102323602 | 121 |
| 23 | 3300006931 | Ga0097620_100879941 | Ga0097620_1008799412 | 121 |
| 24 | 3300009545 | Ga0105237_10448368 | Ga0105237_104483682 | 121 |
| 25 | 3300009551 | Ga0105238_10063863 | Ga0105238_100638635 | 121 |
| 26 | 3300010375 | Ga0105239_10358790 | Ga0105239_103587902 | 121 |
| 27 | 3300010375 | Ga0105239_13655608 | Ga0105239_136556081 | 121 |
| 28 | 3300013105 | Ga0157369_12188578 | Ga0157369_121885781 | 121 |
| 29 | 3300014968 | Ga0157379_12285552 | Ga0157379_122855522 | 121 |
| 30 | 3300020080 | Ga0206350_11448283 | Ga0206350_114482831 | 121 |
| 31 | 3300020610 | Ga0154015_1384123 | Ga0154015_13841231 | 121 |
| 32 | 3300025903 | Ga0207680_10017281 | Ga0207680_100172813 | 121 |
| 33 | 3300025914 | Ga0207671_10566576 | Ga0207671_105665762 | 121 |
| 34 | 3300025921 | Ga0207652_10001116 | Ga0207652_1000111620 | 121 |
| 35 | 3300025931 | Ga0207644_10398174 | Ga0207644_103981742 | 121 |
| 36 | 3300025942 | Ga0207689_10354773 | Ga0207689_103547732 | 121 |
| 37 | 3300025944 | Ga0207661_10032745 | Ga0207661_100327453 | 121 |
| 38 | 3300025986 | Ga0207658_10005807 | Ga0207658_100058076 | 121 |
| 39 | 3300025986 | Ga0207658_10459259 | Ga0207658_104592592 | 121 |
| 40 | 3300026067 | Ga0207678_10001534 | Ga0207678_100015348 | 121 |
| 41 | 3300028379 | Ga0268266_10002632 | Ga0268266_100026326 | 121 |
| 42 | 3300046463 | Ga0495653_0088263 | Ga0495653_0088263_1678_2073 | 121 |
| 43 | 3300046529 | Ga0495652_0172158 | Ga0495652_0172158_964_1359 | 121 |
| 44 | 3300046660 | Ga0495625_0439668 | Ga0495625_0439668_375_770 | 121 |
| 45 | 3300047444 | Ga0495675_0123958 | Ga0495675_0123958_535_930 | 121 |
| 46 | 3300047472 | Ga0495686_0009817 | Ga0495686_0009817_3942_4340 | 121 |
| 47 | 3300047472 | Ga0495686_0018236 | Ga0495686_0018236_3508_3906 | 121 |
| 48 | 3300047472 | Ga0495686_0590810 | Ga0495686_0590810_157_555 | 121 |
| 49 | 3300048905 | Ga0496102_0256229 | Ga0496102_0256229_786_1181 | 121 |
| 50 | 3300048906 | Ga0496103_0026396 | Ga0496103_0026396_1359_1754 | 121 |
| 51 | 3300048906 | Ga0496103_0603262 | Ga0496103_0603262_135_530 | 121 |
| 52 | 3300048907 | Ga0496104_0075362 | Ga0496104_0075362_784_1179 | 121 |
| 53 | 3300048908 | Ga0496105_0014512 | Ga0496105_0014512_61_456 | 121 |
| 54 | 3300048911 | Ga0496108_0342103 | Ga0496108_0342103_900_1295 | 121 |
| 55 | 3300048912 | Ga0496109_1096187 | Ga0496109_1096187_222_617 | 121 |
| 56 | 3300048914 | Ga0496111_0376921 | Ga0496111_0376921_362_757 | 121 |
| 57 | 3300048917 | Ga0496114_0310955 | Ga0496114_0310955_29_424 | 121 |
| 58 | 3300048917 | Ga0496114_1212321 | Ga0496114_1212321_113_508 | 121 |
| 59 | 3300048918 | Ga0496115_0768427 | Ga0496115_0768427_156_551 | 121 |
| 60 | 3300048920 | Ga0496117_0001965 | Ga0496117_0001965_1961_2356 | 121 |
| 61 | 3300048921 | Ga0496118_0004106 | Ga0496118_0004106_1686_2081 | 121 |
| 62 | 3300048922 | Ga0496119_0001195 | Ga0496119_0001195_31223_31621 | 121 |
| 63 | 3300048922 | Ga0496119_0017814 | Ga0496119_0017814_3421_3816 | 121 |
| 64 | 3300048922 | Ga0496119_0114683 | Ga0496119_0114683_993_1388 | 121 |
| 65 | 3300048923 | Ga0496120_0002756 | Ga0496120_0002756_4730_5125 | 121 |
| 66 | 3300048923 | Ga0496120_0426465 | Ga0496120_0426465_34_429 | 121 |
| 67 | 3300048924 | Ga0496121_0015761 | Ga0496121_0015761_2590_2985 | 121 |
| 68 | 3300048924 | Ga0496121_0036117 | Ga0496121_0036117_1443_1838 | 121 |
| 69 | 3300048924 | Ga0496121_0124862 | Ga0496121_0124862_1229_1624 | 121 |
| 70 | 3300048924 | Ga0496121_0151799 | Ga0496121_0151799_809_1204 | 121 |
| 71 | 3300048924 | Ga0496121_0254448 | Ga0496121_0254448_522_917 | 121 |
| 72 | 3300048927 | Ga0496124_0015496 | Ga0496124_0015496_1780_2175 | 121 |
| 73 | 3300048927 | Ga0496124_0051873 | Ga0496124_0051873_437_832 | 121 |
| 74 | 3300048928 | Ga0496125_0116705 | Ga0496125_0116705_933_1328 | 121 |
| 75 | 3300048929 | Ga0496126_0015537 | Ga0496126_0015537_3189_3584 | 121 |
| 76 | 3300048929 | Ga0496126_0541064 | Ga0496126_0541064_215_610 | 121 |
| 77 | 3300048929 | Ga0496126_0623562 | Ga0496126_0623562_273_668 | 121 |
| 78 | 3300049568 | Ga0501031_0004579 | Ga0501031_0004579_5887_6282 | 121 |
| 79 | 3300049569 | Ga0501032_0002738 | Ga0501032_0002738_7516_7911 | 121 |
| 80 | 3300049570 | Ga0501033_0006871 | Ga0501033_0006871_2676_3071 | 121 |
| 81 | 3300049571 | Ga0501034_0029572 | Ga0501034_0029572_3458_3853 | 121 |
| 82 | 3300049571 | Ga0501034_0169010 | Ga0501034_0169010_1109_1504 | 121 |
| 83 | 3300049572 | Ga0501036_0001783 | Ga0501036_0001783_10537_10932 | 121 |
| 84 | 3300049573 | Ga0501037_0005959 | Ga0501037_0005959_5804_6199 | 121 |
| 85 | 3300049574 | Ga0501038_0009090 | Ga0501038_0009090_5776_6171 | 121 |
| 86 | 3300049575 | Ga0501039_0008428 | Ga0501039_0008428_4927_5322 | 121 |
| 87 | 3300049576 | Ga0501040_0032498 | Ga0501040_0032498_1881_2276 | 121 |
| 88 | 3300049577 | Ga0501041_0963639 | Ga0501041_0963639_49_444 | 121 |
| 89 | 3300049578 | Ga0501042_0126989 | Ga0501042_0126989_774_1169 | 121 |
| 90 | 3300049579 | Ga0501043_0001000 | Ga0501043_0001000_2710_3105 | 121 |
| 91 | 3300049580 | Ga0501046_0008562 | Ga0501046_0008562_2703_3098 | 121 |
| 92 | 3300049580 | Ga0501046_0235418 | Ga0501046_0235418_649_1050 | 121 |
| 93 | 3300049581 | Ga0501047_0003193 | Ga0501047_0003193_7068_7463 | 121 |
| 94 | 3300049581 | Ga0501047_0028699 | Ga0501047_0028699_4183_4578 | 121 |
| 95 | 3300049581 | Ga0501047_0246062 | Ga0501047_0246062_514_909 | 121 |
| 96 | 3300049581 | Ga0501047_0276027 | Ga0501047_0276027_712_1107 | 121 |
| 97 | 3300049582 | Ga0501048_0006544 | Ga0501048_0006544_2700_3095 | 121 |
| 98 | 3300049583 | Ga0501067_0011384 | Ga0501067_0011384_995_1390 | 121 |
| 99 | 3300049584 | Ga0501068_0024152 | Ga0501068_0024152_831_1226 | 121 |
| 100 | 3300049585 | Ga0501069_0014239 | Ga0501069_0014239_103_498 | 121 |
| 101 | 3300049586 | Ga0501070_0000603 | Ga0501070_0000603_15733_16128 | 121 |
| 102 | 3300049586 | Ga0501070_0076277 | Ga0501070_0076277_1811_2206 | 121 |
| 103 | 3300049586 | Ga0501070_0134886 | Ga0501070_0134886_1210_1605 | 121 |
| 104 | 3300049587 | Ga0501071_0412377 | Ga0501071_0412377_72_467 | 121 |
| 105 | 3300049588 | Ga0501072_0007991 | Ga0501072_0007991_2456_2851 | 121 |
| 106 | 3300049589 | Ga0501073_0012442 | Ga0501073_0012442_3122_3517 | 121 |
| 107 | 3300049590 | Ga0501074_0017277 | Ga0501074_0017277_2731_3126 | 121 |
| 108 | 3300049590 | Ga0501074_0035338 | Ga0501074_0035338_126_521 | 121 |
| 109 | 3300049590 | Ga0501074_0067100 | Ga0501074_0067100_2102_2497 | 121 |
| 110 | 3300049741 | Ga0501079_0018348 | Ga0501079_0018348_2303_2698 | 121 |
| 111 | 3300049742 | Ga0501080_0041381 | Ga0501080_0041381_1193_1588 | 121 |
| 112 | 3300049742 | Ga0501080_0198304 | Ga0501080_0198304_216_611 | 121 |
| 113 | 3300049744 | Ga0501083_0009148 | Ga0501083_0009148_2967_3368 | 121 |
| 114 | 3300049744 | Ga0501083_0036922 | Ga0501083_0036922_1544_1939 | 121 |
| 115 | 3300049744 | Ga0501083_0041592 | Ga0501083_0041592_1756_2151 | 121 |
| 116 | 3300049822 | Ga0501035_0000873 | Ga0501035_0000873_2696_3091 | 121 |
| 117 | 3300049822 | Ga0501035_0034885 | Ga0501035_0034885_109_504 | 121 |
| 118 | 3300049823 | Ga0501044_0003139 | Ga0501044_0003139_2566_2961 | 121 |
| 119 | 3300049823 | Ga0501044_0036180 | Ga0501044_0036180_2499_2894 | 121 |
| 120 | 3300049823 | Ga0501044_1143201 | Ga0501044_1143201_231_626 | 121 |
| 121 | 3300049824 | Ga0501045_0090325 | Ga0501045_0090325_1271_1666 | 121 |
| 122 | 3300053077 | Ga0495601_0008993 | Ga0495601_0008993_807_1202 | 121 |
| 123 | 3300053084 | Ga0495595_0000547 | Ga0495595_0000547_6335_6730 | 121 |
| 124 | 3300053092 | Ga0500583_0370720 | Ga0500583_0370720_46_441 | 121 |
| 125 | 3300053096 | Ga0500641_0003315 | Ga0500641_0003315_2388_2783 | 121 |
| 126 | 3300053098 | Ga0500650_0163534 | Ga0500650_0163534_359_736 | 121 |
| 127 | 3300053134 | Ga0500658_0221181 | Ga0500658_0221181_270_665 | 121 |
| 128 | 3300053139 | Ga0500568_0173437 | Ga0500568_0173437_113_508 | 121 |
| 129 | 3300054114 | Ga0501084_1032848 | Ga0501084_1032848_13_408 | 121 |
| 130 | 3300060353 | Ga0501082_0023859 | Ga0501082_0023859_2342_2737 | 121 |
| 131 | 3300060353 | Ga0501082_0560331 | Ga0501082_0560331_399_794 | 121 |
| 132 | 3300000532 | CNAas_1002147 | CNAas_10021472 | 122 |
| 133 | 3300000546 | LJNas_1003365 | LJNas_10033652 | 122 |
| 134 | 3300001977 | JGI24746J21847_1000366 | JGI24746J21847_10003666 | 122 |
| 135 | 3300001979 | JGI24740J21852_10003978 | JGI24740J21852_100039784 | 122 |
| 136 | 3300002074 | JGI24748J21848_1006175 | JGI24748J21848_10061752 | 122 |
| 137 | 3300002239 | JGI24034J26672_10000425 | JGI24034J26672_100004258 | 122 |
| 138 | 3300002244 | JGI24742J22300_10000739 | JGI24742J22300_100007397 | 122 |
| 139 | 3300003659 | JGI25404J52841_10004669 | JGI25404J52841_100046691 | 122 |
| 140 | 3300004801 | Ga0058860_11509575 | Ga0058860_115095751 | 122 |
| 141 | 3300005327 | Ga0070658_10024325 | Ga0070658_100243255 | 122 |
| 142 | 3300005327 | Ga0070658_10696522 | Ga0070658_106965222 | 122 |
| 143 | 3300005329 | Ga0070683_100001231 | Ga0070683_10000123118 | 122 |
| 144 | 3300005329 | Ga0070683_100007506 | Ga0070683_1000075062 | 122 |
| 145 | 3300005329 | Ga0070683_100113564 | Ga0070683_1001135643 | 122 |
| 146 | 3300005329 | Ga0070683_100256994 | Ga0070683_1002569943 | 122 |
| 147 | 3300005331 | Ga0070670_100036432 | Ga0070670_1000364325 | 122 |
| 148 | 3300005333 | Ga0070677_10000956 | Ga0070677_100009565 | 122 |
| 149 | 3300005334 | Ga0068869_101210464 | Ga0068869_1012104642 | 122 |
| 150 | 3300005335 | Ga0070666_10052132 | Ga0070666_100521325 | 122 |
| 151 | 3300005337 | Ga0070682_100000023 | Ga0070682_100000023220 | 122 |
| 152 | 3300005337 | Ga0070682_100000061 | Ga0070682_10000006185 | 122 |
| 153 | 3300005337 | Ga0070682_100621637 | Ga0070682_1006216372 | 122 |
| 154 | 3300005337 | Ga0070682_100751612 | Ga0070682_1007516121 | 122 |
| 155 | 3300005338 | Ga0068868_100001254 | Ga0068868_10000125422 | 122 |
| 156 | 3300005338 | Ga0068868_100688014 | Ga0068868_1006880142 | 122 |
| 157 | 3300005338 | Ga0068868_100863852 | Ga0068868_1008638521 | 122 |
| 158 | 3300005340 | Ga0070689_100047666 | Ga0070689_1000476662 | 122 |
| 159 | 3300005340 | Ga0070689_100050193 | Ga0070689_1000501935 | 122 |
| 160 | 3300005341 | Ga0070691_10000004 | Ga0070691_1000000482 | 122 |
| 161 | 3300005341 | Ga0070691_10123681 | Ga0070691_101236812 | 122 |
| 162 | 3300005345 | Ga0070692_10200319 | Ga0070692_102003192 | 122 |
| 163 | 3300005347 | Ga0070668_100020201 | Ga0070668_1000202014 | 122 |
| 164 | 3300005347 | Ga0070668_100020238 | Ga0070668_1000202382 | 122 |
| 165 | 3300005347 | Ga0070668_100589955 | Ga0070668_1005899552 | 122 |
| 166 | 3300005353 | Ga0070669_100040491 | Ga0070669_1000404912 | 122 |
| 167 | 3300005354 | Ga0070675_100000091 | Ga0070675_10000009137 | 122 |
| 168 | 3300005356 | Ga0070674_101519781 | Ga0070674_1015197811 | 122 |
| 169 | 3300005364 | Ga0070673_100016927 | Ga0070673_1000169272 | 122 |
| 170 | 3300005365 | Ga0070688_100000077 | Ga0070688_10000007713 | 122 |
| 171 | 3300005365 | Ga0070688_100000937 | Ga0070688_1000009374 | 122 |
| 172 | 3300005366 | Ga0070659_100005636 | Ga0070659_10000563610 | 122 |
| 173 | 3300005366 | Ga0070659_100062491 | Ga0070659_1000624913 | 122 |
| 174 | 3300005367 | Ga0070667_100000597 | Ga0070667_1000005977 | 122 |
| 175 | 3300005367 | Ga0070667_100409667 | Ga0070667_1004096672 | 122 |
| 176 | 3300005435 | Ga0070714_100098756 | Ga0070714_1000987564 | 122 |
| 177 | 3300005436 | Ga0070713_100000135 | Ga0070713_10000013536 | 122 |
| 178 | 3300005439 | Ga0070711_100005739 | Ga0070711_1000057398 | 122 |
| 179 | 3300005441 | Ga0070700_101189465 | Ga0070700_1011894652 | 122 |
| 180 | 3300005456 | Ga0070678_100005719 | Ga0070678_1000057197 | 122 |
| 181 | 3300005457 | Ga0070662_100000001 | Ga0070662_100000001142 | 122 |
| 182 | 3300005457 | Ga0070662_101866939 | Ga0070662_1018669391 | 122 |
| 183 | 3300005458 | Ga0070681_10010648 | Ga0070681_100106487 | 122 |
| 184 | 3300005466 | Ga0070685_10000061 | Ga0070685_1000006117 | 122 |
| 185 | 3300005466 | Ga0070685_10000965 | Ga0070685_1000096518 | 122 |
| 186 | 3300005530 | Ga0070679_100000088 | Ga0070679_10000008844 | 122 |
| 187 | 3300005535 | Ga0070684_100012176 | Ga0070684_1000121765 | 122 |
| 188 | 3300005535 | Ga0070684_100160553 | Ga0070684_1001605533 | 122 |
| 189 | 3300005535 | Ga0070684_100180836 | Ga0070684_1001808363 | 122 |
| 190 | 3300005535 | Ga0070684_100378015 | Ga0070684_1003780152 | 122 |
| 191 | 3300005539 | Ga0068853_100248975 | Ga0068853_1002489754 | 122 |
| 192 | 3300005539 | Ga0068853_100910550 | Ga0068853_1009105503 | 122 |
| 193 | 3300005543 | Ga0070672_100000005 | Ga0070672_10000000589 | 122 |
| 194 | 3300005547 | Ga0070693_100021873 | Ga0070693_1000218734 | 122 |
| 195 | 3300005548 | Ga0070665_100000022 | Ga0070665_10000002277 | 122 |
| 196 | 3300005548 | Ga0070665_100006490 | Ga0070665_1000064904 | 122 |
| 197 | 3300005548 | Ga0070665_100283438 | Ga0070665_1002834382 | 122 |
| 198 | 3300005548 | Ga0070665_100326908 | Ga0070665_1003269082 | 122 |
| 199 | 3300005549 | Ga0070704_100064390 | Ga0070704_1000643902 | 122 |
| 200 | 3300005564 | Ga0070664_100067851 | Ga0070664_1000678512 | 122 |
| 201 | 3300005578 | Ga0068854_100000838 | Ga0068854_10000083815 | 122 |
| 202 | 3300005578 | Ga0068854_100021831 | Ga0068854_1000218313 | 122 |
| 203 | 3300005614 | Ga0068856_100005996 | Ga0068856_1000059966 | 122 |
| 204 | 3300005614 | Ga0068856_100095223 | Ga0068856_1000952232 | 122 |
| 205 | 3300005614 | Ga0068856_100119729 | Ga0068856_1001197295 | 122 |
| 206 | 3300005614 | Ga0068856_100260518 | Ga0068856_1002605182 | 122 |
| 207 | 3300005616 | Ga0068852_100000037 | Ga0068852_10000003740 | 122 |
| 208 | 3300005616 | Ga0068852_100009794 | Ga0068852_1000097944 | 122 |
| 209 | 3300005718 | Ga0068866_10068635 | Ga0068866_100686352 | 122 |
| 210 | 3300005719 | Ga0068861_100044604 | Ga0068861_1000446043 | 122 |
| 211 | 3300005834 | Ga0068851_10000741 | Ga0068851_100007414 | 122 |
| 212 | 3300005834 | Ga0068851_10010572 | Ga0068851_100105725 | 122 |
| 213 | 3300005841 | Ga0068863_100004891 | Ga0068863_1000048916 | 122 |
| 214 | 3300005841 | Ga0068863_100022537 | Ga0068863_1000225377 | 122 |
| 215 | 3300005842 | Ga0068858_100001657 | Ga0068858_1000016575 | 122 |
| 216 | 3300005842 | Ga0068858_100120833 | Ga0068858_1001208332 | 122 |
| 217 | 3300005844 | Ga0068862_100001558 | Ga0068862_10000155823 | 122 |
| 218 | 3300005983 | Ga0081540_1000697 | Ga0081540_100069715 | 122 |
| 219 | 3300005983 | Ga0081540_1013456 | Ga0081540_10134562 | 122 |
| 220 | 3300005985 | Ga0081539_10016325 | Ga0081539_100163256 | 122 |
| 221 | 3300006038 | Ga0075365_10027783 | Ga0075365_100277834 | 122 |
| 222 | 3300006038 | Ga0075365_10046083 | Ga0075365_100460834 | 122 |
| 223 | 3300006051 | Ga0075364_10126824 | Ga0075364_101268242 | 122 |
| 224 | 3300006051 | Ga0075364_10382678 | Ga0075364_103826783 | 122 |
| 225 | 3300006175 | Ga0070712_100005477 | Ga0070712_1000054777 | 122 |
| 226 | 3300006237 | Ga0097621_100347149 | Ga0097621_1003471493 | 122 |
| 227 | 3300006846 | Ga0075430_100071719 | Ga0075430_1000717195 | 122 |
| 228 | 3300006847 | Ga0075431_100945956 | Ga0075431_1009459562 | 122 |
| 229 | 3300006852 | Ga0075433_10061844 | Ga0075433_100618444 | 122 |
| 230 | 3300006852 | Ga0075433_10063177 | Ga0075433_100631776 | 122 |
| 231 | 3300006852 | Ga0075433_10979438 | Ga0075433_109794382 | 122 |
| 232 | 3300006871 | Ga0075434_100061202 | Ga0075434_1000612025 | 122 |
| 233 | 3300006871 | Ga0075434_100121049 | Ga0075434_1001210494 | 122 |
| 234 | 3300006880 | Ga0075429_100866153 | Ga0075429_1008661532 | 122 |
| 235 | 3300006881 | Ga0068865_100000089 | Ga0068865_10000008926 | 122 |
| 236 | 3300006881 | Ga0068865_101369003 | Ga0068865_1013690032 | 122 |
| 237 | 3300007076 | Ga0075435_100012085 | Ga0075435_1000120853 | 122 |
| 238 | 3300007076 | Ga0075435_100820820 | Ga0075435_1008208202 | 122 |
| 239 | 3300009098 | Ga0105245_10000640 | Ga0105245_1000064021 | 122 |
| 240 | 3300009098 | Ga0105245_10001641 | Ga0105245_100016417 | 122 |
| 241 | 3300009098 | Ga0105245_10002937 | Ga0105245_1000293722 | 122 |
| 242 | 3300009098 | Ga0105245_10020753 | Ga0105245_100207533 | 122 |
| 243 | 3300009098 | Ga0105245_10714357 | Ga0105245_107143572 | 122 |
| 244 | 3300009101 | Ga0105247_10000591 | Ga0105247_100005919 | 122 |
| 245 | 3300009101 | Ga0105247_10311573 | Ga0105247_103115732 | 122 |
| 246 | 3300009147 | Ga0114129_10003422 | Ga0114129_100034223 | 122 |
| 247 | 3300009148 | Ga0105243_10028842 | Ga0105243_100288425 | 122 |
| 248 | 3300009148 | Ga0105243_12969963 | Ga0105243_129699631 | 122 |
| 249 | 3300009174 | Ga0105241_10831000 | Ga0105241_108310002 | 122 |
| 250 | 3300009176 | Ga0105242_10008495 | Ga0105242_100084955 | 122 |
| 251 | 3300009176 | Ga0105242_10652420 | Ga0105242_106524201 | 122 |
| 252 | 3300009176 | Ga0105242_11634911 | Ga0105242_116349112 | 122 |
| 253 | 3300009177 | Ga0105248_10000017 | Ga0105248_10000017265 | 122 |
| 254 | 3300009551 | Ga0105238_10000016 | Ga0105238_10000016224 | 122 |
| 255 | 3300009553 | Ga0105249_10000368 | Ga0105249_100003687 | 122 |
| 256 | 3300009553 | Ga0105249_10001411 | Ga0105249_1000141120 | 122 |
| 257 | 3300009553 | Ga0105249_10394142 | Ga0105249_103941423 | 122 |
| 258 | 3300009553 | Ga0105249_12092226 | Ga0105249_120922262 | 122 |
| 259 | 3300010375 | Ga0105239_10331079 | Ga0105239_103310792 | 122 |
| 260 | 3300010375 | Ga0105239_10706075 | Ga0105239_107060751 | 122 |
| 261 | 3300010375 | Ga0105239_11293698 | Ga0105239_112936982 | 122 |
| 262 | 3300011119 | Ga0105246_11125411 | Ga0105246_111254112 | 122 |
| 263 | 3300012492 | Ga0157335_1044529 | Ga0157335_10445291 | 122 |
| 264 | 3300013102 | Ga0157371_10021297 | Ga0157371_100212972 | 122 |
| 265 | 3300013104 | Ga0157370_10037760 | Ga0157370_100377604 | 122 |
| 266 | 3300013104 | Ga0157370_10141451 | Ga0157370_101414512 | 122 |
| 267 | 3300013105 | Ga0157369_10000105 | Ga0157369_1000010533 | 122 |
| 268 | 3300013296 | Ga0157374_10000785 | Ga0157374_1000078510 | 122 |
| 269 | 3300013296 | Ga0157374_10484385 | Ga0157374_104843852 | 122 |
| 270 | 3300013297 | Ga0157378_10016184 | Ga0157378_100161841 | 122 |
| 271 | 3300013297 | Ga0157378_10121113 | Ga0157378_101211133 | 122 |
| 272 | 3300013297 | Ga0157378_10191797 | Ga0157378_101917974 | 122 |
| 273 | 3300013306 | Ga0163162_10780520 | Ga0163162_107805202 | 122 |
| 274 | 3300013307 | Ga0157372_10001649 | Ga0157372_1000164928 | 122 |
| 275 | 3300013308 | Ga0157375_10076554 | Ga0157375_100765544 | 122 |
| 276 | 3300013308 | Ga0157375_10488346 | Ga0157375_104883462 | 122 |
| 277 | 3300013308 | Ga0157375_13448716 | Ga0157375_134487161 | 122 |
| 278 | 3300014325 | Ga0163163_11693332 | Ga0163163_116933322 | 122 |
| 279 | 3300014325 | Ga0163163_12046880 | Ga0163163_120468802 | 122 |
| 280 | 3300014325 | Ga0163163_12761428 | Ga0163163_127614282 | 122 |
| 281 | 3300014326 | Ga0157380_10001737 | Ga0157380_1000173715 | 122 |
| 282 | 3300014326 | Ga0157380_10051211 | Ga0157380_100512112 | 122 |
| 283 | 3300014326 | Ga0157380_11754446 | Ga0157380_117544461 | 122 |
| 284 | 3300014326 | Ga0157380_12881778 | Ga0157380_128817781 | 122 |
| 285 | 3300014968 | Ga0157379_10211792 | Ga0157379_102117922 | 122 |
| 286 | 3300014968 | Ga0157379_10305209 | Ga0157379_103052092 | 122 |
| 287 | 3300014968 | Ga0157379_11360198 | Ga0157379_113601982 | 122 |
| 288 | 3300014969 | Ga0157376_10050590 | Ga0157376_100505903 | 122 |
| 289 | 3300017792 | Ga0163161_10000064 | Ga0163161_1000006452 | 122 |
| 290 | 3300017792 | Ga0163161_10332348 | Ga0163161_103323482 | 122 |
| 291 | 3300020070 | Ga0206356_11041816 | Ga0206356_110418162 | 122 |
| 292 | 3300020077 | Ga0206351_10147608 | Ga0206351_101476082 | 122 |
| 293 | 3300020078 | Ga0206352_10184859 | Ga0206352_101848592 | 122 |
| 294 | 3300022467 | Ga0224712_10068679 | Ga0224712_100686791 | 122 |
| 295 | 3300025321 | Ga0207656_10001891 | Ga0207656_100018914 | 122 |
| 296 | 3300025321 | Ga0207656_10016340 | Ga0207656_100163404 | 122 |
| 297 | 3300025893 | Ga0207682_10000041 | Ga0207682_100000418 | 122 |
| 298 | 3300025899 | Ga0207642_10030362 | Ga0207642_100303624 | 122 |
| 299 | 3300025900 | Ga0207710_10000684 | Ga0207710_100006847 | 122 |
| 300 | 3300025900 | Ga0207710_10130282 | Ga0207710_101302822 | 122 |
| 301 | 3300025903 | Ga0207680_10002263 | Ga0207680_1000226310 | 122 |
| 302 | 3300025904 | Ga0207647_10260908 | Ga0207647_102609082 | 122 |
| 303 | 3300025909 | Ga0207705_10037805 | Ga0207705_100378055 | 122 |
| 304 | 3300025911 | Ga0207654_10076779 | Ga0207654_100767793 | 122 |
| 305 | 3300025912 | Ga0207707_10007315 | Ga0207707_100073155 | 122 |
| 306 | 3300025915 | Ga0207693_10001233 | Ga0207693_1000123325 | 122 |
| 307 | 3300025916 | Ga0207663_10000399 | Ga0207663_100003998 | 122 |
| 308 | 3300025917 | Ga0207660_10228988 | Ga0207660_102289882 | 122 |
| 309 | 3300025920 | Ga0207649_10000015 | Ga0207649_10000015235 | 122 |
| 310 | 3300025921 | Ga0207652_10000286 | Ga0207652_1000028646 | 122 |
| 311 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012198 | 122 |
| 312 | 3300025925 | Ga0207650_10101377 | Ga0207650_101013772 | 122 |
| 313 | 3300025926 | Ga0207659_10000147 | Ga0207659_1000014726 | 122 |
| 314 | 3300025927 | Ga0207687_10000040 | Ga0207687_1000004058 | 122 |
| 315 | 3300025927 | Ga0207687_10000331 | Ga0207687_1000033110 | 122 |
| 316 | 3300025927 | Ga0207687_10001806 | Ga0207687_100018064 | 122 |
| 317 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003119 | 122 |
| 318 | 3300025929 | Ga0207664_10048306 | Ga0207664_100483065 | 122 |
| 319 | 3300025932 | Ga0207690_10004100 | Ga0207690_1000410011 | 122 |
| 320 | 3300025932 | Ga0207690_10115305 | Ga0207690_101153052 | 122 |
| 321 | 3300025933 | Ga0207706_10000003 | Ga0207706_10000003186 | 122 |
| 322 | 3300025934 | Ga0207686_10003997 | Ga0207686_100039976 | 122 |
| 323 | 3300025934 | Ga0207686_10068904 | Ga0207686_100689042 | 122 |
| 324 | 3300025934 | Ga0207686_10155319 | Ga0207686_101553193 | 122 |
| 325 | 3300025935 | Ga0207709_10001985 | Ga0207709_1000198514 | 122 |
| 326 | 3300025936 | Ga0207670_10018122 | Ga0207670_100181223 | 122 |
| 327 | 3300025936 | Ga0207670_10093989 | Ga0207670_100939892 | 122 |
| 328 | 3300025938 | Ga0207704_10000018 | Ga0207704_10000018123 | 122 |
| 329 | 3300025939 | Ga0207665_10110437 | Ga0207665_101104373 | 122 |
| 330 | 3300025940 | Ga0207691_10000028 | Ga0207691_1000002841 | 122 |
| 331 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011312 | 122 |
| 332 | 3300025942 | Ga0207689_10754297 | Ga0207689_107542972 | 122 |
| 333 | 3300025944 | Ga0207661_10000714 | Ga0207661_1000071418 | 122 |
| 334 | 3300025944 | Ga0207661_10003496 | Ga0207661_1000349614 | 122 |
| 335 | 3300025944 | Ga0207661_10022934 | Ga0207661_100229345 | 122 |
| 336 | 3300025944 | Ga0207661_10831287 | Ga0207661_108312872 | 122 |
| 337 | 3300025945 | Ga0207679_10040523 | Ga0207679_100405235 | 122 |
| 338 | 3300025960 | Ga0207651_10002542 | Ga0207651_100025423 | 122 |
| 339 | 3300025961 | Ga0207712_10000027 | Ga0207712_10000027302 | 122 |
| 340 | 3300025961 | Ga0207712_10002082 | Ga0207712_1000208211 | 122 |
| 341 | 3300025961 | Ga0207712_10255024 | Ga0207712_102550243 | 122 |
| 342 | 3300025972 | Ga0207668_10008461 | Ga0207668_100084613 | 122 |
| 343 | 3300025972 | Ga0207668_10010007 | Ga0207668_100100072 | 122 |
| 344 | 3300025972 | Ga0207668_10506628 | Ga0207668_105066282 | 122 |
| 345 | 3300025981 | Ga0207640_10000205 | Ga0207640_100002059 | 122 |
| 346 | 3300025981 | Ga0207640_10066797 | Ga0207640_100667974 | 122 |
| 347 | 3300025986 | Ga0207658_10000465 | Ga0207658_100004656 | 122 |
| 348 | 3300025986 | Ga0207658_10335726 | Ga0207658_103357262 | 122 |
| 349 | 3300025986 | Ga0207658_10702690 | Ga0207658_107026902 | 122 |
| 350 | 3300026023 | Ga0207677_10001420 | Ga0207677_100014202 | 122 |
| 351 | 3300026023 | Ga0207677_10009593 | Ga0207677_100095935 | 122 |
| 352 | 3300026035 | Ga0207703_10000020 | Ga0207703_10000020130 | 122 |
| 353 | 3300026035 | Ga0207703_10738672 | Ga0207703_107386722 | 122 |
| 354 | 3300026041 | Ga0207639_10185322 | Ga0207639_101853221 | 122 |
| 355 | 3300026041 | Ga0207639_11010971 | Ga0207639_110109712 | 122 |
| 356 | 3300026067 | Ga0207678_10363079 | Ga0207678_103630793 | 122 |
| 357 | 3300026075 | Ga0207708_10079636 | Ga0207708_100796364 | 122 |
| 358 | 3300026078 | Ga0207702_10000690 | Ga0207702_1000069024 | 122 |
| 359 | 3300026078 | Ga0207702_10003502 | Ga0207702_1000350215 | 122 |
| 360 | 3300026078 | Ga0207702_11103351 | Ga0207702_111033512 | 122 |
| 361 | 3300026088 | Ga0207641_10001193 | Ga0207641_1000119317 | 122 |
| 362 | 3300026088 | Ga0207641_10002149 | Ga0207641_100021498 | 122 |
| 363 | 3300026116 | Ga0207674_10587417 | Ga0207674_105874172 | 122 |
| 364 | 3300026118 | Ga0207675_100146155 | Ga0207675_1001461552 | 122 |
| 365 | 3300026121 | Ga0207683_10003514 | Ga0207683_100035147 | 122 |
| 366 | 3300026142 | Ga0207698_10000015 | Ga0207698_10000015162 | 122 |
| 367 | 3300026142 | Ga0207698_10018608 | Ga0207698_100186084 | 122 |
| 368 | 3300028379 | Ga0268266_10000029 | Ga0268266_10000029373 | 122 |
| 369 | 3300028379 | Ga0268266_10001209 | Ga0268266_100012094 | 122 |
| 370 | 3300028379 | Ga0268266_10058212 | Ga0268266_100582124 | 122 |
| 371 | 3300028379 | Ga0268266_11324723 | Ga0268266_113247231 | 122 |
| 372 | 3300028380 | Ga0268265_10001048 | Ga0268265_1000104826 | 122 |
| 373 | 3300028381 | Ga0268264_10064748 | Ga0268264_100647482 | 122 |
| 374 | 3300028381 | Ga0268264_10135194 | Ga0268264_101351943 | 122 |
| 375 | 3300028556 | Ga0265337_1000061 | Ga0265337_100006129 | 122 |
| 376 | 3300028558 | Ga0265326_10000067 | Ga0265326_1000006714 | 122 |
| 377 | 3300028573 | Ga0265334_10117279 | Ga0265334_101172792 | 122 |
| 378 | 3300028654 | Ga0265322_10000005 | Ga0265322_1000000595 | 122 |
| 379 | 3300028800 | Ga0265338_10000051 | Ga0265338_100000516 | 122 |
| 380 | 3300029957 | Ga0265324_10000510 | Ga0265324_1000051021 | 122 |
| 381 | 3300029957 | Ga0265324_10094406 | Ga0265324_100944062 | 122 |
| 382 | 3300031238 | Ga0265332_10131848 | Ga0265332_101318482 | 122 |
| 383 | 3300031239 | Ga0265328_10000563 | Ga0265328_100005638 | 122 |
| 384 | 3300031240 | Ga0265320_10000010 | Ga0265320_10000010141 | 122 |
| 385 | 3300031241 | Ga0265325_10006156 | Ga0265325_100061566 | 122 |
| 386 | 3300031242 | Ga0265329_10014727 | Ga0265329_100147273 | 122 |
| 387 | 3300031249 | Ga0265339_10051355 | Ga0265339_100513552 | 122 |
| 388 | 3300031250 | Ga0265331_10003612 | Ga0265331_100036128 | 122 |
| 389 | 3300031251 | Ga0265327_10000040 | Ga0265327_10000040165 | 122 |
| 390 | 3300031344 | Ga0265316_10036257 | Ga0265316_100362572 | 122 |
| 391 | 3300031711 | Ga0265314_10000208 | Ga0265314_1000020875 | 122 |
| 392 | 3300031727 | Ga0316576_10005341 | Ga0316576_100053418 | 122 |
| 393 | 3300031728 | Ga0316578_10487678 | Ga0316578_104876781 | 122 |
| 394 | 3300031731 | Ga0307405_10650807 | Ga0307405_106508072 | 122 |
| 395 | 3300031733 | Ga0316577_10184447 | Ga0316577_101844472 | 122 |
| 396 | 3300032126 | Ga0307415_100001546 | Ga0307415_1000015469 | 122 |
| 397 | 3300032133 | Ga0316583_10106778 | Ga0316583_101067782 | 122 |
| 398 | 3300035398 | Ga0316574_0020645 | Ga0316574_0020645_617_1015 | 122 |
| 399 | 3300035398 | Ga0316574_0885993 | Ga0316574_0885993_146_514 | 122 |
| 400 | 3300035724 | Ga0373933_0102864 | Ga0373933_0102864_278_676 | 122 |
| 401 | 3300036401 | Ga0373937_0312282 | Ga0373937_0312282_354_752 | 122 |
| 402 | 3300036712 | Ga0316584_0020165 | Ga0316584_0020165_2551_2949 | 122 |
| 403 | 3300041451 | Ga0451791_1304923 | Ga0451791_1304923_361_795 | 122 |
| 404 | 3300041459 | Ga0451800_0767792 | Ga0451800_0767792_191_589 | 122 |
| 405 | 3300041463 | Ga0451804_1055041 | Ga0451804_1055041_73_471 | 122 |
| 406 | 3300041486 | Ga0451807_0854954 | Ga0451807_0854954_1260_1658 | 122 |
| 407 | 3300041486 | Ga0451807_2127737 | Ga0451807_2127737_739_1137 | 122 |
| 408 | 3300041486 | Ga0451807_2260395 | Ga0451807_2260395_333_737 | 122 |
| 409 | 3300041492 | Ga0451835_0033024 | Ga0451835_0033024_270_668 | 122 |
| 410 | 3300041494 | Ga0451837_0805574 | Ga0451837_0805574_231_665 | 122 |
| 411 | 3300041505 | Ga0451849_0377150 | Ga0451849_0377150_544_942 | 122 |
| 412 | 3300041509 | Ga0451843_1693432 | Ga0451843_1693432_49_429 | 122 |
| 413 | 3300041512 | Ga0451853_1950518 | Ga0451853_1950518_622_1020 | 122 |
| 414 | 3300041512 | Ga0451853_2626091 | Ga0451853_2626091_78_476 | 122 |
| 415 | 3300041512 | Ga0451853_3252069 | Ga0451853_3252069_421_819 | 122 |
| 416 | 3300044694 | Ga0466963_0002882 | Ga0466963_0002882_8557_8955 | 122 |
| 417 | 3300044694 | Ga0466963_0125338 | Ga0466963_0125338_227_625 | 122 |
| 418 | 3300044694 | Ga0466963_0197296 | Ga0466963_0197296_212_610 | 122 |
| 419 | 3300044842 | Ga0466957_0030890 | Ga0466957_0030890_1818_2216 | 122 |
| 420 | 3300044842 | Ga0466957_0184388 | Ga0466957_0184388_212_610 | 122 |
| 421 | 3300045836 | Ga0466958_0038088 | Ga0466958_0038088_1735_2136 | 122 |
| 422 | 3300045976 | Ga0466967_0000012 | Ga0466967_0000012_92994_93392 | 122 |
| 423 | 3300045976 | Ga0466967_0111590 | Ga0466967_0111590_553_951 | 122 |
| 424 | 3300045976 | Ga0466967_0243572 | Ga0466967_0243572_1086_1484 | 122 |
| 425 | 3300045976 | Ga0466967_0479102 | Ga0466967_0479102_251_649 | 122 |
| 426 | 3300045976 | Ga0466967_0995990 | Ga0466967_0995990_134_532 | 122 |
| 427 | 3300046454 | Ga0495592_0000423 | Ga0495592_0000423_435_833 | 122 |
| 428 | 3300046454 | Ga0495592_0057352 | Ga0495592_0057352_161_559 | 122 |
| 429 | 3300046454 | Ga0495592_0801781 | Ga0495592_0801781_23_421 | 122 |
| 430 | 3300046455 | Ga0495603_0000194 | Ga0495603_0000194_19260_19658 | 122 |
| 431 | 3300046459 | Ga0495629_0000806 | Ga0495629_0000806_19070_19468 | 122 |
| 432 | 3300046459 | Ga0495629_0003436 | Ga0495629_0003436_7978_8376 | 122 |
| 433 | 3300046459 | Ga0495629_0012055 | Ga0495629_0012055_4645_5043 | 122 |
| 434 | 3300046460 | Ga0495638_0048154 | Ga0495638_0048154_1813_2211 | 122 |
| 435 | 3300046461 | Ga0495641_0000004 | Ga0495641_0000004_134875_135273 | 122 |
| 436 | 3300046461 | Ga0495641_0095674 | Ga0495641_0095674_90_494 | 122 |
| 437 | 3300046462 | Ga0495651_0037463 | Ga0495651_0037463_1080_1478 | 122 |
| 438 | 3300046462 | Ga0495651_0088358 | Ga0495651_0088358_495_893 | 122 |
| 439 | 3300046462 | Ga0495651_0342644 | Ga0495651_0342644_407_805 | 122 |
| 440 | 3300046463 | Ga0495653_0052740 | Ga0495653_0052740_1324_1722 | 122 |
| 441 | 3300046463 | Ga0495653_0134167 | Ga0495653_0134167_525_923 | 122 |
| 442 | 3300046463 | Ga0495653_0189604 | Ga0495653_0189604_402_800 | 122 |
| 443 | 3300046463 | Ga0495653_0303676 | Ga0495653_0303676_493_891 | 122 |
| 444 | 3300046463 | Ga0495653_0431541 | Ga0495653_0431541_339_737 | 122 |
| 445 | 3300046475 | Ga0495639_0041462 | Ga0495639_0041462_426_824 | 122 |
| 446 | 3300046476 | Ga0495662_0000051 | Ga0495662_0000051_2527_2925 | 122 |
| 447 | 3300046476 | Ga0495662_0005718 | Ga0495662_0005718_1408_1806 | 122 |
| 448 | 3300046477 | Ga0495664_0378391 | Ga0495664_0378391_388_786 | 122 |
| 449 | 3300046499 | Ga0495594_0000012 | Ga0495594_0000012_77155_77553 | 122 |
| 450 | 3300046507 | Ga0495606_0000895 | Ga0495606_0000895_37788_38186 | 122 |
| 451 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_159138_159509 | 122 |
| 452 | 3300046511 | Ga0495608_0000092 | Ga0495608_0000092_12868_13266 | 122 |
| 453 | 3300046511 | Ga0495608_0011421 | Ga0495608_0011421_4839_5237 | 122 |
| 454 | 3300046514 | Ga0495618_0000094 | Ga0495618_0000094_46917_47315 | 122 |
| 455 | 3300046515 | Ga0495620_0001737 | Ga0495620_0001737_1097_1495 | 122 |
| 456 | 3300046516 | Ga0495628_0007879 | Ga0495628_0007879_2049_2447 | 122 |
| 457 | 3300046516 | Ga0495628_0069581 | Ga0495628_0069581_1734_2132 | 122 |
| 458 | 3300046516 | Ga0495628_0134161 | Ga0495628_0134161_1041_1442 | 122 |
| 459 | 3300046517 | Ga0495630_0000032 | Ga0495630_0000032_16770_17168 | 122 |
| 460 | 3300046517 | Ga0495630_0000519 | Ga0495630_0000519_1285_1683 | 122 |
| 461 | 3300046517 | Ga0495630_0001088 | Ga0495630_0001088_17327_17725 | 122 |
| 462 | 3300046517 | Ga0495630_0230802 | Ga0495630_0230802_343_741 | 122 |
| 463 | 3300046517 | Ga0495630_0245725 | Ga0495630_0245725_461_859 | 122 |
| 464 | 3300046523 | Ga0495644_0002998 | Ga0495644_0002998_2905_3303 | 122 |
| 465 | 3300046523 | Ga0495644_0154778 | Ga0495644_0154778_377_805 | 122 |
| 466 | 3300046529 | Ga0495652_0000018 | Ga0495652_0000018_147844_148242 | 122 |
| 467 | 3300046529 | Ga0495652_0001501 | Ga0495652_0001501_10248_10658 | 122 |
| 468 | 3300046529 | Ga0495652_0083319 | Ga0495652_0083319_546_944 | 122 |
| 469 | 3300046533 | Ga0495640_0006754 | Ga0495640_0006754_6189_6587 | 122 |
| 470 | 3300046533 | Ga0495640_0089880 | Ga0495640_0089880_15_413 | 122 |
| 471 | 3300046535 | Ga0495586_0001742 | Ga0495586_0001742_10807_11205 | 122 |
| 472 | 3300046536 | Ga0495587_0028299 | Ga0495587_0028299_1036_1437 | 122 |
| 473 | 3300046536 | Ga0495587_0075141 | Ga0495587_0075141_1413_1811 | 122 |
| 474 | 3300046536 | Ga0495587_0093925 | Ga0495587_0093925_371_769 | 122 |
| 475 | 3300046537 | Ga0495598_0001408 | Ga0495598_0001408_1975_2373 | 122 |
| 476 | 3300046539 | Ga0495621_0001476 | Ga0495621_0001476_5235_5633 | 122 |
| 477 | 3300046543 | Ga0495645_0091667 | Ga0495645_0091667_949_1359 | 122 |
| 478 | 3300046543 | Ga0495645_0233335 | Ga0495645_0233335_537_935 | 122 |
| 479 | 3300046543 | Ga0495645_0441170 | Ga0495645_0441170_158_556 | 122 |
| 480 | 3300046557 | Ga0495622_0000353 | Ga0495622_0000353_6780_7178 | 122 |
| 481 | 3300046558 | Ga0495633_0103902 | Ga0495633_0103902_785_1183 | 122 |
| 482 | 3300046559 | Ga0495667_0000265 | Ga0495667_0000265_19732_20130 | 122 |
| 483 | 3300046642 | Ga0495634_0000191 | Ga0495634_0000191_12230_12628 | 122 |
| 484 | 3300046642 | Ga0495634_0188219 | Ga0495634_0188219_184_582 | 122 |
| 485 | 3300046660 | Ga0495625_0000243 | Ga0495625_0000243_16534_16932 | 122 |
| 486 | 3300046663 | Ga0495635_0000182 | Ga0495635_0000182_8690_9088 | 122 |
| 487 | 3300046663 | Ga0495635_0107909 | Ga0495635_0107909_915_1316 | 122 |
| 488 | 3300046674 | Ga0495588_0000266 | Ga0495588_0000266_13728_14126 | 122 |
| 489 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_210337_210708 | 122 |
| 490 | 3300046675 | Ga0495657_0009610 | Ga0495657_0009610_4786_5184 | 122 |
| 491 | 3300046675 | Ga0495657_0325707 | Ga0495657_0325707_279_677 | 122 |
| 492 | 3300046678 | Ga0495599_0110208 | Ga0495599_0110208_1255_1653 | 122 |
| 493 | 3300046678 | Ga0495599_0270545 | Ga0495599_0270545_261_671 | 122 |
| 494 | 3300046680 | Ga0495646_0222613 | Ga0495646_0222613_159_557 | 122 |
| 495 | 3300046681 | Ga0495647_0000005 | Ga0495647_0000005_38177_38575 | 122 |
| 496 | 3300046681 | Ga0495647_0001427 | Ga0495647_0001427_4072_4470 | 122 |
| 497 | 3300046681 | Ga0495647_0011078 | Ga0495647_0011078_1139_1537 | 122 |
| 498 | 3300046683 | Ga0495658_0089324 | Ga0495658_0089324_88_486 | 122 |
| 499 | 3300046684 | Ga0495669_0000248 | Ga0495669_0000248_1520_1918 | 122 |
| 500 | 3300046684 | Ga0495669_0018718 | Ga0495669_0018718_2210_2608 | 122 |
| 501 | 3300046689 | Ga0495613_0000173 | Ga0495613_0000173_49954_50352 | 122 |
| 502 | 3300046689 | Ga0495613_0000233 | Ga0495613_0000233_6140_6538 | 122 |
| 503 | 3300046689 | Ga0495613_0341865 | Ga0495613_0341865_497_865 | 122 |
| 504 | 3300046690 | Ga0495624_0000563 | Ga0495624_0000563_9707_10105 | 122 |
| 505 | 3300046690 | Ga0495624_0000600 | Ga0495624_0000600_12056_12454 | 122 |
| 506 | 3300046691 | Ga0495670_0104819 | Ga0495670_0104819_679_1077 | 122 |
| 507 | 3300046694 | Ga0495649_0007268 | Ga0495649_0007268_437_835 | 122 |
| 508 | 3300046809 | Ga0495600_0002279 | Ga0495600_0002279_1646_2044 | 122 |
| 509 | 3300046809 | Ga0495600_0007184 | Ga0495600_0007184_155_559 | 122 |
| 510 | 3300047315 | Ga0495581_0169689 | Ga0495581_0169689_599_997 | 122 |
| 511 | 3300047317 | Ga0495604_0000437 | Ga0495604_0000437_28065_28463 | 122 |
| 512 | 3300047317 | Ga0495604_0000509 | Ga0495604_0000509_29778_30176 | 122 |
| 513 | 3300047317 | Ga0495604_0049629 | Ga0495604_0049629_2429_2827 | 122 |
| 514 | 3300047317 | Ga0495604_0101081 | Ga0495604_0101081_694_1092 | 122 |
| 515 | 3300047319 | Ga0495674_0000039 | Ga0495674_0000039_27064_27462 | 122 |
| 516 | 3300047320 | Ga0495672_0043357 | Ga0495672_0043357_1759_2157 | 122 |
| 517 | 3300047320 | Ga0495672_0103231 | Ga0495672_0103231_688_1086 | 122 |
| 518 | 3300047321 | Ga0495676_0000320 | Ga0495676_0000320_21121_21519 | 122 |
| 519 | 3300047321 | Ga0495676_0009275 | Ga0495676_0009275_7368_7766 | 122 |
| 520 | 3300047321 | Ga0495676_0057377 | Ga0495676_0057377_2468_2866 | 122 |
| 521 | 3300047321 | Ga0495676_0153025 | Ga0495676_0153025_296_694 | 122 |
| 522 | 3300047321 | Ga0495676_0445721 | Ga0495676_0445721_173_571 | 122 |
| 523 | 3300047322 | Ga0495680_0000113 | Ga0495680_0000113_53144_53542 | 122 |
| 524 | 3300047322 | Ga0495680_0000513 | Ga0495680_0000513_10758_11156 | 122 |
| 525 | 3300047322 | Ga0495680_0005366 | Ga0495680_0005366_8355_8753 | 122 |
| 526 | 3300047322 | Ga0495680_0047844 | Ga0495680_0047844_2451_2849 | 122 |
| 527 | 3300047322 | Ga0495680_0094480 | Ga0495680_0094480_1686_2084 | 122 |
| 528 | 3300047322 | Ga0495680_0608104 | Ga0495680_0608104_263_661 | 122 |
| 529 | 3300047322 | Ga0495680_0802749 | Ga0495680_0802749_163_561 | 122 |
| 530 | 3300047444 | Ga0495675_0000002 | Ga0495675_0000002_210337_210708 | 122 |
| 531 | 3300047446 | Ga0495679_015058 | Ga0495679_015058_1045_1443 | 122 |
| 532 | 3300047447 | Ga0495685_065761 | Ga0495685_065761_473_871 | 122 |
| 533 | 3300047471 | Ga0495684_0755433 | Ga0495684_0755433_193_591 | 122 |
| 534 | 3300047472 | Ga0495686_0102809 | Ga0495686_0102809_871_1269 | 122 |
| 535 | 3300047673 | Ga0495593_0263367 | Ga0495593_0263367_50_448 | 122 |
| 536 | 3300048088 | Ga0495602_0000034 | Ga0495602_0000034_24852_25250 | 122 |
| 537 | 3300048088 | Ga0495602_0000315 | Ga0495602_0000315_31289_31687 | 122 |
| 538 | 3300048088 | Ga0495602_0102049 | Ga0495602_0102049_1267_1665 | 122 |
| 539 | 3300048088 | Ga0495602_0178057 | Ga0495602_0178057_618_1016 | 122 |
| 540 | 3300048088 | Ga0495602_0413779 | Ga0495602_0413779_535_933 | 122 |
| 541 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_28308_28706 | 122 |
| 542 | 3300048903 | Ga0496100_0000234 | Ga0496100_0000234_6737_7135 | 122 |
| 543 | 3300048904 | Ga0496101_0000028 | Ga0496101_0000028_28297_28695 | 122 |
| 544 | 3300048904 | Ga0496101_0000382 | Ga0496101_0000382_6737_7135 | 122 |
| 545 | 3300048905 | Ga0496102_0056244 | Ga0496102_0056244_1381_1779 | 122 |
| 546 | 3300048905 | Ga0496102_0411497 | Ga0496102_0411497_81_482 | 122 |
| 547 | 3300048905 | Ga0496102_0636199 | Ga0496102_0636199_179_580 | 122 |
| 548 | 3300048906 | Ga0496103_0227247 | Ga0496103_0227247_608_1006 | 122 |
| 549 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_183708_184106 | 122 |
| 550 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_278530_278928 | 122 |
| 551 | 3300048907 | Ga0496104_0043010 | Ga0496104_0043010_1272_1697 | 122 |
| 552 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_183708_184106 | 122 |
| 553 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_278530_278928 | 122 |
| 554 | 3300048908 | Ga0496105_0000051 | Ga0496105_0000051_12345_12770 | 122 |
| 555 | 3300048909 | Ga0496106_0000134 | Ga0496106_0000134_38367_38765 | 122 |
| 556 | 3300048909 | Ga0496106_0000172 | Ga0496106_0000172_28948_29346 | 122 |
| 557 | 3300048909 | Ga0496106_0000455 | Ga0496106_0000455_22174_22572 | 122 |
| 558 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_219782_220180 | 122 |
| 559 | 3300048910 | Ga0496107_0000234 | Ga0496107_0000234_6725_7123 | 122 |
| 560 | 3300048910 | Ga0496107_0009773 | Ga0496107_0009773_5992_6390 | 122 |
| 561 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_409631_410029 | 122 |
| 562 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_498481_498879 | 122 |
| 563 | 3300048911 | Ga0496108_0013089 | Ga0496108_0013089_88_486 | 122 |
| 564 | 3300048911 | Ga0496108_0340522 | Ga0496108_0340522_730_1128 | 122 |
| 565 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_36213_36611 | 122 |
| 566 | 3300048912 | Ga0496109_0000011 | Ga0496109_0000011_13167_13565 | 122 |
| 567 | 3300048912 | Ga0496109_0000013 | Ga0496109_0000013_92072_92470 | 122 |
| 568 | 3300048912 | Ga0496109_0209810 | Ga0496109_0209810_679_1080 | 122 |
| 569 | 3300048912 | Ga0496109_0388835 | Ga0496109_0388835_256_654 | 122 |
| 570 | 3300048912 | Ga0496109_2022082 | Ga0496109_2022082_55_453 | 122 |
| 571 | 3300048913 | Ga0496110_0000185 | Ga0496110_0000185_3880_4278 | 122 |
| 572 | 3300048913 | Ga0496110_0001335 | Ga0496110_0001335_7876_8274 | 122 |
| 573 | 3300048913 | Ga0496110_0023711 | Ga0496110_0023711_2915_3316 | 122 |
| 574 | 3300048913 | Ga0496110_0061760 | Ga0496110_0061760_421_819 | 122 |
| 575 | 3300048913 | Ga0496110_0853698 | Ga0496110_0853698_71_472 | 122 |
| 576 | 3300048913 | Ga0496110_1081795 | Ga0496110_1081795_255_653 | 122 |
| 577 | 3300048914 | Ga0496111_0000103 | Ga0496111_0000103_12535_12933 | 122 |
| 578 | 3300048914 | Ga0496111_0312986 | Ga0496111_0312986_434_832 | 122 |
| 579 | 3300048914 | Ga0496111_0583240 | Ga0496111_0583240_313_711 | 122 |
| 580 | 3300048914 | Ga0496111_0900609 | Ga0496111_0900609_14_412 | 122 |
| 581 | 3300048915 | Ga0496112_0000026 | Ga0496112_0000026_85649_86047 | 122 |
| 582 | 3300048915 | Ga0496112_0000661 | Ga0496112_0000661_10262_10660 | 122 |
| 583 | 3300048915 | Ga0496112_0281563 | Ga0496112_0281563_638_1036 | 122 |
| 584 | 3300048915 | Ga0496112_0385140 | Ga0496112_0385140_68_469 | 122 |
| 585 | 3300048915 | Ga0496112_1011216 | Ga0496112_1011216_166_564 | 122 |
| 586 | 3300048915 | Ga0496112_1198059 | Ga0496112_1198059_81_479 | 122 |
| 587 | 3300048915 | Ga0496112_1644325 | Ga0496112_1644325_81_479 | 122 |
| 588 | 3300048916 | Ga0496113_0000017 | Ga0496113_0000017_70460_70858 | 122 |
| 589 | 3300048916 | Ga0496113_0005910 | Ga0496113_0005910_6289_6687 | 122 |
| 590 | 3300048916 | Ga0496113_0093778 | Ga0496113_0093778_1418_1816 | 122 |
| 591 | 3300048916 | Ga0496113_0245149 | Ga0496113_0245149_488_889 | 122 |
| 592 | 3300048916 | Ga0496113_0592722 | Ga0496113_0592722_245_643 | 122 |
| 593 | 3300048917 | Ga0496114_0037828 | Ga0496114_0037828_18_416 | 122 |
| 594 | 3300048918 | Ga0496115_0000022 | Ga0496115_0000022_125945_126343 | 122 |
| 595 | 3300048918 | Ga0496115_0015665 | Ga0496115_0015665_4604_5002 | 122 |
| 596 | 3300048922 | Ga0496119_0015154 | Ga0496119_0015154_4394_4792 | 122 |
| 597 | 3300048923 | Ga0496120_0031163 | Ga0496120_0031163_1760_2158 | 122 |
| 598 | 3300048927 | Ga0496124_0274072 | Ga0496124_0274072_78_476 | 122 |
| 599 | 3300048928 | Ga0496125_0296877 | Ga0496125_0296877_204_602 | 122 |
| 600 | 3300049571 | Ga0501034_0002876 | Ga0501034_0002876_6005_6403 | 122 |
| 601 | 3300049571 | Ga0501034_0035223 | Ga0501034_0035223_1814_2212 | 122 |
| 602 | 3300049571 | Ga0501034_0092678 | Ga0501034_0092678_2248_2646 | 122 |
| 603 | 3300049571 | Ga0501034_0176227 | Ga0501034_0176227_1406_1804 | 122 |
| 604 | 3300049571 | Ga0501034_0968362 | Ga0501034_0968362_216_614 | 122 |
| 605 | 3300049578 | Ga0501042_0014137 | Ga0501042_0014137_536_934 | 122 |
| 606 | 3300049578 | Ga0501042_0086233 | Ga0501042_0086233_1397_1795 | 122 |
| 607 | 3300049578 | Ga0501042_0308659 | Ga0501042_0308659_592_990 | 122 |
| 608 | 3300049581 | Ga0501047_0051756 | Ga0501047_0051756_488_886 | 122 |
| 609 | 3300049583 | Ga0501067_0082768 | Ga0501067_0082768_916_1314 | 122 |
| 610 | 3300049584 | Ga0501068_0158624 | Ga0501068_0158624_860_1258 | 122 |
| 611 | 3300049584 | Ga0501068_0180836 | Ga0501068_0180836_596_994 | 122 |
| 612 | 3300049584 | Ga0501068_0242891 | Ga0501068_0242891_219_617 | 122 |
| 613 | 3300049585 | Ga0501069_0081767 | Ga0501069_0081767_846_1244 | 122 |
| 614 | 3300049586 | Ga0501070_0056882 | Ga0501070_0056882_2067_2465 | 122 |
| 615 | 3300049586 | Ga0501070_0171733 | Ga0501070_0171733_723_1121 | 122 |
| 616 | 3300049587 | Ga0501071_0520078 | Ga0501071_0520078_442_840 | 122 |
| 617 | 3300049588 | Ga0501072_0194070 | Ga0501072_0194070_525_923 | 122 |
| 618 | 3300049588 | Ga0501072_0474369 | Ga0501072_0474369_445_843 | 122 |
| 619 | 3300049588 | Ga0501072_1396853 | Ga0501072_1396853_105_509 | 122 |
| 620 | 3300049589 | Ga0501073_0403410 | Ga0501073_0403410_322_720 | 122 |
| 621 | 3300049590 | Ga0501074_0200930 | Ga0501074_0200930_651_1049 | 122 |
| 622 | 3300049591 | Ga0501075_0001603 | Ga0501075_0001603_11186_11584 | 122 |
| 623 | 3300049592 | Ga0501076_0100114 | Ga0501076_0100114_1902_2300 | 122 |
| 624 | 3300049592 | Ga0501076_0852228 | Ga0501076_0852228_229_633 | 122 |
| 625 | 3300049741 | Ga0501079_0745431 | Ga0501079_0745431_25_405 | 122 |
| 626 | 3300049742 | Ga0501080_0220594 | Ga0501080_0220594_453_851 | 122 |
| 627 | 3300049744 | Ga0501083_0572237 | Ga0501083_0572237_76_474 | 122 |
| 628 | 3300049822 | Ga0501035_1194400 | Ga0501035_1194400_88_486 | 122 |
| 629 | 3300050491 | nmdc:mga00v17_12096_c1 | nmdc:mga00v17_12096_c1_180_578 | 122 |
| 630 | 3300050491 | nmdc:mga00v17_68915_c1 | nmdc:mga00v17_68915_c1_895_1293 | 122 |
| 631 | 3300050491 | nmdc:mga00v17_85669_c1 | nmdc:mga00v17_85669_c1_686_1084 | 122 |
| 632 | 3300050492 | nmdc:mga0yw44_15653_c1 | nmdc:mga0yw44_15653_c1_1540_1938 | 122 |
| 633 | 3300050492 | nmdc:mga0yw44_201986_c1 | nmdc:mga0yw44_201986_c1_440_838 | 122 |
| 634 | 3300050507 | nmdc:mga05p37_156002_c1 | nmdc:mga05p37_156002_c1_1238_1639 | 122 |
| 635 | 3300050509 | nmdc:mga0qj67_20491_c1 | nmdc:mga0qj67_20491_c1_2623_3021 | 122 |
| 636 | 3300050510 | nmdc:mga06r32_1489750_c1 | nmdc:mga06r32_1489750_c1_116_517 | 122 |
| 637 | 3300050512 | nmdc:mga0n895_106073_c1 | nmdc:mga0n895_106073_c1_508_909 | 122 |
| 638 | 3300050512 | nmdc:mga0n895_45699_c1 | nmdc:mga0n895_45699_c1_330_731 | 122 |
| 639 | 3300050515 | nmdc:mga0a205_281_c1 | nmdc:mga0a205_281_c1_34470_34853 | 122 |
| 640 | 3300050515 | nmdc:mga0a205_45873_c1 | nmdc:mga0a205_45873_c1_925_1326 | 122 |
| 641 | 3300053077 | Ga0495601_0000029 | Ga0495601_0000029_64617_65015 | 122 |
| 642 | 3300053077 | Ga0495601_0000444 | Ga0495601_0000444_15934_16332 | 122 |
| 643 | 3300053077 | Ga0495601_0014716 | Ga0495601_0014716_3374_3742 | 122 |
| 644 | 3300053077 | Ga0495601_0101836 | Ga0495601_0101836_634_1032 | 122 |
| 645 | 3300053077 | Ga0495601_0390189 | Ga0495601_0390189_377_775 | 122 |
| 646 | 3300053078 | Ga0495612_0001200 | Ga0495612_0001200_7415_7813 | 122 |
| 647 | 3300053078 | Ga0495612_0004444 | Ga0495612_0004444_4080_4478 | 122 |
| 648 | 3300053078 | Ga0495612_0025544 | Ga0495612_0025544_313_711 | 122 |
| 649 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_159161_159532 | 122 |
| 650 | 3300053084 | Ga0495595_0052701 | Ga0495595_0052701_825_1223 | 122 |
| 651 | 3300053085 | Ga0495619_0000026 | Ga0495619_0000026_13032_13403 | 122 |
| 652 | 3300053085 | Ga0495619_0000067 | Ga0495619_0000067_48657_49055 | 122 |
| 653 | 3300053085 | Ga0495619_0000205 | Ga0495619_0000205_19846_20244 | 122 |
| 654 | 3300053085 | Ga0495619_0002937 | Ga0495619_0002937_4804_5202 | 122 |
| 655 | 3300053094 | Ga0500566_0001360 | Ga0500566_0001360_555_953 | 122 |
| 656 | 3300053123 | Ga0500614_000263 | Ga0500614_000263_6505_6903 | 122 |
| 657 | 3300061734 | Ga0530510_0669914 | Ga0530510_0669914_83_481 | 122 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ld9-assembly1.cif.gz_B | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.9427 | 11 | 122 |
| 5ld9-assembly1.cif.gz_A | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.9215 | 11 | 122 |
| 2kks-assembly1.cif.gz_A | solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 | 0.9135 | 1 | 122 |
| 2kks-assembly1.cif.gz_A | solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 | 0.9067 | 1 | 122 |
| 5cw4-assembly1.cif.gz_A | structure of cfbrcc36-cfkiaa0157 complex (selenium edge) | 0.8315 | 4 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2kksA00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9135 | 1 | 122 | 3.40.140.10 |
| af_P9WHS1_10_146_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9128 | 1 | 118 | 3.40.140.10 |
| 2kksA00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9067 | 1 | 122 | 3.40.140.10 |
| af_Q54Z40_718_975_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8797 | 11 | 111 | 3.40.140.10 |
| af_P9WHS1_10_146_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8778 | 1 | 118 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3BKG2-F1-model_v4 | MPN domain-containing protein | 0.9938 | 1 | 122 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A1M3BKG2-F1-model_v4 | MPN domain-containing protein | 0.9857 | 1 | 122 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A532U8W9-F1-model_v4 | MPN domain-containing protein | 0.9836 | 1 | 122 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A354C0H7-F1-model_v4 | MPN domain-containing protein | 0.9808 | 2 | 122 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A1W1VZD0-F1-model_v4 | Proteasome lid subunit RPN8/RPN11, contains Jab1/MPN metalloenzyme (JAMM) motif | 0.9807 | 2 | 122 |
GO:0000502
GO:0006508 GO:0008235 GO:0008270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar