F473051

General Info

Members Datasets Scaffolds Average Seq Length
656 211 1312 71

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0336806|Ga0501071_0336806_130_369
Length 79
Sequence LGTVKEAVMAQDREKISTGPKEEPVNETIAGTGPGIPDDALAPGEEELPQPPSNEEVDEAARALEGPVAERDTLPLEGE

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
201 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
202 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
203 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
204 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
205 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
206 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
207 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
208 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
209 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
210 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.44
Rhizosphere 97.26
Stem 0
Stem Tuber 0
Unclassified 6.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0336806 3300049587 Bacteria 1147
2 JGI24741J21665_1007174 3300001915 Bacteria 2178
3 JGI24741J21665_1023594 3300001915 Bacteria 949
4 JGI24740J21852_10002546 3300001979 Bacteria 8220
5 JGI24740J21852_10002894 3300001979 Bacteria 7669
6 JGI24740J21852_10047389 3300001979 Bacteria 1255
7 JGI24739J22299_10000218 3300001989 Bacteria 19232
8 JGI24739J22299_10152297 3300001989 Bacteria 683
9 JGI24737J22298_10000015 3300001990 Bacteria 49821
10 JGI24737J22298_10089989 3300001990 Bacteria 911
11 JGI24735J21928_10004156 3300002067 Bacteria 4889
12 JGI24735J21928_10014576 3300002067 Bacteria 2461
13 JGI24738J21930_10001106 3300002075 Bacteria 7617
14 Ga0065715_10200829 3300005293 Bacteria 1362
15 Ga0070658_10065313 3300005327 Bacteria 2969
16 Ga0070658_10558871 3300005327 Bacteria 990
17 Ga0070658_10603313 3300005327 Bacteria 951
18 Ga0070658_10611501 3300005327 Unclassified 945
19 Ga0070658_10724865 3300005327 Bacteria 863
20 Ga0070658_10917765 3300005327 Bacteria 761
21 Ga0070676_10005458 3300005328 Bacteria 6771
22 Ga0070676_10445365 3300005328 Bacteria 909
23 Ga0070683_100059717 3300005329 Bacteria 3543
24 Ga0070683_100518095 3300005329 Bacteria 1139
25 Ga0070683_100544498 3300005329 Bacteria 1110
26 Ga0070683_100846765 3300005329 Bacteria 877
27 Ga0070690_100026475 3300005330 Bacteria 3577
28 Ga0070690_100750698 3300005330 Bacteria 753
29 Ga0070670_100014081 3300005331 Bacteria 6861
30 Ga0070670_100024597 3300005331 Bacteria 5178
31 Ga0070670_100067865 3300005331 Bacteria 3060
32 Ga0070670_100114608 3300005331 Bacteria 2324
33 Ga0070677_10042190 3300005333 Bacteria 1805
34 Ga0070677_10507550 3300005333 Unclassified 654
35 Ga0068869_100001179 3300005334 Bacteria 15349
36 Ga0070666_10004646 3300005335 Bacteria 8385
37 Ga0070666_10024115 3300005335 Bacteria 3962
38 Ga0070666_10708305 3300005335 Bacteria 738
39 Ga0070666_10903478 3300005335 Bacteria 653
40 Ga0070680_100002976 3300005336 Bacteria 12592
41 Ga0070680_100082260 3300005336 Bacteria 2657
42 Ga0070680_100157407 3300005336 Bacteria 1909
43 Ga0070680_100540412 3300005336 Bacteria 998
44 Ga0070680_100721184 3300005336 Bacteria 858
45 Ga0070680_100751289 3300005336 Bacteria 840
46 Ga0070682_100071715 3300005337 Bacteria 2218
47 Ga0070682_100082636 3300005337 Bacteria 2082
48 Ga0070682_100336610 3300005337 Bacteria 1120
49 Ga0070682_100586846 3300005337 Bacteria 878
50 Ga0070682_100663826 3300005337 Bacteria 832
51 Ga0070682_101887680 3300005337 Unclassified 523
52 Ga0068868_100054412 3300005338 Bacteria 3154
53 Ga0068868_100110215 3300005338 Bacteria 2236
54 Ga0068868_100323674 3300005338 Bacteria 1314
55 Ga0070660_100006092 3300005339 Bacteria 8337
56 Ga0070660_100006447 3300005339 Bacteria 8136
57 Ga0070660_100010650 3300005339 Bacteria 6503
58 Ga0070660_100012520 3300005339 Bacteria 6060
59 Ga0070660_100030414 3300005339 Bacteria 4051
60 Ga0070660_100322050 3300005339 Bacteria 1270
61 Ga0070660_100454035 3300005339 Bacteria 1063
62 Ga0070689_100391634 3300005340 Bacteria 1173
63 Ga0070691_10010855 3300005341 Bacteria 4157
64 Ga0070687_100209301 3300005343 Bacteria 1187
65 Ga0070687_100287453 3300005343 Unclassified 1038
66 Ga0070661_100002456 3300005344 Bacteria 12715
67 Ga0070661_100063073 3300005344 Bacteria 2722
68 Ga0070661_100091792 3300005344 Bacteria 2249
69 Ga0070661_100100999 3300005344 Bacteria 2145
70 Ga0070661_100112718 3300005344 Unclassified 2032
71 Ga0070661_100141644 3300005344 Bacteria 1812
72 Ga0070661_100174943 3300005344 Bacteria 1631
73 Ga0070661_100238057 3300005344 Bacteria 1401
74 Ga0070661_100632371 3300005344 Unclassified 867
75 Ga0070692_10166265 3300005345 Bacteria 1268
76 Ga0070692_10274714 3300005345 Bacteria 1019
77 Ga0070668_100006467 3300005347 Bacteria 8687
78 Ga0070669_100006302 3300005353 Bacteria 8552
79 Ga0070669_100646746 3300005353 Bacteria 889
80 Ga0070669_101592419 3300005353 Bacteria 569
81 Ga0070675_100049024 3300005354 Bacteria 3465
82 Ga0070675_100059279 3300005354 Bacteria 3158
83 Ga0070675_100913386 3300005354 Bacteria 805
84 Ga0070671_100118756 3300005355 Bacteria 2225
85 Ga0070671_100146054 3300005355 Bacteria 1996
86 Ga0070671_101487269 3300005355 Bacteria 599
87 Ga0070673_100000046 3300005364 Bacteria 50435
88 Ga0070673_100943313 3300005364 Bacteria 801
89 Ga0070688_101680948 3300005365 Unclassified 519
90 Ga0070659_100005794 3300005366 Bacteria 8896
91 Ga0070659_100011500 3300005366 Bacteria 6546
92 Ga0070659_100047027 3300005366 Bacteria 3383
93 Ga0070659_100133330 3300005366 Bacteria 2019
94 Ga0070659_100176921 3300005366 Bacteria 1750
95 Ga0070659_100384550 3300005366 Bacteria 1182
96 Ga0070667_100010355 3300005367 Bacteria 7701
97 Ga0070667_100120901 3300005367 Bacteria 2278
98 Ga0070667_100973181 3300005367 Unclassified 791
99 Ga0070667_101121188 3300005367 Unclassified 736
100 Ga0070709_10184651 3300005434 Bacteria 1467
101 Ga0070714_100168057 3300005435 Unclassified 1989
102 Ga0070714_100302781 3300005435 Bacteria 1491
103 Ga0070714_100378012 3300005435 Bacteria 1335
104 Ga0070713_100072576 3300005436 Bacteria 2911
105 Ga0070711_101313226 3300005439 Bacteria 628
106 Ga0070663_100004760 3300005455 Bacteria 8011
107 Ga0070663_100186389 3300005455 Bacteria 1612
108 Ga0070663_100213211 3300005455 Bacteria 1513
109 Ga0070663_100307950 3300005455 Bacteria 1270
110 Ga0070663_100469918 3300005455 Bacteria 1040
111 Ga0070663_100967684 3300005455 Bacteria 738
112 Ga0070663_101226707 3300005455 Bacteria 660
113 Ga0070663_101472929 3300005455 Bacteria 604
114 Ga0070662_100001246 3300005457 Bacteria 15625
115 Ga0070662_100137916 3300005457 Bacteria 1887
116 Ga0070662_100433314 3300005457 Bacteria 1089
117 Ga0070662_100660891 3300005457 Bacteria 882
118 Ga0070662_101158676 3300005457 Bacteria 664
119 Ga0070681_10216855 3300005458 Bacteria 1829
120 Ga0070681_10247726 3300005458 Bacteria 1695
121 Ga0070681_10420745 3300005458 Bacteria 1248
122 Ga0070681_10574016 3300005458 Bacteria 1041
123 Ga0070681_11057763 3300005458 Bacteria 732
124 Ga0068867_100006944 3300005459 Bacteria 8010
125 Ga0068867_100908877 3300005459 Bacteria 793
126 Ga0070679_100313691 3300005530 Bacteria 1518
127 Ga0070679_100346910 3300005530 Bacteria 1432
128 Ga0070679_100422969 3300005530 Bacteria 1277
129 Ga0070679_100691429 3300005530 Bacteria 963
130 Ga0070679_100880515 3300005530 Bacteria 839
131 Ga0070684_100008663 3300005535 Bacteria 7972
132 Ga0070684_100013064 3300005535 Bacteria 6682
133 Ga0070684_100229308 3300005535 Bacteria 1696
134 Ga0070684_101932563 3300005535 Unclassified 557
135 Ga0068853_100004667 3300005539 Bacteria 10623
136 Ga0068853_100046873 3300005539 Bacteria 3708
137 Ga0068853_100069937 3300005539 Bacteria 3054
138 Ga0068853_100486708 3300005539 Bacteria 1163
139 Ga0068853_100489338 3300005539 Bacteria 1160
140 Ga0068853_100805059 3300005539 Bacteria 900
141 Ga0070672_100007001 3300005543 Bacteria 7631
142 Ga0070672_100030583 3300005543 Bacteria 4047
143 Ga0070686_100327383 3300005544 Bacteria 1144
144 Ga0070696_101315901 3300005546 Bacteria 614
145 Ga0070693_100172153 3300005547 Bacteria 1388
146 Ga0070693_101282550 3300005547 Unclassified 566
147 Ga0070665_100093000 3300005548 Bacteria 3020
148 Ga0070665_100340479 3300005548 Bacteria 1504
149 Ga0070665_102011762 3300005548 Bacteria 583
150 Ga0068855_100022003 3300005563 Bacteria 7645
151 Ga0068855_100204368 3300005563 Bacteria 2223
152 Ga0068855_100242909 3300005563 Bacteria 2011
153 Ga0068855_100310849 3300005563 Bacteria 1743
154 Ga0068855_100962191 3300005563 Bacteria 899
155 Ga0068855_101439833 3300005563 Bacteria 709
156 Ga0070664_100000207 3300005564 Bacteria 42082
157 Ga0070664_100005703 3300005564 Bacteria 10025
158 Ga0070664_100015541 3300005564 Bacteria 6228
159 Ga0070664_100021731 3300005564 Bacteria 5292
160 Ga0070664_100108431 3300005564 Bacteria 2421
161 Ga0070664_100179193 3300005564 Bacteria 1883
162 Ga0070664_101100150 3300005564 Bacteria 748
163 Ga0068857_100007016 3300005577 Bacteria 9695
164 Ga0068857_100057077 3300005577 Bacteria 3465
165 Ga0068857_100071095 3300005577 Bacteria 3100
166 Ga0068857_100113779 3300005577 Bacteria 2433
167 Ga0068857_100269667 3300005577 Bacteria 1564
168 Ga0068854_100007236 3300005578 Bacteria 7086
169 Ga0068854_100031249 3300005578 Bacteria 3699
170 Ga0068854_100045230 3300005578 Bacteria 3129
171 Ga0068854_100193574 3300005578 Bacteria 1594
172 Ga0068854_100263247 3300005578 Bacteria 1381
173 Ga0068854_101331967 3300005578 Bacteria 647
174 Ga0068856_100002243 3300005614 Bacteria 19957
175 Ga0068856_100113212 3300005614 Bacteria 2711
176 Ga0068856_100168718 3300005614 Bacteria 2200
177 Ga0068856_100380084 3300005614 Bacteria 1431
178 Ga0068856_100410083 3300005614 Bacteria 1375
179 Ga0068856_100431718 3300005614 Bacteria 1337
180 Ga0068856_101068688 3300005614 Bacteria 825
181 Ga0068856_101825251 3300005614 Bacteria 619
182 Ga0068856_102496022 3300005614 Bacteria 524
183 Ga0070702_101088416 3300005615 Bacteria 638
184 Ga0068852_100001072 3300005616 Bacteria 18069
185 Ga0068852_100049257 3300005616 Bacteria 3603
186 Ga0068852_100089348 3300005616 Bacteria 2753
187 Ga0068852_100117854 3300005616 Bacteria 2425
188 Ga0068852_100127307 3300005616 Bacteria 2341
189 Ga0068852_100186205 3300005616 Bacteria 1955
190 Ga0068852_100244837 3300005616 Bacteria 1715
191 Ga0068852_100278821 3300005616 Bacteria 1611
192 Ga0068852_100316362 3300005616 Bacteria 1515
193 Ga0068852_100426711 3300005616 Bacteria 1309
194 Ga0068852_100452289 3300005616 Bacteria 1271
195 Ga0068852_100752735 3300005616 Bacteria 986
196 Ga0068852_100796780 3300005616 Bacteria 959
197 Ga0068859_100012368 3300005617 Bacteria 8583
198 Ga0068859_102347913 3300005617 Bacteria 588
199 Ga0068859_102356215 3300005617 Bacteria 587
200 Ga0068864_100023424 3300005618 Bacteria 5185
201 Ga0068866_10169835 3300005718 Bacteria 1279
202 Ga0068861_101109776 3300005719 Bacteria 761
203 Ga0068851_10006876 3300005834 Bacteria 5211
204 Ga0068851_10028032 3300005834 Bacteria 2779
205 Ga0068851_10104380 3300005834 Bacteria 1507
206 Ga0068851_10225742 3300005834 Bacteria 1054
207 Ga0068851_10652815 3300005834 Unclassified 644
208 Ga0068863_100034502 3300005841 Bacteria 4819
209 Ga0068863_100080977 3300005841 Bacteria 3076
210 Ga0068858_100064099 3300005842 Bacteria 3401
211 Ga0068858_100108029 3300005842 Bacteria 2597
212 Ga0068858_101343187 3300005842 Bacteria 704
213 Ga0068860_100008637 3300005843 Bacteria 10152
214 Ga0068860_100609229 3300005843 Bacteria 1098
215 Ga0068862_100112618 3300005844 Bacteria 2390
216 Ga0070717_10114934 3300006028 Bacteria 2300
217 Ga0070712_100174839 3300006175 Bacteria 1669
218 Ga0097621_100029569 3300006237 Bacteria 4328
219 Ga0097621_101088925 3300006237 Bacteria 750
220 Ga0068871_100098503 3300006358 Bacteria 2446
221 Ga0068871_100912529 3300006358 Bacteria 815
222 Ga0068865_100042305 3300006881 Bacteria 3107
223 Ga0097620_100012369 3300006931 Bacteria 8583
224 Ga0097620_102347740 3300006931 Bacteria 588
225 Ga0097620_102355951 3300006931 Bacteria 587
226 Ga0105240_10129538 3300009093 Bacteria 3028
227 Ga0105240_10211328 3300009093 Bacteria 2267
228 Ga0105240_10833726 3300009093 Bacteria 997
229 Ga0105240_11175476 3300009093 Bacteria 813
230 Ga0105245_10002347 3300009098 Bacteria 17117
231 Ga0105245_11355697 3300009098 Bacteria 761
232 Ga0105241_10288571 3300009174 Bacteria 1404
233 Ga0105241_10579186 3300009174 Bacteria 1011
234 Ga0105241_10950176 3300009174 Bacteria 801
235 Ga0105242_10180460 3300009176 Bacteria 1862
236 Ga0105248_10002245 3300009177 Bacteria 21383
237 Ga0105248_10336841 3300009177 Bacteria 1699
238 Ga0105248_11579706 3300009177 Bacteria 743
239 Ga0105248_11580221 3300009177 Bacteria 743
240 Ga0105237_10024051 3300009545 Bacteria 6232
241 Ga0105238_10007012 3300009551 Bacteria 11270
242 Ga0105238_10640794 3300009551 Bacteria 1072
243 Ga0105238_12181821 3300009551 Bacteria 588
244 Ga0105239_10312993 3300010375 Bacteria 1770
245 Ga0105239_11162137 3300010375 Bacteria 889
246 Ga0105239_11751709 3300010375 Bacteria 719
247 Ga0105246_10146483 3300011119 Bacteria 1782
248 Ga0157373_10006064 3300013100 Bacteria 9039
249 Ga0157373_10027539 3300013100 Bacteria 4101
250 Ga0157373_10028058 3300013100 Bacteria 4061
251 Ga0157373_10043197 3300013100 Bacteria 3220
252 Ga0157373_10103018 3300013100 Bacteria 2008
253 Ga0157373_10125927 3300013100 Bacteria 1802
254 Ga0157373_10679042 3300013100 Bacteria 754
255 Ga0157371_10000867 3300013102 Bacteria 34332
256 Ga0157371_10019463 3300013102 Bacteria 5006
257 Ga0157371_10058850 3300013102 Bacteria 2725
258 Ga0157371_10089420 3300013102 Bacteria 2181
259 Ga0157371_10278907 3300013102 Bacteria 1207
260 Ga0157371_10986618 3300013102 Bacteria 642
261 Ga0157370_10011140 3300013104 Bacteria 9426
262 Ga0157370_10055006 3300013104 Bacteria 3793
263 Ga0157370_10115620 3300013104 Bacteria 2506
264 Ga0157370_10140243 3300013104 Bacteria 2252
265 Ga0157370_10181008 3300013104 Bacteria 1959
266 Ga0157370_11070202 3300013104 Bacteria 729
267 Ga0157369_10217704 3300013105 Bacteria 2000
268 Ga0157369_10223553 3300013105 Bacteria 1970
269 Ga0157369_10223928 3300013105 Bacteria 1968
270 Ga0157369_10262700 3300013105 Bacteria 1800
271 Ga0157369_10914631 3300013105 Bacteria 899
272 Ga0157369_11217989 3300013105 Bacteria 768
273 Ga0157369_12022287 3300013105 Unclassified 584
274 Ga0157374_10196534 3300013296 Bacteria 1974
275 Ga0157374_11457044 3300013296 Bacteria 708
276 Ga0157378_10013268 3300013297 Bacteria 7203
277 Ga0163162_10827195 3300013306 Bacteria 1042
278 Ga0157372_10015034 3300013307 Bacteria 8284
279 Ga0157372_10125942 3300013307 Bacteria 2945
280 Ga0157372_10756376 3300013307 Bacteria 1130
281 Ga0157372_11028017 3300013307 Bacteria 954
282 Ga0157372_11149022 3300013307 Bacteria 898
283 Ga0157372_12150792 3300013307 Bacteria 641
284 Ga0157372_12949016 3300013307 Bacteria 544
285 Ga0157375_10139993 3300013308 Bacteria 2546
286 Ga0157375_10287068 3300013308 Bacteria 1808
287 Ga0157375_10758896 3300013308 Bacteria 1121
288 Ga0157375_12405908 3300013308 Bacteria 628
289 Ga0182008_10647078 3300014497 Bacteria 598
290 Ga0157377_10047754 3300014745 Bacteria 2399
291 Ga0157376_11783826 3300014969 Bacteria 651
292 Ga0157376_12184078 3300014969 Bacteria 592
293 Ga0197907_11475648 3300020069 Bacteria 612
294 Ga0206353_10949361 3300020082 Bacteria 662
295 Ga0206353_11847157 3300020082 Bacteria 1258
296 Ga0207697_10000957 3300025315 Bacteria 16249
297 Ga0207656_10063927 3300025321 Bacteria 1621
298 Ga0207656_10076779 3300025321 Bacteria 1495
299 Ga0207656_10587688 3300025321 Unclassified 568
300 Ga0207682_10069573 3300025893 Bacteria 1489
301 Ga0207642_10319674 3300025899 Bacteria 906
302 Ga0207688_10000353 3300025901 Bacteria 21377
303 Ga0207680_10041294 3300025903 Bacteria 2690
304 Ga0207680_10114588 3300025903 Bacteria 1754
305 Ga0207680_10477026 3300025903 Bacteria 887
306 Ga0207680_10957821 3300025903 Bacteria 613
307 Ga0207647_10000778 3300025904 Bacteria 24806
308 Ga0207647_10001547 3300025904 Bacteria 17700
309 Ga0207647_10037318 3300025904 Bacteria 3082
310 Ga0207699_10824704 3300025906 Unclassified 682
311 Ga0207645_10004867 3300025907 Bacteria 9849
312 Ga0207645_10069272 3300025907 Bacteria 2257
313 Ga0207705_10000931 3300025909 Bacteria 23900
314 Ga0207705_10001618 3300025909 Bacteria 17874
315 Ga0207705_10006231 3300025909 Bacteria 8860
316 Ga0207705_10006634 3300025909 Bacteria 8566
317 Ga0207705_10007017 3300025909 Bacteria 8309
318 Ga0207705_10019412 3300025909 Bacteria 4861
319 Ga0207705_10047272 3300025909 Bacteria 3094
320 Ga0207705_10163281 3300025909 Bacteria 1674
321 Ga0207705_10314129 3300025909 Bacteria 1203
322 Ga0207705_10755658 3300025909 Bacteria 755
323 Ga0207654_10101946 3300025911 Bacteria 1770
324 Ga0207654_10163426 3300025911 Bacteria 1440
325 Ga0207654_10210158 3300025911 Bacteria 1286
326 Ga0207654_10255912 3300025911 Bacteria 1175
327 Ga0207707_10030954 3300025912 Bacteria 4680
328 Ga0207707_10191528 3300025912 Bacteria 1784
329 Ga0207707_10651964 3300025912 Unclassified 887
330 Ga0207707_11212823 3300025912 Bacteria 610
331 Ga0207695_10004498 3300025913 Bacteria 18977
332 Ga0207695_10027193 3300025913 Bacteria 6372
333 Ga0207695_10782003 3300025913 Bacteria 835
334 Ga0207671_10034162 3300025914 Bacteria 3780
335 Ga0207660_10021980 3300025917 Bacteria 4295
336 Ga0207660_10184588 3300025917 Unclassified 1622
337 Ga0207660_10346984 3300025917 Bacteria 1189
338 Ga0207660_10617883 3300025917 Bacteria 883
339 Ga0207660_11384346 3300025917 Bacteria 570
340 Ga0207662_10316432 3300025918 Bacteria 1041
341 Ga0207662_10388752 3300025918 Bacteria 944
342 Ga0207657_10000578 3300025919 Bacteria 38938
343 Ga0207657_10015498 3300025919 Bacteria 7383
344 Ga0207657_10016182 3300025919 Bacteria 7199
345 Ga0207657_10017200 3300025919 Bacteria 6946
346 Ga0207657_10018785 3300025919 Bacteria 6585
347 Ga0207657_10021416 3300025919 Bacteria 6083
348 Ga0207657_10022556 3300025919 Bacteria 5886
349 Ga0207657_10055929 3300025919 Bacteria 3406
350 Ga0207657_10059980 3300025919 Bacteria 3266
351 Ga0207657_10108833 3300025919 Bacteria 2291
352 Ga0207657_10159516 3300025919 Bacteria 1833
353 Ga0207657_10232159 3300025919 Bacteria 1475
354 Ga0207649_10003435 3300025920 Bacteria 8661
355 Ga0207649_10017810 3300025920 Bacteria 4029
356 Ga0207649_10036078 3300025920 Bacteria 2975
357 Ga0207649_10045030 3300025920 Bacteria 2703
358 Ga0207649_10119014 3300025920 Unclassified 1778
359 Ga0207649_10575530 3300025920 Bacteria 864
360 Ga0207649_10693705 3300025920 Bacteria 789
361 Ga0207649_10844926 3300025920 Bacteria 716
362 Ga0207649_11380788 3300025920 Unclassified 557
363 Ga0207652_10039493 3300025921 Bacteria 4005
364 Ga0207652_10150440 3300025921 Bacteria 2084
365 Ga0207652_10164116 3300025921 Bacteria 1991
366 Ga0207652_10469940 3300025921 Bacteria 1133
367 Ga0207652_10525226 3300025921 Bacteria 1065
368 Ga0207652_10971855 3300025921 Bacteria 747
369 Ga0207681_10021950 3300025923 Bacteria 4065
370 Ga0207681_11557400 3300025923 Bacteria 554
371 Ga0207650_10055351 3300025925 Bacteria 2945
372 Ga0207650_10121935 3300025925 Bacteria 2031
373 Ga0207659_10026901 3300025926 Bacteria 3887
374 Ga0207659_10125911 3300025926 Bacteria 1970
375 Ga0207687_10117891 3300025927 Bacteria 1981
376 Ga0207700_10065492 3300025928 Bacteria 2772
377 Ga0207700_10572486 3300025928 Unclassified 1004
378 Ga0207700_11784224 3300025928 Unclassified 541
379 Ga0207664_10010428 3300025929 Bacteria 6560
380 Ga0207664_10334389 3300025929 Bacteria 1338
381 Ga0207644_10032204 3300025931 Bacteria 3656
382 Ga0207644_10359520 3300025931 Bacteria 1184
383 Ga0207690_10024265 3300025932 Bacteria 3797
384 Ga0207690_10047097 3300025932 Bacteria 2859
385 Ga0207690_10101174 3300025932 Bacteria 2058
386 Ga0207690_10115764 3300025932 Bacteria 1938
387 Ga0207690_10324441 3300025932 Bacteria 1211
388 Ga0207690_10396572 3300025932 Unclassified 1100
389 Ga0207690_10490921 3300025932 Bacteria 992
390 Ga0207706_10002227 3300025933 Bacteria 18932
391 Ga0207706_10067865 3300025933 Bacteria 3139
392 Ga0207706_10177431 3300025933 Bacteria 1872
393 Ga0207706_10230207 3300025933 Bacteria 1622
394 Ga0207706_10483604 3300025933 Bacteria 1070
395 Ga0207670_11054716 3300025936 Bacteria 685
396 Ga0207691_10002986 3300025940 Bacteria 16500
397 Ga0207691_10144832 3300025940 Bacteria 2092
398 Ga0207711_10016009 3300025941 Bacteria 6222
399 Ga0207689_10000922 3300025942 Bacteria 28234
400 Ga0207661_10007514 3300025944 Bacteria 7748
401 Ga0207661_10143897 3300025944 Bacteria 2054
402 Ga0207661_10564824 3300025944 Bacteria 1043
403 Ga0207661_10579580 3300025944 Bacteria 1029
404 Ga0207661_12078264 3300025944 Bacteria 514
405 Ga0207679_10000286 3300025945 Bacteria 38353
406 Ga0207679_10018257 3300025945 Bacteria 4696
407 Ga0207679_10134154 3300025945 Bacteria 1991
408 Ga0207679_10201010 3300025945 Bacteria 1664
409 Ga0207679_10220572 3300025945 Bacteria 1595
410 Ga0207679_11357282 3300025945 Bacteria 652
411 Ga0207667_10007890 3300025949 Bacteria 12710
412 Ga0207667_10039806 3300025949 Bacteria 5006
413 Ga0207667_10048919 3300025949 Bacteria 4468
414 Ga0207667_10192842 3300025949 Bacteria 2090
415 Ga0207667_10233909 3300025949 Bacteria 1881
416 Ga0207667_10449135 3300025949 Bacteria 1310
417 Ga0207667_10449142 3300025949 Bacteria 1310
418 Ga0207651_10006123 3300025960 Bacteria 6253
419 Ga0207651_10023781 3300025960 Bacteria 3777
420 Ga0207651_10635687 3300025960 Bacteria 936
421 Ga0207668_10008981 3300025972 Bacteria 5977
422 Ga0207640_10008477 3300025981 Bacteria 5711
423 Ga0207640_10026245 3300025981 Bacteria 3535
424 Ga0207640_10061632 3300025981 Bacteria 2485
425 Ga0207640_10068519 3300025981 Bacteria 2378
426 Ga0207640_10216517 3300025981 Bacteria 1463
427 Ga0207640_10444490 3300025981 Bacteria 1067
428 Ga0207640_10622558 3300025981 Bacteria 916
429 Ga0207658_10029853 3300025986 Bacteria 3855
430 Ga0207658_10743598 3300025986 Bacteria 888
431 Ga0207658_11142146 3300025986 Unclassified 712
432 Ga0207677_10124989 3300026023 Bacteria 1942
433 Ga0207677_10166251 3300026023 Bacteria 1720
434 Ga0207677_10257934 3300026023 Bacteria 1419
435 Ga0207677_11552640 3300026023 Unclassified 612
436 Ga0207703_10008965 3300026035 Bacteria 7880
437 Ga0207703_10345625 3300026035 Bacteria 1368
438 Ga0207703_10647096 3300026035 Bacteria 1002
439 Ga0207703_11777986 3300026035 Bacteria 592
440 Ga0207639_10005010 3300026041 Bacteria 8923
441 Ga0207639_10052342 3300026041 Bacteria 3111
442 Ga0207639_10158550 3300026041 Bacteria 1904
443 Ga0207639_10173080 3300026041 Bacteria 1830
444 Ga0207639_10617793 3300026041 Bacteria 1000
445 Ga0207639_10938850 3300026041 Bacteria 809
446 Ga0207639_10958901 3300026041 Bacteria 800
447 Ga0207639_11808259 3300026041 Bacteria 572
448 Ga0207639_12302557 3300026041 Bacteria 500
449 Ga0207678_10000812 3300026067 Bacteria 28578
450 Ga0207678_10088877 3300026067 Bacteria 2641
451 Ga0207678_10104271 3300026067 Bacteria 2420
452 Ga0207678_10160540 3300026067 Bacteria 1920
453 Ga0207678_10168138 3300026067 Bacteria 1872
454 Ga0207678_10175047 3300026067 Bacteria 1832
455 Ga0207678_10185026 3300026067 Bacteria 1779
456 Ga0207702_10001061 3300026078 Bacteria 28175
457 Ga0207702_10008921 3300026078 Bacteria 8454
458 Ga0207702_10270167 3300026078 Bacteria 1603
459 Ga0207702_10563515 3300026078 Bacteria 1115
460 Ga0207702_10689797 3300026078 Bacteria 1006
461 Ga0207702_11187953 3300026078 Bacteria 757
462 Ga0207702_11432029 3300026078 Bacteria 685
463 Ga0207641_10372535 3300026088 Unclassified 1365
464 Ga0207648_10007086 3300026089 Bacteria 11065
465 Ga0207648_10037224 3300026089 Bacteria 4285
466 Ga0207648_10191281 3300026089 Bacteria 1814
467 Ga0207676_10066819 3300026095 Bacteria 2869
468 Ga0207674_10002907 3300026116 Bacteria 21278
469 Ga0207674_10013718 3300026116 Bacteria 8972
470 Ga0207674_10016766 3300026116 Bacteria 8007
471 Ga0207674_10061837 3300026116 Bacteria 3783
472 Ga0207674_10422045 3300026116 Bacteria 1289
473 Ga0207675_100322927 3300026118 Bacteria 1507
474 Ga0207698_10004015 3300026142 Bacteria 8931
475 Ga0207698_10024548 3300026142 Bacteria 4233
476 Ga0207698_10080454 3300026142 Bacteria 2625
477 Ga0207698_10179723 3300026142 Bacteria 1873
478 Ga0207698_10339068 3300026142 Bacteria 1415
479 Ga0207698_10357258 3300026142 Bacteria 1382
480 Ga0207698_10372151 3300026142 Bacteria 1356
481 Ga0207698_10393549 3300026142 Bacteria 1322
482 Ga0207698_10473736 3300026142 Bacteria 1213
483 Ga0207698_10651755 3300026142 Bacteria 1043
484 Ga0207698_12751704 3300026142 Unclassified 500
485 Ga0268266_10069689 3300028379 Bacteria 3047
486 Ga0268266_10402261 3300028379 Bacteria 1295
487 Ga0268266_11878980 3300028379 Bacteria 573
488 Ga0268264_10315955 3300028381 Unclassified 1475
489 Ga0268264_10964852 3300028381 Bacteria 858
490 Ga0307408_101390930 3300031548 Bacteria 660
491 Ga0307405_10232756 3300031731 Bacteria 1359
492 Ga0307413_10419880 3300031824 Bacteria 1053
493 Ga0307413_10464077 3300031824 Bacteria 1008
494 Ga0307410_10228872 3300031852 Bacteria 1434
495 Ga0307410_11976422 3300031852 Bacteria 520
496 Ga0307406_10402930 3300031901 Bacteria 1085
497 Ga0307406_11890438 3300031901 Bacteria 532
498 Ga0307407_10091341 3300031903 Bacteria 1867
499 Ga0307412_10471208 3300031911 Bacteria 1039
500 Ga0307409_101068935 3300031995 Bacteria 827
501 Ga0307409_102131703 3300031995 Bacteria 590
502 Ga0307416_100021447 3300032002 Bacteria 4637
503 Ga0307416_100042426 3300032002 Bacteria 3551
504 Ga0307416_102740245 3300032002 Bacteria 589
505 Ga0307414_11305015 3300032004 Bacteria 673
506 Ga0307411_10181961 3300032005 Bacteria 1596
507 Ga0307411_10396476 3300032005 Bacteria 1140
508 Ga0307411_10552199 3300032005 Bacteria 983
509 Ga0307411_11796899 3300032005 Unclassified 569
510 Ga0307415_100017190 3300032126 Bacteria 4330
511 Ga0307415_100116731 3300032126 Bacteria 1992
512 Ga0307415_100207075 3300032126 Bacteria 1561
513 Ga0307415_101219431 3300032126 Bacteria 709
514 Ga0373960_0275345 3300035121 Bacteria 619
515 Ga0395899_0000514 3300037312 Bacteria 42939
516 Ga0395899_0042592 3300037312 Bacteria 3388
517 Ga0395899_0043088 3300037312 Bacteria 3367
518 Ga0395899_0044347 3300037312 Bacteria 3314
519 Ga0395899_0065410 3300037312 Bacteria 2672
520 Ga0395899_0068499 3300037312 Bacteria 2601
521 Ga0395899_0168668 3300037312 Bacteria 1542
522 Ga0395899_0259391 3300037312 Bacteria 1189
523 Ga0395899_0389723 3300037312 Bacteria 924
524 Ga0395899_0627385 3300037312 Bacteria 682
525 Ga0395900_0001307 3300037418 Bacteria 30308
526 Ga0395900_0004798 3300037418 Bacteria 14244
527 Ga0395900_0035702 3300037418 Bacteria 5121
528 Ga0395900_0112671 3300037418 Bacteria 2793
529 Ga0395900_0146042 3300037418 Bacteria 2418
530 Ga0395900_0323956 3300037418 Bacteria 1520
531 Ga0395900_0323998 3300037418 Bacteria 1520
532 Ga0395900_0419850 3300037418 Bacteria 1298
533 Ga0395900_0512464 3300037418 Bacteria 1148
534 Ga0395900_0532401 3300037418 Bacteria 1121
535 Ga0395900_0701425 3300037418 Bacteria 945
536 Ga0395900_0904797 3300037418 Bacteria 806
537 Ga0395900_0925831 3300037418 Bacteria 794
538 Ga0395900_0995574 3300037418 Bacteria 758
539 Ga0395898_0000021 3300037466 Bacteria 393971
540 Ga0395898_0030986 3300037466 Bacteria 5348
541 Ga0395898_0081239 3300037466 Bacteria 3126
542 Ga0395898_0127354 3300037466 Bacteria 2439
543 Ga0395898_0140714 3300037466 Bacteria 2310
544 Ga0395898_0185944 3300037466 Bacteria 1985
545 Ga0395898_0342666 3300037466 Bacteria 1425
546 Ga0395898_0472265 3300037466 Bacteria 1193
547 Ga0395898_0526073 3300037466 Bacteria 1124
548 Ga0395898_0644755 3300037466 Bacteria 1001
549 Ga0395898_0673922 3300037466 Bacteria 976
550 Ga0395898_0776977 3300037466 Unclassified 898
551 Ga0395905_0000006 3300037471 Bacteria 549428
552 Ga0395905_0000935 3300037471 Bacteria 37721
553 Ga0395905_0008316 3300037471 Bacteria 10237
554 Ga0395905_0088653 3300037471 Bacteria 2900
555 Ga0395905_0178653 3300037471 Bacteria 1992
556 Ga0395905_0272394 3300037471 Bacteria 1579
557 Ga0395905_0319795 3300037471 Bacteria 1441
558 Ga0395905_0355856 3300037471 Bacteria 1356
559 Ga0395905_0392082 3300037471 Bacteria 1283
560 Ga0395905_0411416 3300037471 Unclassified 1248
561 Ga0395905_0542407 3300037471 Bacteria 1064
562 Ga0395905_0592355 3300037471 Bacteria 1010
563 Ga0395905_0616908 3300037471 Bacteria 986
564 Ga0395905_1894264 3300037471 Unclassified 502
565 Ga0395901_0003108 3300038443 Bacteria 16701
566 Ga0395901_0009853 3300038443 Bacteria 9685
567 Ga0395901_0020331 3300038443 Bacteria 6796
568 Ga0395901_0094477 3300038443 Bacteria 3132
569 Ga0395901_0146814 3300038443 Bacteria 2479
570 Ga0395901_0177992 3300038443 Bacteria 2230
571 Ga0395901_0214645 3300038443 Bacteria 2012
572 Ga0395901_0285013 3300038443 Bacteria 1715
573 Ga0395901_0532316 3300038443 Bacteria 1192
574 Ga0395901_0664099 3300038443 Bacteria 1044
575 Ga0395901_1696721 3300038443 Bacteria 583
576 Ga0395901_1826275 3300038443 Bacteria 556
577 Ga0436365_1581748 3300039437 Bacteria 13505
578 Ga0451802_1436034 3300041460 Bacteria 569
579 Ga0451802_1637520 3300041460 Bacteria 589
580 Ga0451853_2750480 3300041512 Unclassified 524
581 Ga0466969_0024278 3300044656 Bacteria 3118
582 Ga0466969_0152473 3300044656 Unclassified 1064
583 Ga0466972_0141654 3300044658 Bacteria 1132
584 Ga0466972_0184552 3300044658 Unclassified 978
585 Ga0466966_0030488 3300044684 Bacteria 3502
586 Ga0466966_0078607 3300044684 Bacteria 2057
587 Ga0466966_0600280 3300044684 Bacteria 663
588 Ga0466961_0101910 3300044693 Bacteria 1808
589 Ga0466961_0380229 3300044693 Bacteria 858
590 Ga0466961_0708837 3300044693 Bacteria 603
591 Ga0466961_0953964 3300044693 Unclassified 510
592 Ga0466963_0188293 3300044694 Bacteria 1442
593 Ga0466963_0222630 3300044694 Bacteria 1321
594 Ga0466963_0338973 3300044694 Unclassified 1058
595 Ga0466963_0467702 3300044694 Bacteria 890
596 Ga0466963_0866364 3300044694 Bacteria 637
597 Ga0466963_1033157 3300044694 Bacteria 578
598 Ga0466964_0348220 3300044706 Unclassified 760
599 Ga0466971_0033806 3300044719 Bacteria 2291
600 Ga0466971_0246457 3300044719 Unclassified 850
601 Ga0466970_0098006 3300044765 Bacteria 1595
602 Ga0466957_0070070 3300044842 Bacteria 2167
603 Ga0466957_0474276 3300044842 Bacteria 865
604 Ga0466957_0543526 3300044842 Bacteria 809
605 Ga0466957_1129117 3300044842 Unclassified 566
606 Ga0466960_0181628 3300044901 Bacteria 1141
607 Ga0466959_0195563 3300045049 Bacteria 1409
608 Ga0466959_0504821 3300045049 Bacteria 817
609 Ga0466958_0100745 3300045836 Bacteria 1796
610 Ga0466958_0170652 3300045836 Bacteria 1377
611 Ga0466958_0173980 3300045836 Bacteria 1364
612 Ga0466967_0012098 3300045976 Bacteria 6581
613 Ga0466967_0053362 3300045976 Bacteria 3552
614 Ga0466967_0087765 3300045976 Bacteria 2821
615 Ga0466967_0334790 3300045976 Bacteria 1462
616 Ga0466967_0363328 3300045976 Bacteria 1403
617 Ga0466967_1118238 3300045976 Bacteria 785
618 Ga0495629_0504188 3300046459 Bacteria 816
619 Ga0495669_0025587 3300046684 Bacteria 2574
620 Ga0495677_0308726 3300047445 Bacteria 622
621 Ga0495685_063285 3300047447 Bacteria 1245
622 Ga0496106_0796681 3300048909 Bacteria 750
623 Ga0496107_0451989 3300048910 Bacteria 954
624 Ga0496107_1222184 3300048910 Unclassified 540
625 Ga0496108_0152226 3300048911 Bacteria 1996
626 Ga0496109_0190861 3300048912 Bacteria 1925
627 Ga0496109_0426152 3300048912 Bacteria 1253
628 Ga0496109_0943163 3300048912 Bacteria 801
629 Ga0496110_0761147 3300048913 Bacteria 872
630 Ga0496111_0095805 3300048914 Bacteria 2178
631 Ga0496111_0106023 3300048914 Bacteria 2068
632 Ga0496112_0072720 3300048915 Bacteria 3399
633 Ga0496112_0151736 3300048915 Bacteria 2284
634 Ga0496113_0040843 3300048916 Bacteria 3420
635 Ga0496113_1046100 3300048916 Bacteria 642
636 Ga0501070_0075267 3300049586 Bacteria 2795
637 Ga0501073_1179347 3300049589 Unclassified 526
638 Ga0501209_079588 3300049656 Unclassified 943
639 Ga0501217_279896 3300049661 Bacteria 546
640 Ga0501223_026900 3300049663 Bacteria 1120
641 Ga0501223_133351 3300049663 Bacteria 531
642 Ga0501224_010922 3300049664 Bacteria 1333
643 Ga0501235_186852 3300049669 Bacteria 555
644 Ga0501240_016842 3300049673 Bacteria 1056
645 Ga0501247_067608 3300049677 Bacteria 559
646 Ga0501248_015037 3300049678 Bacteria 741
647 Ga0501249_024174 3300049679 Bacteria 1338
648 Ga0501225_0238520 3300049705 Bacteria 593
649 Ga0501262_002726 3300049759 Bacteria 1994
650 Ga0501266_091802 3300049763 Bacteria 528
651 Ga0501268_008697 3300049765 Bacteria 1545
652 Ga0501268_061083 3300049765 Unclassified 747
653 Ga0501270_005526 3300049767 Unclassified 1473
654 Ga0501273_018530 3300049770 Bacteria 927
655 Ga0501212_019908 3300049851 Bacteria 1031
656 Ga0466962_0042161 3300061719 Bacteria 2184
657 Ga0501071_0336806
658 JGI24741J21665_1007174
659 JGI24741J21665_1023594
660 JGI24740J21852_10002546
661 JGI24740J21852_10002894
662 JGI24740J21852_10047389
663 JGI24739J22299_10000218
664 JGI24739J22299_10152297
665 JGI24737J22298_10000015
666 JGI24737J22298_10089989
667 JGI24735J21928_10004156
668 JGI24735J21928_10014576
669 JGI24738J21930_10001106
670 Ga0065715_10200829
671 Ga0070658_10065313
672 Ga0070658_10558871
673 Ga0070658_10603313
674 Ga0070658_10611501
675 Ga0070658_10724865
676 Ga0070658_10917765
677 Ga0070676_10005458
678 Ga0070676_10445365
679 Ga0070683_100059717
680 Ga0070683_100518095
681 Ga0070683_100544498
682 Ga0070683_100846765
683 Ga0070690_100026475
684 Ga0070690_100750698
685 Ga0070670_100014081
686 Ga0070670_100024597
687 Ga0070670_100067865
688 Ga0070670_100114608
689 Ga0070677_10042190
690 Ga0070677_10507550
691 Ga0068869_100001179
692 Ga0070666_10004646
693 Ga0070666_10024115
694 Ga0070666_10708305
695 Ga0070666_10903478
696 Ga0070680_100002976
697 Ga0070680_100082260
698 Ga0070680_100157407
699 Ga0070680_100540412
700 Ga0070680_100721184
701 Ga0070680_100751289
702 Ga0070682_100071715
703 Ga0070682_100082636
704 Ga0070682_100336610
705 Ga0070682_100586846
706 Ga0070682_100663826
707 Ga0070682_101887680
708 Ga0068868_100054412
709 Ga0068868_100110215
710 Ga0068868_100323674
711 Ga0070660_100006092
712 Ga0070660_100006447
713 Ga0070660_100010650
714 Ga0070660_100012520
715 Ga0070660_100030414
716 Ga0070660_100322050
717 Ga0070660_100454035
718 Ga0070689_100391634
719 Ga0070691_10010855
720 Ga0070687_100209301
721 Ga0070687_100287453
722 Ga0070661_100002456
723 Ga0070661_100063073
724 Ga0070661_100091792
725 Ga0070661_100100999
726 Ga0070661_100112718
727 Ga0070661_100141644
728 Ga0070661_100174943
729 Ga0070661_100238057
730 Ga0070661_100632371
731 Ga0070692_10166265
732 Ga0070692_10274714
733 Ga0070668_100006467
734 Ga0070669_100006302
735 Ga0070669_100646746
736 Ga0070669_101592419
737 Ga0070675_100049024
738 Ga0070675_100059279
739 Ga0070675_100913386
740 Ga0070671_100118756
741 Ga0070671_100146054
742 Ga0070671_101487269
743 Ga0070673_100000046
744 Ga0070673_100943313
745 Ga0070688_101680948
746 Ga0070659_100005794
747 Ga0070659_100011500
748 Ga0070659_100047027
749 Ga0070659_100133330
750 Ga0070659_100176921
751 Ga0070659_100384550
752 Ga0070667_100010355
753 Ga0070667_100120901
754 Ga0070667_100973181
755 Ga0070667_101121188
756 Ga0070709_10184651
757 Ga0070714_100168057
758 Ga0070714_100302781
759 Ga0070714_100378012
760 Ga0070713_100072576
761 Ga0070711_101313226
762 Ga0070663_100004760
763 Ga0070663_100186389
764 Ga0070663_100213211
765 Ga0070663_100307950
766 Ga0070663_100469918
767 Ga0070663_100967684
768 Ga0070663_101226707
769 Ga0070663_101472929
770 Ga0070662_100001246
771 Ga0070662_100137916
772 Ga0070662_100433314
773 Ga0070662_100660891
774 Ga0070662_101158676
775 Ga0070681_10216855
776 Ga0070681_10247726
777 Ga0070681_10420745
778 Ga0070681_10574016
779 Ga0070681_11057763
780 Ga0068867_100006944
781 Ga0068867_100908877
782 Ga0070679_100313691
783 Ga0070679_100346910
784 Ga0070679_100422969
785 Ga0070679_100691429
786 Ga0070679_100880515
787 Ga0070684_100008663
788 Ga0070684_100013064
789 Ga0070684_100229308
790 Ga0070684_101932563
791 Ga0068853_100004667
792 Ga0068853_100046873
793 Ga0068853_100069937
794 Ga0068853_100486708
795 Ga0068853_100489338
796 Ga0068853_100805059
797 Ga0070672_100007001
798 Ga0070672_100030583
799 Ga0070686_100327383
800 Ga0070696_101315901
801 Ga0070693_100172153
802 Ga0070693_101282550
803 Ga0070665_100093000
804 Ga0070665_100340479
805 Ga0070665_102011762
806 Ga0068855_100022003
807 Ga0068855_100204368
808 Ga0068855_100242909
809 Ga0068855_100310849
810 Ga0068855_100962191
811 Ga0068855_101439833
812 Ga0070664_100000207
813 Ga0070664_100005703
814 Ga0070664_100015541
815 Ga0070664_100021731
816 Ga0070664_100108431
817 Ga0070664_100179193
818 Ga0070664_101100150
819 Ga0068857_100007016
820 Ga0068857_100057077
821 Ga0068857_100071095
822 Ga0068857_100113779
823 Ga0068857_100269667
824 Ga0068854_100007236
825 Ga0068854_100031249
826 Ga0068854_100045230
827 Ga0068854_100193574
828 Ga0068854_100263247
829 Ga0068854_101331967
830 Ga0068856_100002243
831 Ga0068856_100113212
832 Ga0068856_100168718
833 Ga0068856_100380084
834 Ga0068856_100410083
835 Ga0068856_100431718
836 Ga0068856_101068688
837 Ga0068856_101825251
838 Ga0068856_102496022
839 Ga0070702_101088416
840 Ga0068852_100001072
841 Ga0068852_100049257
842 Ga0068852_100089348
843 Ga0068852_100117854
844 Ga0068852_100127307
845 Ga0068852_100186205
846 Ga0068852_100244837
847 Ga0068852_100278821
848 Ga0068852_100316362
849 Ga0068852_100426711
850 Ga0068852_100452289
851 Ga0068852_100752735
852 Ga0068852_100796780
853 Ga0068859_100012368
854 Ga0068859_102347913
855 Ga0068859_102356215
856 Ga0068864_100023424
857 Ga0068866_10169835
858 Ga0068861_101109776
859 Ga0068851_10006876
860 Ga0068851_10028032
861 Ga0068851_10104380
862 Ga0068851_10225742
863 Ga0068851_10652815
864 Ga0068863_100034502
865 Ga0068863_100080977
866 Ga0068858_100064099
867 Ga0068858_100108029
868 Ga0068858_101343187
869 Ga0068860_100008637
870 Ga0068860_100609229
871 Ga0068862_100112618
872 Ga0070717_10114934
873 Ga0070712_100174839
874 Ga0097621_100029569
875 Ga0097621_101088925
876 Ga0068871_100098503
877 Ga0068871_100912529
878 Ga0068865_100042305
879 Ga0097620_100012369
880 Ga0097620_102347740
881 Ga0097620_102355951
882 Ga0105240_10129538
883 Ga0105240_10211328
884 Ga0105240_10833726
885 Ga0105240_11175476
886 Ga0105245_10002347
887 Ga0105245_11355697
888 Ga0105241_10288571
889 Ga0105241_10579186
890 Ga0105241_10950176
891 Ga0105242_10180460
892 Ga0105248_10002245
893 Ga0105248_10336841
894 Ga0105248_11579706
895 Ga0105248_11580221
896 Ga0105237_10024051
897 Ga0105238_10007012
898 Ga0105238_10640794
899 Ga0105238_12181821
900 Ga0105239_10312993
901 Ga0105239_11162137
902 Ga0105239_11751709
903 Ga0105246_10146483
904 Ga0157373_10006064
905 Ga0157373_10027539
906 Ga0157373_10028058
907 Ga0157373_10043197
908 Ga0157373_10103018
909 Ga0157373_10125927
910 Ga0157373_10679042
911 Ga0157371_10000867
912 Ga0157371_10019463
913 Ga0157371_10058850
914 Ga0157371_10089420
915 Ga0157371_10278907
916 Ga0157371_10986618
917 Ga0157370_10011140
918 Ga0157370_10055006
919 Ga0157370_10115620
920 Ga0157370_10140243
921 Ga0157370_10181008
922 Ga0157370_11070202
923 Ga0157369_10217704
924 Ga0157369_10223553
925 Ga0157369_10223928
926 Ga0157369_10262700
927 Ga0157369_10914631
928 Ga0157369_11217989
929 Ga0157369_12022287
930 Ga0157374_10196534
931 Ga0157374_11457044
932 Ga0157378_10013268
933 Ga0163162_10827195
934 Ga0157372_10015034
935 Ga0157372_10125942
936 Ga0157372_10756376
937 Ga0157372_11028017
938 Ga0157372_11149022
939 Ga0157372_12150792
940 Ga0157372_12949016
941 Ga0157375_10139993
942 Ga0157375_10287068
943 Ga0157375_10758896
944 Ga0157375_12405908
945 Ga0182008_10647078
946 Ga0157377_10047754
947 Ga0157376_11783826
948 Ga0157376_12184078
949 Ga0197907_11475648
950 Ga0206353_10949361
951 Ga0206353_11847157
952 Ga0207697_10000957
953 Ga0207656_10063927
954 Ga0207656_10076779
955 Ga0207656_10587688
956 Ga0207682_10069573
957 Ga0207642_10319674
958 Ga0207688_10000353
959 Ga0207680_10041294
960 Ga0207680_10114588
961 Ga0207680_10477026
962 Ga0207680_10957821
963 Ga0207647_10000778
964 Ga0207647_10001547
965 Ga0207647_10037318
966 Ga0207699_10824704
967 Ga0207645_10004867
968 Ga0207645_10069272
969 Ga0207705_10000931
970 Ga0207705_10001618
971 Ga0207705_10006231
972 Ga0207705_10006634
973 Ga0207705_10007017
974 Ga0207705_10019412
975 Ga0207705_10047272
976 Ga0207705_10163281
977 Ga0207705_10314129
978 Ga0207705_10755658
979 Ga0207654_10101946
980 Ga0207654_10163426
981 Ga0207654_10210158
982 Ga0207654_10255912
983 Ga0207707_10030954
984 Ga0207707_10191528
985 Ga0207707_10651964
986 Ga0207707_11212823
987 Ga0207695_10004498
988 Ga0207695_10027193
989 Ga0207695_10782003
990 Ga0207671_10034162
991 Ga0207660_10021980
992 Ga0207660_10184588
993 Ga0207660_10346984
994 Ga0207660_10617883
995 Ga0207660_11384346
996 Ga0207662_10316432
997 Ga0207662_10388752
998 Ga0207657_10000578
999 Ga0207657_10015498
1000 Ga0207657_10016182
1001 Ga0207657_10017200
1002 Ga0207657_10018785
1003 Ga0207657_10021416
1004 Ga0207657_10022556
1005 Ga0207657_10055929
1006 Ga0207657_10059980
1007 Ga0207657_10108833
1008 Ga0207657_10159516
1009 Ga0207657_10232159
1010 Ga0207649_10003435
1011 Ga0207649_10017810
1012 Ga0207649_10036078
1013 Ga0207649_10045030
1014 Ga0207649_10119014
1015 Ga0207649_10575530
1016 Ga0207649_10693705
1017 Ga0207649_10844926
1018 Ga0207649_11380788
1019 Ga0207652_10039493
1020 Ga0207652_10150440
1021 Ga0207652_10164116
1022 Ga0207652_10469940
1023 Ga0207652_10525226
1024 Ga0207652_10971855
1025 Ga0207681_10021950
1026 Ga0207681_11557400
1027 Ga0207650_10055351
1028 Ga0207650_10121935
1029 Ga0207659_10026901
1030 Ga0207659_10125911
1031 Ga0207687_10117891
1032 Ga0207700_10065492
1033 Ga0207700_10572486
1034 Ga0207700_11784224
1035 Ga0207664_10010428
1036 Ga0207664_10334389
1037 Ga0207644_10032204
1038 Ga0207644_10359520
1039 Ga0207690_10024265
1040 Ga0207690_10047097
1041 Ga0207690_10101174
1042 Ga0207690_10115764
1043 Ga0207690_10324441
1044 Ga0207690_10396572
1045 Ga0207690_10490921
1046 Ga0207706_10002227
1047 Ga0207706_10067865
1048 Ga0207706_10177431
1049 Ga0207706_10230207
1050 Ga0207706_10483604
1051 Ga0207670_11054716
1052 Ga0207691_10002986
1053 Ga0207691_10144832
1054 Ga0207711_10016009
1055 Ga0207689_10000922
1056 Ga0207661_10007514
1057 Ga0207661_10143897
1058 Ga0207661_10564824
1059 Ga0207661_10579580
1060 Ga0207661_12078264
1061 Ga0207679_10000286
1062 Ga0207679_10018257
1063 Ga0207679_10134154
1064 Ga0207679_10201010
1065 Ga0207679_10220572
1066 Ga0207679_11357282
1067 Ga0207667_10007890
1068 Ga0207667_10039806
1069 Ga0207667_10048919
1070 Ga0207667_10192842
1071 Ga0207667_10233909
1072 Ga0207667_10449135
1073 Ga0207667_10449142
1074 Ga0207651_10006123
1075 Ga0207651_10023781
1076 Ga0207651_10635687
1077 Ga0207668_10008981
1078 Ga0207640_10008477
1079 Ga0207640_10026245
1080 Ga0207640_10061632
1081 Ga0207640_10068519
1082 Ga0207640_10216517
1083 Ga0207640_10444490
1084 Ga0207640_10622558
1085 Ga0207658_10029853
1086 Ga0207658_10743598
1087 Ga0207658_11142146
1088 Ga0207677_10124989
1089 Ga0207677_10166251
1090 Ga0207677_10257934
1091 Ga0207677_11552640
1092 Ga0207703_10008965
1093 Ga0207703_10345625
1094 Ga0207703_10647096
1095 Ga0207703_11777986
1096 Ga0207639_10005010
1097 Ga0207639_10052342
1098 Ga0207639_10158550
1099 Ga0207639_10173080
1100 Ga0207639_10617793
1101 Ga0207639_10938850
1102 Ga0207639_10958901
1103 Ga0207639_11808259
1104 Ga0207639_12302557
1105 Ga0207678_10000812
1106 Ga0207678_10088877
1107 Ga0207678_10104271
1108 Ga0207678_10160540
1109 Ga0207678_10168138
1110 Ga0207678_10175047
1111 Ga0207678_10185026
1112 Ga0207702_10001061
1113 Ga0207702_10008921
1114 Ga0207702_10270167
1115 Ga0207702_10563515
1116 Ga0207702_10689797
1117 Ga0207702_11187953
1118 Ga0207702_11432029
1119 Ga0207641_10372535
1120 Ga0207648_10007086
1121 Ga0207648_10037224
1122 Ga0207648_10191281
1123 Ga0207676_10066819
1124 Ga0207674_10002907
1125 Ga0207674_10013718
1126 Ga0207674_10016766
1127 Ga0207674_10061837
1128 Ga0207674_10422045
1129 Ga0207675_100322927
1130 Ga0207698_10004015
1131 Ga0207698_10024548
1132 Ga0207698_10080454
1133 Ga0207698_10179723
1134 Ga0207698_10339068
1135 Ga0207698_10357258
1136 Ga0207698_10372151
1137 Ga0207698_10393549
1138 Ga0207698_10473736
1139 Ga0207698_10651755
1140 Ga0207698_12751704
1141 Ga0268266_10069689
1142 Ga0268266_10402261
1143 Ga0268266_11878980
1144 Ga0268264_10315955
1145 Ga0268264_10964852
1146 Ga0307408_101390930
1147 Ga0307405_10232756
1148 Ga0307413_10419880
1149 Ga0307413_10464077
1150 Ga0307410_10228872
1151 Ga0307410_11976422
1152 Ga0307406_10402930
1153 Ga0307406_11890438
1154 Ga0307407_10091341
1155 Ga0307412_10471208
1156 Ga0307409_101068935
1157 Ga0307409_102131703
1158 Ga0307416_100021447
1159 Ga0307416_100042426
1160 Ga0307416_102740245
1161 Ga0307414_11305015
1162 Ga0307411_10181961
1163 Ga0307411_10396476
1164 Ga0307411_10552199
1165 Ga0307411_11796899
1166 Ga0307415_100017190
1167 Ga0307415_100116731
1168 Ga0307415_100207075
1169 Ga0307415_101219431
1170 Ga0373960_0275345
1171 Ga0395899_0000514
1172 Ga0395899_0042592
1173 Ga0395899_0043088
1174 Ga0395899_0044347
1175 Ga0395899_0065410
1176 Ga0395899_0068499
1177 Ga0395899_0168668
1178 Ga0395899_0259391
1179 Ga0395899_0389723
1180 Ga0395899_0627385
1181 Ga0395900_0001307
1182 Ga0395900_0004798
1183 Ga0395900_0035702
1184 Ga0395900_0112671
1185 Ga0395900_0146042
1186 Ga0395900_0323956
1187 Ga0395900_0323998
1188 Ga0395900_0419850
1189 Ga0395900_0512464
1190 Ga0395900_0532401
1191 Ga0395900_0701425
1192 Ga0395900_0904797
1193 Ga0395900_0925831
1194 Ga0395900_0995574
1195 Ga0395898_0000021
1196 Ga0395898_0030986
1197 Ga0395898_0081239
1198 Ga0395898_0127354
1199 Ga0395898_0140714
1200 Ga0395898_0185944
1201 Ga0395898_0342666
1202 Ga0395898_0472265
1203 Ga0395898_0526073
1204 Ga0395898_0644755
1205 Ga0395898_0673922
1206 Ga0395898_0776977
1207 Ga0395905_0000006
1208 Ga0395905_0000935
1209 Ga0395905_0008316
1210 Ga0395905_0088653
1211 Ga0395905_0178653
1212 Ga0395905_0272394
1213 Ga0395905_0319795
1214 Ga0395905_0355856
1215 Ga0395905_0392082
1216 Ga0395905_0411416
1217 Ga0395905_0542407
1218 Ga0395905_0592355
1219 Ga0395905_0616908
1220 Ga0395905_1894264
1221 Ga0395901_0003108
1222 Ga0395901_0009853
1223 Ga0395901_0020331
1224 Ga0395901_0094477
1225 Ga0395901_0146814
1226 Ga0395901_0177992
1227 Ga0395901_0214645
1228 Ga0395901_0285013
1229 Ga0395901_0532316
1230 Ga0395901_0664099
1231 Ga0395901_1696721
1232 Ga0395901_1826275
1233 Ga0436365_1581748
1234 Ga0451802_1436034
1235 Ga0451802_1637520
1236 Ga0451853_2750480
1237 Ga0466969_0024278
1238 Ga0466969_0152473
1239 Ga0466972_0141654
1240 Ga0466972_0184552
1241 Ga0466966_0030488
1242 Ga0466966_0078607
1243 Ga0466966_0600280
1244 Ga0466961_0101910
1245 Ga0466961_0380229
1246 Ga0466961_0708837
1247 Ga0466961_0953964
1248 Ga0466963_0188293
1249 Ga0466963_0222630
1250 Ga0466963_0338973
1251 Ga0466963_0467702
1252 Ga0466963_0866364
1253 Ga0466963_1033157
1254 Ga0466964_0348220
1255 Ga0466971_0033806
1256 Ga0466971_0246457
1257 Ga0466970_0098006
1258 Ga0466957_0070070
1259 Ga0466957_0474276
1260 Ga0466957_0543526
1261 Ga0466957_1129117
1262 Ga0466960_0181628
1263 Ga0466959_0195563
1264 Ga0466959_0504821
1265 Ga0466958_0100745
1266 Ga0466958_0170652
1267 Ga0466958_0173980
1268 Ga0466967_0012098
1269 Ga0466967_0053362
1270 Ga0466967_0087765
1271 Ga0466967_0334790
1272 Ga0466967_0363328
1273 Ga0466967_1118238
1274 Ga0495629_0504188
1275 Ga0495669_0025587
1276 Ga0495677_0308726
1277 Ga0495685_063285
1278 Ga0496106_0796681
1279 Ga0496107_0451989
1280 Ga0496107_1222184
1281 Ga0496108_0152226
1282 Ga0496109_0190861
1283 Ga0496109_0426152
1284 Ga0496109_0943163
1285 Ga0496110_0761147
1286 Ga0496111_0095805
1287 Ga0496111_0106023
1288 Ga0496112_0072720
1289 Ga0496112_0151736
1290 Ga0496113_0040843
1291 Ga0496113_1046100
1292 Ga0501070_0075267
1293 Ga0501073_1179347
1294 Ga0501209_079588
1295 Ga0501217_279896
1296 Ga0501223_026900
1297 Ga0501223_133351
1298 Ga0501224_010922
1299 Ga0501235_186852
1300 Ga0501240_016842
1301 Ga0501247_067608
1302 Ga0501248_015037
1303 Ga0501249_024174
1304 Ga0501225_0238520
1305 Ga0501262_002726
1306 Ga0501266_091802
1307 Ga0501268_008697
1308 Ga0501268_061083
1309 Ga0501270_005526
1310 Ga0501273_018530
1311 Ga0501212_019908
1312 Ga0466962_0042161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map