F473003
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 656 | 365 | 647 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300005983|Ga0081540_1009326|Ga0081540_10093263 |
| Length | 232 |
| Sequence | MRAAASVTALFPERSSDPLEFVDYRLAETAEEKDEIYRLRYRAYLREGAILPSESQRVTDRYDDEPNNFTFGVYYRDELYSSIRISVLRGEWRGSPSSEMFADILHPELDRGKIIIDPTRFLPYVTVRLGYVACGHFNADIGLANVRPEHRAFYRKVFLQKPLGEPKLFPGLIKPVGLMAANYHEIRDRVFQRFPFMRSSAFERRMLFQRSGERHASLRGVVTSFGRASIIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 5 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 6 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 7 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 8 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 176 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 177 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 222 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 223 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 302 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 319 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 325 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 329 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 330 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 331 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 333 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 336 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 337 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 338 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 339 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 340 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 341 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 342 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 343 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 345 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 347 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 348 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 349 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 351 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 352 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 354 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 355 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 356 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 357 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 359 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 360 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 361 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 363 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 365 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.32 |
| Metatranscriptomes | 0.3 |
| Isolates | 1.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.11 |
| Nodule | 1.83 |
| Rhizoplane | 5.03 |
| Rhizosphere | 74.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10002652 | 3300003215 | Bacteria | 10226 |
| 2 | rootH2_10065279 | 3300003320 | Bacteria | 1343 |
| 3 | rootL2_10232803 | 3300003322 | Bacteria | 1440 |
| 4 | rootH1_10056145 | 3300003323 | Bacteria | 1525 |
| 5 | Ga0070676_10069179 | 3300005328 | Bacteria | 2115 |
| 6 | Ga0070683_100024418 | 3300005329 | Bacteria | 5414 |
| 7 | Ga0070690_100235183 | 3300005330 | Bacteria | 1290 |
| 8 | Ga0070690_100312513 | 3300005330 | Bacteria | 1130 |
| 9 | Ga0070670_100197497 | 3300005331 | Bacteria | 1748 |
| 10 | Ga0070670_100215051 | 3300005331 | Bacteria | 1672 |
| 11 | Ga0068869_100027419 | 3300005334 | Bacteria | 3971 |
| 12 | Ga0068869_100138760 | 3300005334 | Bacteria | 1875 |
| 13 | Ga0068869_100291234 | 3300005334 | Bacteria | 1316 |
| 14 | Ga0070680_100006843 | 3300005336 | Bacteria | 8690 |
| 15 | Ga0070680_100368291 | 3300005336 | Bacteria | 1222 |
| 16 | Ga0068868_100026005 | 3300005338 | Bacteria | 4457 |
| 17 | Ga0068868_100232886 | 3300005338 | Bacteria | 1545 |
| 18 | Ga0070660_100135773 | 3300005339 | Bacteria | 1971 |
| 19 | Ga0070660_100291849 | 3300005339 | Bacteria | 1336 |
| 20 | Ga0070691_10050182 | 3300005341 | Bacteria | 1990 |
| 21 | Ga0070661_100166021 | 3300005344 | Bacteria | 1674 |
| 22 | Ga0070692_10079244 | 3300005345 | Bacteria | 1765 |
| 23 | Ga0070668_100305439 | 3300005347 | Bacteria | 1335 |
| 24 | Ga0070668_100393734 | 3300005347 | Bacteria | 1181 |
| 25 | Ga0070669_100637346 | 3300005353 | Bacteria | 896 |
| 26 | Ga0070671_100146906 | 3300005355 | Bacteria | 1990 |
| 27 | Ga0070671_100186437 | 3300005355 | Bacteria | 1758 |
| 28 | Ga0070671_100294267 | 3300005355 | Bacteria | 1382 |
| 29 | Ga0070674_100742015 | 3300005356 | Bacteria | 843 |
| 30 | Ga0070673_100155297 | 3300005364 | Bacteria | 1942 |
| 31 | Ga0070688_100409779 | 3300005365 | Bacteria | 1005 |
| 32 | Ga0070659_100531847 | 3300005366 | Bacteria | 1005 |
| 33 | Ga0070667_100239516 | 3300005367 | Bacteria | 1619 |
| 34 | Ga0070709_10001487 | 3300005434 | Bacteria | 12659 |
| 35 | Ga0070709_10016670 | 3300005434 | Bacteria | 4200 |
| 36 | Ga0070714_100015426 | 3300005435 | Bacteria | 6149 |
| 37 | Ga0070714_100594497 | 3300005435 | Bacteria | 1062 |
| 38 | Ga0070713_100030133 | 3300005436 | Bacteria | 4305 |
| 39 | Ga0070713_100238859 | 3300005436 | Bacteria | 1654 |
| 40 | Ga0070710_10015094 | 3300005437 | Bacteria | 3901 |
| 41 | Ga0070710_10204679 | 3300005437 | Bacteria | 1248 |
| 42 | Ga0070711_100003888 | 3300005439 | Bacteria | 8772 |
| 43 | Ga0070711_100184269 | 3300005439 | Bacteria | 1600 |
| 44 | Ga0070700_100425868 | 3300005441 | Bacteria | 1004 |
| 45 | Ga0070708_100181247 | 3300005445 | Bacteria | 1969 |
| 46 | Ga0070663_100054420 | 3300005455 | Bacteria | 2860 |
| 47 | Ga0070663_100135637 | 3300005455 | Bacteria | 1873 |
| 48 | Ga0070678_100106351 | 3300005456 | Bacteria | 2186 |
| 49 | Ga0070678_100158439 | 3300005456 | Bacteria | 1831 |
| 50 | Ga0070678_101018804 | 3300005456 | Bacteria | 762 |
| 51 | Ga0070662_100035970 | 3300005457 | Bacteria | 3500 |
| 52 | Ga0070681_10033857 | 3300005458 | Bacteria | 5129 |
| 53 | Ga0070681_10066584 | 3300005458 | Bacteria | 3571 |
| 54 | Ga0070681_10107417 | 3300005458 | Bacteria | 2731 |
| 55 | Ga0068867_100540291 | 3300005459 | Bacteria | 1008 |
| 56 | Ga0070707_100045951 | 3300005468 | Bacteria | 4179 |
| 57 | Ga0070698_100095110 | 3300005471 | Bacteria | 2958 |
| 58 | Ga0070684_100007774 | 3300005535 | Bacteria | 8357 |
| 59 | Ga0070684_100397204 | 3300005535 | Bacteria | 1271 |
| 60 | Ga0070684_100541892 | 3300005535 | Bacteria | 1079 |
| 61 | Ga0068853_100003590 | 3300005539 | Bacteria | 11880 |
| 62 | Ga0068853_100136738 | 3300005539 | Bacteria | 2197 |
| 63 | Ga0068853_100292389 | 3300005539 | Bacteria | 1504 |
| 64 | Ga0068853_100401044 | 3300005539 | Bacteria | 1284 |
| 65 | Ga0070672_100081783 | 3300005543 | Bacteria | 2590 |
| 66 | Ga0070693_100013877 | 3300005547 | Bacteria | 4114 |
| 67 | Ga0070665_100013002 | 3300005548 | Bacteria | 8383 |
| 68 | Ga0070665_100083124 | 3300005548 | Bacteria | 3207 |
| 69 | Ga0070665_100119008 | 3300005548 | Bacteria | 2644 |
| 70 | Ga0070665_100132590 | 3300005548 | Bacteria | 2493 |
| 71 | Ga0070665_100525923 | 3300005548 | Bacteria | 1194 |
| 72 | Ga0070665_100552682 | 3300005548 | Bacteria | 1163 |
| 73 | Ga0068855_100130222 | 3300005563 | Bacteria | 2874 |
| 74 | Ga0068855_100212071 | 3300005563 | Bacteria | 2175 |
| 75 | Ga0070664_100450466 | 3300005564 | Bacteria | 1181 |
| 76 | Ga0068857_100084537 | 3300005577 | Bacteria | 2836 |
| 77 | Ga0068857_100085418 | 3300005577 | Bacteria | 2820 |
| 78 | Ga0068857_100151750 | 3300005577 | Bacteria | 2099 |
| 79 | Ga0068854_100079839 | 3300005578 | Bacteria | 2413 |
| 80 | Ga0068854_100380101 | 3300005578 | Bacteria | 1163 |
| 81 | Ga0068856_100000055 | 3300005614 | Bacteria | 104152 |
| 82 | Ga0068856_100226087 | 3300005614 | Bacteria | 1887 |
| 83 | Ga0068856_100293585 | 3300005614 | Bacteria | 1642 |
| 84 | Ga0068856_100782777 | 3300005614 | Bacteria | 974 |
| 85 | Ga0070702_100104952 | 3300005615 | Bacteria | 1741 |
| 86 | Ga0068852_100114629 | 3300005616 | Bacteria | 2456 |
| 87 | Ga0068852_100221209 | 3300005616 | Bacteria | 1801 |
| 88 | Ga0068852_100263109 | 3300005616 | Bacteria | 1657 |
| 89 | Ga0068859_100089531 | 3300005617 | Bacteria | 3128 |
| 90 | Ga0068859_100142154 | 3300005617 | Bacteria | 2473 |
| 91 | Ga0068859_100338557 | 3300005617 | Bacteria | 1599 |
| 92 | Ga0068864_100065929 | 3300005618 | Bacteria | 3141 |
| 93 | Ga0068864_100366767 | 3300005618 | Bacteria | 1362 |
| 94 | Ga0068866_10157642 | 3300005718 | Bacteria | 1321 |
| 95 | Ga0068861_100195902 | 3300005719 | Bacteria | 1692 |
| 96 | Ga0068861_100719120 | 3300005719 | Bacteria | 930 |
| 97 | Ga0068861_100780771 | 3300005719 | Bacteria | 895 |
| 98 | Ga0068863_100266058 | 3300005841 | Bacteria | 1658 |
| 99 | Ga0068863_100346571 | 3300005841 | Bacteria | 1446 |
| 100 | Ga0068863_100391809 | 3300005841 | Bacteria | 1357 |
| 101 | Ga0068858_100052617 | 3300005842 | Bacteria | 3767 |
| 102 | Ga0068858_100104845 | 3300005842 | Bacteria | 2638 |
| 103 | Ga0068858_100154086 | 3300005842 | Bacteria | 2162 |
| 104 | Ga0068858_100191277 | 3300005842 | Bacteria | 1934 |
| 105 | Ga0068858_100250382 | 3300005842 | Bacteria | 1683 |
| 106 | Ga0068858_100701475 | 3300005842 | Bacteria | 985 |
| 107 | Ga0068858_100801910 | 3300005842 | Bacteria | 919 |
| 108 | Ga0068860_100216348 | 3300005843 | Bacteria | 1859 |
| 109 | Ga0068860_100362846 | 3300005843 | Bacteria | 1427 |
| 110 | Ga0068862_100351642 | 3300005844 | Bacteria | 1367 |
| 111 | Ga0081455_10204961 | 3300005937 | Bacteria | 1474 |
| 112 | Ga0081540_1003764 | 3300005983 | Bacteria | 11882 |
| 113 | Ga0081540_1004015 | 3300005983 | Bacteria | 11394 |
| 114 | Ga0081540_1005865 | 3300005983 | Bacteria | 9086 |
| 115 | Ga0081540_1009326 | 3300005983 | Bacteria | 6768 |
| 116 | Ga0081540_1023846 | 3300005983 | Bacteria | 3566 |
| 117 | Ga0081540_1145600 | 3300005983 | Bacteria | 943 |
| 118 | Ga0075365_10011031 | 3300006038 | Bacteria | 5295 |
| 119 | Ga0075365_10028198 | 3300006038 | Bacteria | 3579 |
| 120 | Ga0075365_10085847 | 3300006038 | Bacteria | 2138 |
| 121 | Ga0075365_10271295 | 3300006038 | Bacteria | 1193 |
| 122 | Ga0075365_10432090 | 3300006038 | Bacteria | 930 |
| 123 | Ga0075368_10045183 | 3300006042 | Bacteria | 1739 |
| 124 | Ga0075368_10053190 | 3300006042 | Bacteria | 1611 |
| 125 | Ga0075363_100193101 | 3300006048 | Bacteria | 1161 |
| 126 | Ga0075364_10106168 | 3300006051 | Bacteria | 1871 |
| 127 | Ga0075364_10115370 | 3300006051 | Bacteria | 1795 |
| 128 | Ga0075432_10107655 | 3300006058 | Bacteria | 1036 |
| 129 | Ga0070712_100008298 | 3300006175 | Bacteria | 6527 |
| 130 | Ga0070712_100337765 | 3300006175 | Bacteria | 1229 |
| 131 | Ga0075362_10057028 | 3300006177 | Bacteria | 1759 |
| 132 | Ga0075362_10176981 | 3300006177 | Bacteria | 1033 |
| 133 | Ga0075367_10030593 | 3300006178 | Bacteria | 3087 |
| 134 | Ga0075367_10150222 | 3300006178 | Bacteria | 1445 |
| 135 | Ga0075367_10170947 | 3300006178 | Bacteria | 1354 |
| 136 | Ga0075369_10040659 | 3300006186 | Bacteria | 1988 |
| 137 | Ga0075369_10055700 | 3300006186 | Bacteria | 1718 |
| 138 | Ga0075366_10139491 | 3300006195 | Bacteria | 1465 |
| 139 | Ga0075366_10175116 | 3300006195 | Bacteria | 1302 |
| 140 | Ga0075366_10212620 | 3300006195 | Bacteria | 1177 |
| 141 | Ga0097621_100302697 | 3300006237 | Bacteria | 1412 |
| 142 | Ga0075370_10020057 | 3300006353 | Bacteria | 3648 |
| 143 | Ga0075370_10132925 | 3300006353 | Bacteria | 1452 |
| 144 | Ga0075428_100140946 | 3300006844 | Bacteria | 2621 |
| 145 | Ga0075433_10467919 | 3300006852 | Bacteria | 1111 |
| 146 | Ga0075434_100027848 | 3300006871 | Bacteria | 5548 |
| 147 | Ga0068865_100317631 | 3300006881 | Bacteria | 1252 |
| 148 | Ga0097620_100089533 | 3300006931 | Bacteria | 3128 |
| 149 | Ga0097620_100142152 | 3300006931 | Bacteria | 2473 |
| 150 | Ga0097620_100338545 | 3300006931 | Bacteria | 1599 |
| 151 | Ga0099822_1012261 | 3300006943 | Bacteria | 10280 |
| 152 | Ga0075435_100012504 | 3300007076 | Bacteria | 6287 |
| 153 | Ga0099794_10013774 | 3300007265 | Bacteria | 3527 |
| 154 | Ga0099794_10079252 | 3300007265 | Bacteria | 1618 |
| 155 | Ga0099795_10031449 | 3300007788 | Bacteria | 1828 |
| 156 | Ga0099795_10036535 | 3300007788 | Bacteria | 1724 |
| 157 | Ga0105240_10022030 | 3300009093 | Bacteria | 8460 |
| 158 | Ga0105240_10427003 | 3300009093 | Bacteria | 1488 |
| 159 | Ga0105240_10437572 | 3300009093 | Bacteria | 1466 |
| 160 | Ga0105240_10586306 | 3300009093 | Bacteria | 1229 |
| 161 | Ga0111539_10759872 | 3300009094 | Bacteria | 1128 |
| 162 | Ga0105245_10082903 | 3300009098 | Bacteria | 2934 |
| 163 | Ga0105245_10331862 | 3300009098 | Bacteria | 1501 |
| 164 | Ga0105245_10363741 | 3300009098 | Bacteria | 1436 |
| 165 | Ga0105247_10013326 | 3300009101 | Bacteria | 4935 |
| 166 | Ga0105247_10053876 | 3300009101 | Bacteria | 2482 |
| 167 | Ga0105247_10074117 | 3300009101 | Bacteria | 2134 |
| 168 | Ga0105247_10253921 | 3300009101 | Bacteria | 1203 |
| 169 | Ga0105247_10302205 | 3300009101 | Bacteria | 1111 |
| 170 | Ga0105243_10276725 | 3300009148 | Bacteria | 1510 |
| 171 | Ga0105243_10429427 | 3300009148 | Bacteria | 1234 |
| 172 | Ga0105241_10227278 | 3300009174 | Bacteria | 1572 |
| 173 | Ga0105241_10249209 | 3300009174 | Bacteria | 1505 |
| 174 | Ga0105242_10302434 | 3300009176 | Bacteria | 1461 |
| 175 | Ga0105248_10076907 | 3300009177 | Bacteria | 3751 |
| 176 | Ga0105248_10184785 | 3300009177 | Bacteria | 2349 |
| 177 | Ga0105248_10185973 | 3300009177 | Bacteria | 2341 |
| 178 | Ga0105237_10045497 | 3300009545 | Bacteria | 4416 |
| 179 | Ga0105237_10220415 | 3300009545 | Bacteria | 1897 |
| 180 | Ga0105237_10508266 | 3300009545 | Bacteria | 1212 |
| 181 | Ga0105238_10001743 | 3300009551 | Bacteria | 21842 |
| 182 | Ga0105238_10004073 | 3300009551 | Bacteria | 14490 |
| 183 | Ga0105238_10030170 | 3300009551 | Bacteria | 5518 |
| 184 | Ga0105238_10067648 | 3300009551 | Bacteria | 3573 |
| 185 | Ga0105238_10196680 | 3300009551 | Bacteria | 1992 |
| 186 | Ga0105238_10322618 | 3300009551 | Bacteria | 1531 |
| 187 | Ga0105249_10230558 | 3300009553 | Bacteria | 1826 |
| 188 | Ga0105249_10329798 | 3300009553 | Bacteria | 1539 |
| 189 | Ga0105249_10367885 | 3300009553 | Bacteria | 1461 |
| 190 | Ga0105249_10726062 | 3300009553 | Bacteria | 1055 |
| 191 | Ga0099796_10059880 | 3300010159 | Bacteria | 1346 |
| 192 | Ga0099796_10089829 | 3300010159 | Bacteria | 1140 |
| 193 | Ga0099796_10101441 | 3300010159 | Bacteria | 1083 |
| 194 | Ga0105239_10014303 | 3300010375 | Bacteria | 8805 |
| 195 | Ga0105239_10025293 | 3300010375 | Bacteria | 6537 |
| 196 | Ga0105239_10179856 | 3300010375 | Bacteria | 2366 |
| 197 | Ga0105239_10230757 | 3300010375 | Bacteria | 2076 |
| 198 | Ga0105239_10652548 | 3300010375 | Bacteria | 1202 |
| 199 | Ga0105239_11102021 | 3300010375 | Bacteria | 914 |
| 200 | Ga0105246_10030767 | 3300011119 | Bacteria | 3548 |
| 201 | Ga0105246_10064349 | 3300011119 | Bacteria | 2561 |
| 202 | Ga0157370_10117448 | 3300013104 | Bacteria | 2485 |
| 203 | Ga0157370_10365171 | 3300013104 | Bacteria | 1330 |
| 204 | Ga0157369_10018060 | 3300013105 | Bacteria | 7911 |
| 205 | Ga0157369_10033001 | 3300013105 | Bacteria | 5690 |
| 206 | Ga0157369_10141525 | 3300013105 | Bacteria | 2545 |
| 207 | Ga0157374_10113743 | 3300013296 | Bacteria | 2605 |
| 208 | Ga0157374_10227925 | 3300013296 | Bacteria | 1830 |
| 209 | Ga0157374_10466066 | 3300013296 | Bacteria | 1265 |
| 210 | Ga0157378_10247296 | 3300013297 | Bacteria | 1706 |
| 211 | Ga0157378_10598189 | 3300013297 | Bacteria | 1114 |
| 212 | Ga0157378_11255832 | 3300013297 | Bacteria | 781 |
| 213 | Ga0163162_10257682 | 3300013306 | Bacteria | 1876 |
| 214 | Ga0163162_10572632 | 3300013306 | Bacteria | 1256 |
| 215 | Ga0157372_10284184 | 3300013307 | Bacteria | 1924 |
| 216 | Ga0157372_10693423 | 3300013307 | Bacteria | 1185 |
| 217 | Ga0157372_10719698 | 3300013307 | Bacteria | 1161 |
| 218 | Ga0157375_10044068 | 3300013308 | Bacteria | 4331 |
| 219 | Ga0157375_10350668 | 3300013308 | Bacteria | 1642 |
| 220 | Ga0157375_10536581 | 3300013308 | Bacteria | 1332 |
| 221 | Ga0157375_10564250 | 3300013308 | Bacteria | 1299 |
| 222 | Ga0157375_10621132 | 3300013308 | Bacteria | 1239 |
| 223 | Ga0163163_10119609 | 3300014325 | Bacteria | 2667 |
| 224 | Ga0163163_10776438 | 3300014325 | Bacteria | 1021 |
| 225 | Ga0157380_10137822 | 3300014326 | Bacteria | 2091 |
| 226 | Ga0157380_10229900 | 3300014326 | Bacteria | 1665 |
| 227 | Ga0157380_10332748 | 3300014326 | Bacteria | 1413 |
| 228 | Ga0157377_10113406 | 3300014745 | Bacteria | 1632 |
| 229 | Ga0157377_10249794 | 3300014745 | Bacteria | 1149 |
| 230 | Ga0157377_10317756 | 3300014745 | Bacteria | 1033 |
| 231 | Ga0157379_10135592 | 3300014968 | Bacteria | 2218 |
| 232 | Ga0157379_10545212 | 3300014968 | Bacteria | 1079 |
| 233 | Ga0157376_10210638 | 3300014969 | Bacteria | 1794 |
| 234 | Ga0163161_10194886 | 3300017792 | Bacteria | 1559 |
| 235 | Ga0163161_10222728 | 3300017792 | Bacteria | 1461 |
| 236 | Ga0224712_10037559 | 3300022467 | Bacteria | 1803 |
| 237 | Ga0209677_102424 | 3300025253 | Bacteria | 7044 |
| 238 | Ga0209233_1000694 | 3300025261 | Bacteria | 15931 |
| 239 | Ga0209455_1005264 | 3300025272 | Bacteria | 4037 |
| 240 | Ga0209758_1018978 | 3300025297 | Bacteria | 3341 |
| 241 | Ga0207697_10052681 | 3300025315 | Bacteria | 1684 |
| 242 | Ga0207692_10016278 | 3300025898 | Bacteria | 3288 |
| 243 | Ga0207692_10379543 | 3300025898 | Bacteria | 877 |
| 244 | Ga0207642_10113215 | 3300025899 | Bacteria | 1386 |
| 245 | Ga0207710_10010402 | 3300025900 | Bacteria | 3919 |
| 246 | Ga0207710_10035623 | 3300025900 | Bacteria | 2190 |
| 247 | Ga0207710_10084753 | 3300025900 | Bacteria | 1475 |
| 248 | Ga0207688_10132020 | 3300025901 | Bacteria | 1464 |
| 249 | Ga0207680_10290781 | 3300025903 | Bacteria | 1137 |
| 250 | Ga0207699_10010672 | 3300025906 | Bacteria | 4619 |
| 251 | Ga0207645_10134844 | 3300025907 | Bacteria | 1608 |
| 252 | Ga0207654_10125342 | 3300025911 | Bacteria | 1619 |
| 253 | Ga0207707_10000386 | 3300025912 | Bacteria | 46013 |
| 254 | Ga0207707_10001016 | 3300025912 | Bacteria | 26912 |
| 255 | Ga0207707_10039598 | 3300025912 | Bacteria | 4119 |
| 256 | Ga0207707_10047779 | 3300025912 | Bacteria | 3727 |
| 257 | Ga0207695_10404305 | 3300025913 | Bacteria | 1250 |
| 258 | Ga0207671_10016121 | 3300025914 | Bacteria | 5822 |
| 259 | Ga0207671_10117980 | 3300025914 | Bacteria | 2026 |
| 260 | Ga0207671_10451980 | 3300025914 | Bacteria | 1023 |
| 261 | Ga0207693_10025202 | 3300025915 | Bacteria | 4716 |
| 262 | Ga0207663_10113642 | 3300025916 | Bacteria | 1841 |
| 263 | Ga0207660_10000887 | 3300025917 | Bacteria | 19699 |
| 264 | Ga0207660_10187511 | 3300025917 | Bacteria | 1609 |
| 265 | Ga0207662_10080894 | 3300025918 | Bacteria | 1983 |
| 266 | Ga0207657_10001391 | 3300025919 | Bacteria | 25799 |
| 267 | Ga0207649_10214878 | 3300025920 | Bacteria | 1366 |
| 268 | Ga0207649_10652612 | 3300025920 | Bacteria | 813 |
| 269 | Ga0207652_10068736 | 3300025921 | Bacteria | 3074 |
| 270 | Ga0207652_10076797 | 3300025921 | Bacteria | 2913 |
| 271 | Ga0207681_10274777 | 3300025923 | Bacteria | 1324 |
| 272 | Ga0207681_10453504 | 3300025923 | Bacteria | 1044 |
| 273 | Ga0207694_10492973 | 3300025924 | Bacteria | 1025 |
| 274 | Ga0207650_10387506 | 3300025925 | Bacteria | 1155 |
| 275 | Ga0207650_10422366 | 3300025925 | Bacteria | 1106 |
| 276 | Ga0207659_10136108 | 3300025926 | Bacteria | 1902 |
| 277 | Ga0207687_10221465 | 3300025927 | Bacteria | 1490 |
| 278 | Ga0207687_10242525 | 3300025927 | Bacteria | 1429 |
| 279 | Ga0207687_10566042 | 3300025927 | Unclassified | 955 |
| 280 | Ga0207700_10090686 | 3300025928 | Bacteria | 2413 |
| 281 | Ga0207664_10011265 | 3300025929 | Bacteria | 6344 |
| 282 | Ga0207664_10073307 | 3300025929 | Bacteria | 2763 |
| 283 | Ga0207644_10187010 | 3300025931 | Bacteria | 1627 |
| 284 | Ga0207644_10290872 | 3300025931 | Bacteria | 1314 |
| 285 | Ga0207690_10150002 | 3300025932 | Bacteria | 1727 |
| 286 | Ga0207706_10340910 | 3300025933 | Bacteria | 1304 |
| 287 | Ga0207709_10228630 | 3300025935 | Bacteria | 1346 |
| 288 | Ga0207670_10301362 | 3300025936 | Bacteria | 1255 |
| 289 | Ga0207669_10178991 | 3300025937 | Bacteria | 1518 |
| 290 | Ga0207669_10186272 | 3300025937 | Bacteria | 1493 |
| 291 | Ga0207704_10281903 | 3300025938 | Bacteria | 1264 |
| 292 | Ga0207691_10048268 | 3300025940 | Bacteria | 3904 |
| 293 | Ga0207691_10314333 | 3300025940 | Bacteria | 1344 |
| 294 | Ga0207711_10022786 | 3300025941 | Bacteria | 5240 |
| 295 | Ga0207711_10303706 | 3300025941 | Bacteria | 1472 |
| 296 | Ga0207689_10043282 | 3300025942 | Bacteria | 3722 |
| 297 | Ga0207689_10164622 | 3300025942 | Bacteria | 1827 |
| 298 | Ga0207689_10301957 | 3300025942 | Bacteria | 1327 |
| 299 | Ga0207661_10185885 | 3300025944 | Bacteria | 1818 |
| 300 | Ga0207667_10011614 | 3300025949 | Bacteria | 10225 |
| 301 | Ga0207667_10114401 | 3300025949 | Bacteria | 2781 |
| 302 | Ga0207651_10318840 | 3300025960 | Bacteria | 1299 |
| 303 | Ga0207712_10352662 | 3300025961 | Bacteria | 1224 |
| 304 | Ga0207668_10358018 | 3300025972 | Bacteria | 1222 |
| 305 | Ga0207668_10414523 | 3300025972 | Bacteria | 1142 |
| 306 | Ga0207658_10184991 | 3300025986 | Bacteria | 1727 |
| 307 | Ga0207677_10042292 | 3300026023 | Bacteria | 3020 |
| 308 | Ga0207703_10072541 | 3300026035 | Bacteria | 2846 |
| 309 | Ga0207703_10073571 | 3300026035 | Bacteria | 2827 |
| 310 | Ga0207703_10135872 | 3300026035 | Bacteria | 2129 |
| 311 | Ga0207703_10154187 | 3300026035 | Bacteria | 2006 |
| 312 | Ga0207703_10288310 | 3300026035 | Bacteria | 1493 |
| 313 | Ga0207639_10056384 | 3300026041 | Bacteria | 3011 |
| 314 | Ga0207639_10196308 | 3300026041 | Bacteria | 1728 |
| 315 | Ga0207639_10230641 | 3300026041 | Bacteria | 1604 |
| 316 | Ga0207678_10036846 | 3300026067 | Bacteria | 4257 |
| 317 | Ga0207678_10054475 | 3300026067 | Bacteria | 3445 |
| 318 | Ga0207678_10084475 | 3300026067 | Bacteria | 2715 |
| 319 | Ga0207678_10199195 | 3300026067 | Bacteria | 1712 |
| 320 | Ga0207678_10724034 | 3300026067 | Bacteria | 876 |
| 321 | Ga0207708_10156038 | 3300026075 | Bacteria | 1800 |
| 322 | Ga0207708_10462004 | 3300026075 | Bacteria | 1059 |
| 323 | Ga0207702_10000688 | 3300026078 | Bacteria | 36556 |
| 324 | Ga0207702_10349794 | 3300026078 | Bacteria | 1414 |
| 325 | Ga0207702_10734827 | 3300026078 | Bacteria | 974 |
| 326 | Ga0207641_10321703 | 3300026088 | Bacteria | 1467 |
| 327 | Ga0207676_10006429 | 3300026095 | Bacteria | 8303 |
| 328 | Ga0207676_10233070 | 3300026095 | Bacteria | 1647 |
| 329 | Ga0207674_10046764 | 3300026116 | Bacteria | 4441 |
| 330 | Ga0207674_10119218 | 3300026116 | Bacteria | 2608 |
| 331 | Ga0207674_10199010 | 3300026116 | Bacteria | 1953 |
| 332 | Ga0207675_100053066 | 3300026118 | Bacteria | 3783 |
| 333 | Ga0207675_100276971 | 3300026118 | Bacteria | 1629 |
| 334 | Ga0207675_100649196 | 3300026118 | Bacteria | 1061 |
| 335 | Ga0207675_100736886 | 3300026118 | Bacteria | 996 |
| 336 | Ga0207683_10015315 | 3300026121 | Bacteria | 6530 |
| 337 | Ga0207683_10165753 | 3300026121 | Bacteria | 1999 |
| 338 | Ga0207683_10175207 | 3300026121 | Bacteria | 1943 |
| 339 | Ga0207683_10178366 | 3300026121 | Bacteria | 1926 |
| 340 | Ga0207698_10042920 | 3300026142 | Bacteria | 3384 |
| 341 | Ga0207698_10757892 | 3300026142 | Bacteria | 970 |
| 342 | Ga0207698_10827665 | 3300026142 | Bacteria | 929 |
| 343 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 344 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 345 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 346 | Ga0209588_1048888 | 3300027671 | Bacteria | 1369 |
| 347 | Ga0209813_10012310 | 3300027866 | Bacteria | 2258 |
| 348 | Ga0268266_10001136 | 3300028379 | Bacteria | 33101 |
| 349 | Ga0268266_10192392 | 3300028379 | Bacteria | 1863 |
| 350 | Ga0268265_10546896 | 3300028380 | Bacteria | 1098 |
| 351 | Ga0268264_10157699 | 3300028381 | Bacteria | 2041 |
| 352 | Ga0268264_10395672 | 3300028381 | Bacteria | 1326 |
| 353 | Ga0268264_10721493 | 3300028381 | Bacteria | 991 |
| 354 | Ga0265323_10009075 | 3300028653 | Bacteria | 4080 |
| 355 | Ga0265336_10019148 | 3300028666 | Bacteria | 2211 |
| 356 | Ga0265338_10011039 | 3300028800 | Bacteria | 10483 |
| 357 | Ga0265324_10093029 | 3300029957 | Bacteria | 1025 |
| 358 | Ga0307509_10192424 | 3300031507 | Bacteria | 1889 |
| 359 | Ga0307405_10216953 | 3300031731 | Bacteria | 1401 |
| 360 | Ga0307413_10149407 | 3300031824 | Bacteria | 1626 |
| 361 | Ga0307406_10210029 | 3300031901 | Bacteria | 1439 |
| 362 | Ga0307406_10467644 | 3300031901 | Bacteria | 1015 |
| 363 | Ga0307407_10156021 | 3300031903 | Bacteria | 1489 |
| 364 | Ga0307412_10041561 | 3300031911 | Bacteria | 2981 |
| 365 | Ga0307409_100861543 | 3300031995 | Bacteria | 917 |
| 366 | Ga0307416_100275087 | 3300032002 | Bacteria | 1656 |
| 367 | Ga0307415_100048349 | 3300032126 | Bacteria | 2870 |
| 368 | Ga0307415_100125344 | 3300032126 | Bacteria | 1934 |
| 369 | Ga0315911_1000022 | 3300033442 | Bacteria | 118114 |
| 370 | Ga0373926_0009183 | 3300035083 | Bacteria | 3300 |
| 371 | Ga0373934_0054370 | 3300035086 | Bacteria | 1590 |
| 372 | Ga0373923_0039539 | 3300035111 | Bacteria | 1937 |
| 373 | Ga0373923_0055004 | 3300035111 | Bacteria | 1676 |
| 374 | Ga0373936_0078514 | 3300035113 | Bacteria | 1371 |
| 375 | Ga0373941_0037811 | 3300035115 | Bacteria | 1474 |
| 376 | Ga0373953_0000731 | 3300035117 | Bacteria | 9082 |
| 377 | Ga0373954_0001719 | 3300035118 | Bacteria | 8964 |
| 378 | Ga0373954_0213288 | 3300035118 | Bacteria | 949 |
| 379 | Ga0373956_0002420 | 3300035119 | Bacteria | 7612 |
| 380 | Ga0373957_0000218 | 3300035120 | Bacteria | 14250 |
| 381 | Ga0373943_0000806 | 3300035170 | Bacteria | 13730 |
| 382 | Ga0373943_0013605 | 3300035170 | Bacteria | 3677 |
| 383 | Ga0373946_0005160 | 3300035171 | Bacteria | 4708 |
| 384 | Ga0373946_0076943 | 3300035171 | Bacteria | 1453 |
| 385 | Ga0373955_0003024 | 3300035172 | Bacteria | 7372 |
| 386 | Ga0373955_0061584 | 3300035172 | Bacteria | 2073 |
| 387 | Ga0373962_0030019 | 3300035242 | Bacteria | 1485 |
| 388 | Ga0373924_0041117 | 3300035410 | Bacteria | 1894 |
| 389 | Ga0373924_0043328 | 3300035410 | Bacteria | 1848 |
| 390 | Ga0373931_0000654 | 3300035691 | Bacteria | 14304 |
| 391 | Ga0373935_0656560 | 3300035692 | Bacteria | 769 |
| 392 | Ga0373927_0000046 | 3300035695 | Bacteria | 88401 |
| 393 | Ga0373927_0027284 | 3300035695 | Bacteria | 3729 |
| 394 | Ga0373927_0128792 | 3300035695 | Bacteria | 1653 |
| 395 | Ga0373933_0011360 | 3300035724 | Bacteria | 4905 |
| 396 | Ga0373933_0326977 | 3300035724 | Bacteria | 994 |
| 397 | Ga0373947_0003991 | 3300035725 | Bacteria | 8665 |
| 398 | Ga0373947_0007461 | 3300035725 | Bacteria | 6329 |
| 399 | Ga0373947_0110148 | 3300035725 | Bacteria | 1739 |
| 400 | Ga0373937_0011908 | 3300036401 | Bacteria | 7634 |
| 401 | Ga0373937_0023752 | 3300036401 | Bacteria | 5525 |
| 402 | Ga0373937_0048069 | 3300036401 | Bacteria | 3904 |
| 403 | Ga0372808_005113 | 3300036459 | Bacteria | 1714 |
| 404 | Ga0373925_0011487 | 3300037068 | Bacteria | 6408 |
| 405 | Ga0373925_0123513 | 3300037068 | Bacteria | 2012 |
| 406 | Ga0436364_1134021 | 3300037853 | Bacteria | 8101 |
| 407 | Ga0436365_1263660 | 3300039437 | Bacteria | 1159 |
| 408 | Ga0436360_0175672 | 3300039438 | Bacteria | 1854 |
| 409 | Ga0436363_1660925 | 3300039450 | Bacteria | 2753 |
| 410 | Ga0439459_0025575 | 3300042438 | Bacteria | 1167 |
| 411 | Ga0466963_0053540 | 3300044694 | Bacteria | 2679 |
| 412 | Ga0466957_0082530 | 3300044842 | Bacteria | 2004 |
| 413 | Ga0466967_0743151 | 3300045976 | Bacteria | 973 |
| 414 | Ga0495592_0001238 | 3300046454 | Bacteria | 17695 |
| 415 | Ga0495592_0012178 | 3300046454 | Bacteria | 6527 |
| 416 | Ga0495592_0213444 | 3300046454 | Bacteria | 1295 |
| 417 | Ga0495603_0000051 | 3300046455 | Bacteria | 50402 |
| 418 | Ga0495629_0000182 | 3300046459 | Bacteria | 56655 |
| 419 | Ga0495629_0000750 | 3300046459 | Bacteria | 26239 |
| 420 | Ga0495629_0048286 | 3300046459 | Bacteria | 2984 |
| 421 | Ga0495641_0006669 | 3300046461 | Bacteria | 7421 |
| 422 | Ga0495651_0014625 | 3300046462 | Bacteria | 6067 |
| 423 | Ga0495653_0007956 | 3300046463 | Bacteria | 8681 |
| 424 | Ga0495580_0009446 | 3300046472 | Bacteria | 7670 |
| 425 | Ga0495582_0000025 | 3300046473 | Bacteria | 82063 |
| 426 | Ga0495639_0007403 | 3300046475 | Bacteria | 4714 |
| 427 | Ga0495639_0012974 | 3300046475 | Bacteria | 3596 |
| 428 | Ga0495639_0119608 | 3300046475 | Bacteria | 1256 |
| 429 | Ga0495662_0000583 | 3300046476 | Bacteria | 16810 |
| 430 | Ga0495664_0004145 | 3300046477 | Bacteria | 7913 |
| 431 | Ga0495664_0004921 | 3300046477 | Bacteria | 7309 |
| 432 | Ga0495584_0100035 | 3300046491 | Bacteria | 1465 |
| 433 | Ga0495585_0145034 | 3300046492 | Bacteria | 1241 |
| 434 | Ga0495594_0002799 | 3300046499 | Bacteria | 9050 |
| 435 | Ga0495594_0346493 | 3300046499 | Bacteria | 846 |
| 436 | Ga0495596_0060204 | 3300046500 | Bacteria | 1479 |
| 437 | Ga0495606_0099170 | 3300046507 | Bacteria | 1776 |
| 438 | Ga0495608_0000738 | 3300046511 | Bacteria | 22828 |
| 439 | Ga0495608_0221870 | 3300046511 | Bacteria | 1186 |
| 440 | Ga0495616_0116199 | 3300046513 | Bacteria | 1239 |
| 441 | Ga0495618_0065409 | 3300046514 | Bacteria | 2311 |
| 442 | Ga0495628_0005837 | 3300046516 | Bacteria | 10785 |
| 443 | Ga0495630_0034359 | 3300046517 | Bacteria | 3786 |
| 444 | Ga0495632_0094115 | 3300046519 | Bacteria | 1417 |
| 445 | Ga0495643_0149056 | 3300046522 | Bacteria | 1160 |
| 446 | Ga0495648_0197744 | 3300046524 | Bacteria | 1009 |
| 447 | Ga0495666_0033207 | 3300046526 | Bacteria | 2522 |
| 448 | Ga0495666_0042079 | 3300046526 | Bacteria | 2210 |
| 449 | Ga0495652_0004125 | 3300046529 | Bacteria | 14021 |
| 450 | Ga0495652_0044488 | 3300046529 | Bacteria | 3823 |
| 451 | Ga0495652_0138768 | 3300046529 | Bacteria | 1914 |
| 452 | Ga0495665_0000195 | 3300046531 | Bacteria | 31231 |
| 453 | Ga0495640_0023048 | 3300046533 | Bacteria | 4545 |
| 454 | Ga0495640_0042745 | 3300046533 | Bacteria | 3159 |
| 455 | Ga0495587_0006945 | 3300046536 | Bacteria | 7353 |
| 456 | Ga0495587_0049585 | 3300046536 | Bacteria | 2485 |
| 457 | Ga0495609_0116488 | 3300046538 | Bacteria | 1151 |
| 458 | Ga0495645_0053146 | 3300046543 | Bacteria | 2945 |
| 459 | Ga0495645_0117193 | 3300046543 | Bacteria | 1879 |
| 460 | Ga0495645_0371989 | 3300046543 | Bacteria | 916 |
| 461 | Ga0495622_0001733 | 3300046557 | Bacteria | 10791 |
| 462 | Ga0495667_0004219 | 3300046559 | Bacteria | 9686 |
| 463 | Ga0495667_0014506 | 3300046559 | Bacteria | 5322 |
| 464 | Ga0495656_0014978 | 3300046615 | Bacteria | 2917 |
| 465 | Ga0495634_0005743 | 3300046642 | Bacteria | 9475 |
| 466 | Ga0495634_0043116 | 3300046642 | Bacteria | 3058 |
| 467 | Ga0495634_0052709 | 3300046642 | Bacteria | 2727 |
| 468 | Ga0495611_0214843 | 3300046648 | Bacteria | 895 |
| 469 | Ga0495625_0064442 | 3300046660 | Bacteria | 2585 |
| 470 | Ga0495625_0218024 | 3300046660 | Bacteria | 1251 |
| 471 | Ga0495635_0000166 | 3300046663 | Bacteria | 40939 |
| 472 | Ga0495635_0004315 | 3300046663 | Bacteria | 9844 |
| 473 | Ga0495659_0009032 | 3300046664 | Bacteria | 3176 |
| 474 | Ga0495588_0002009 | 3300046674 | Bacteria | 8695 |
| 475 | Ga0495588_0009190 | 3300046674 | Bacteria | 4563 |
| 476 | Ga0495588_0161339 | 3300046674 | Bacteria | 1186 |
| 477 | Ga0495657_0005822 | 3300046675 | Bacteria | 9704 |
| 478 | Ga0495657_0054952 | 3300046675 | Bacteria | 2658 |
| 479 | Ga0495599_0014529 | 3300046678 | Bacteria | 4875 |
| 480 | Ga0495623_0002267 | 3300046679 | Bacteria | 12801 |
| 481 | Ga0495646_0002103 | 3300046680 | Bacteria | 12076 |
| 482 | Ga0495646_0088643 | 3300046680 | Bacteria | 1791 |
| 483 | Ga0495646_0184454 | 3300046680 | Bacteria | 1143 |
| 484 | Ga0495647_0002805 | 3300046681 | Bacteria | 5527 |
| 485 | Ga0495658_0002361 | 3300046683 | Bacteria | 9539 |
| 486 | Ga0495658_0015804 | 3300046683 | Bacteria | 3877 |
| 487 | Ga0495613_0006158 | 3300046689 | Bacteria | 8979 |
| 488 | Ga0495613_0058031 | 3300046689 | Bacteria | 2842 |
| 489 | Ga0495624_0000898 | 3300046690 | Bacteria | 23624 |
| 490 | Ga0495670_0081446 | 3300046691 | Bacteria | 1649 |
| 491 | Ga0495671_0051376 | 3300046692 | Bacteria | 2050 |
| 492 | Ga0495649_0041544 | 3300046694 | Bacteria | 2515 |
| 493 | Ga0495589_0092486 | 3300046794 | Bacteria | 1468 |
| 494 | Ga0495600_0005583 | 3300046809 | Bacteria | 7596 |
| 495 | Ga0495600_0049111 | 3300046809 | Bacteria | 2753 |
| 496 | Ga0495581_0000187 | 3300047315 | Bacteria | 28682 |
| 497 | Ga0495604_0004924 | 3300047317 | Bacteria | 10588 |
| 498 | Ga0495604_0422841 | 3300047317 | Bacteria | 874 |
| 499 | Ga0495674_0003575 | 3300047319 | Bacteria | 15109 |
| 500 | Ga0495674_0005019 | 3300047319 | Bacteria | 12726 |
| 501 | Ga0495674_0013003 | 3300047319 | Bacteria | 7835 |
| 502 | Ga0495676_0013511 | 3300047321 | Bacteria | 7338 |
| 503 | Ga0495676_0077799 | 3300047321 | Bacteria | 2528 |
| 504 | Ga0495676_0094780 | 3300047321 | Bacteria | 2223 |
| 505 | Ga0495680_0004903 | 3300047322 | Bacteria | 12674 |
| 506 | Ga0495675_0000770 | 3300047444 | Bacteria | 19951 |
| 507 | Ga0495684_0000501 | 3300047471 | Bacteria | 31747 |
| 508 | Ga0495684_0195971 | 3300047471 | Bacteria | 1491 |
| 509 | Ga0495684_0344128 | 3300047471 | Bacteria | 1060 |
| 510 | Ga0495593_0000469 | 3300047673 | Bacteria | 22695 |
| 511 | Ga0495593_0006360 | 3300047673 | Bacteria | 6928 |
| 512 | Ga0495602_0019776 | 3300048088 | Bacteria | 6673 |
| 513 | Ga0496100_0182597 | 3300048903 | Bacteria | 1518 |
| 514 | Ga0496101_0001656 | 3300048904 | Bacteria | 13367 |
| 515 | Ga0496101_0302144 | 3300048904 | Bacteria | 1254 |
| 516 | Ga0496102_0010759 | 3300048905 | Bacteria | 7880 |
| 517 | Ga0496102_0514120 | 3300048905 | Bacteria | 1120 |
| 518 | Ga0496102_0679421 | 3300048905 | Bacteria | 953 |
| 519 | Ga0496103_0016825 | 3300048906 | Bacteria | 4367 |
| 520 | Ga0496104_0004595 | 3300048907 | Bacteria | 12035 |
| 521 | Ga0496104_0137623 | 3300048907 | Bacteria | 2346 |
| 522 | Ga0496104_0251224 | 3300048907 | Bacteria | 1681 |
| 523 | Ga0496105_0040208 | 3300048908 | Bacteria | 3854 |
| 524 | Ga0496106_0026288 | 3300048909 | Bacteria | 4333 |
| 525 | Ga0496106_0166386 | 3300048909 | Bacteria | 1746 |
| 526 | Ga0496106_0201150 | 3300048909 | Bacteria | 1585 |
| 527 | Ga0496107_0005918 | 3300048910 | Bacteria | 8380 |
| 528 | Ga0496107_0155125 | 3300048910 | Bacteria | 1695 |
| 529 | Ga0496108_0041009 | 3300048911 | Bacteria | 3862 |
| 530 | Ga0496108_0159548 | 3300048911 | Bacteria | 1948 |
| 531 | Ga0496108_0496324 | 3300048911 | Bacteria | 1066 |
| 532 | Ga0496109_0011243 | 3300048912 | Bacteria | 7687 |
| 533 | Ga0496109_0271311 | 3300048912 | Bacteria | 1598 |
| 534 | Ga0496110_0020972 | 3300048913 | Bacteria | 5521 |
| 535 | Ga0496111_0012551 | 3300048914 | Bacteria | 5741 |
| 536 | Ga0496111_0138489 | 3300048914 | Bacteria | 1803 |
| 537 | Ga0496112_0002949 | 3300048915 | Bacteria | 13878 |
| 538 | Ga0496112_0020266 | 3300048915 | Bacteria | 6299 |
| 539 | Ga0496112_0284217 | 3300048915 | Bacteria | 1601 |
| 540 | Ga0496112_0288614 | 3300048915 | Bacteria | 1587 |
| 541 | Ga0496112_0309803 | 3300048915 | Bacteria | 1524 |
| 542 | Ga0496113_0020040 | 3300048916 | Bacteria | 4693 |
| 543 | Ga0496114_0008695 | 3300048917 | Bacteria | 8045 |
| 544 | Ga0496115_0057832 | 3300048918 | Bacteria | 3119 |
| 545 | Ga0496115_0114644 | 3300048918 | Bacteria | 2215 |
| 546 | Ga0496117_0035199 | 3300048920 | Bacteria | 3762 |
| 547 | Ga0496117_0127876 | 3300048920 | Bacteria | 1547 |
| 548 | Ga0496118_0014251 | 3300048921 | Bacteria | 7455 |
| 549 | Ga0496118_0245440 | 3300048921 | Bacteria | 1022 |
| 550 | Ga0496119_0071247 | 3300048922 | Bacteria | 2036 |
| 551 | Ga0496119_0087993 | 3300048922 | Bacteria | 1772 |
| 552 | Ga0496119_0166993 | 3300048922 | Bacteria | 1165 |
| 553 | Ga0496120_0255828 | 3300048923 | Bacteria | 820 |
| 554 | Ga0496121_0016292 | 3300048924 | Bacteria | 7687 |
| 555 | Ga0496121_0033170 | 3300048924 | Bacteria | 4678 |
| 556 | Ga0496121_0042466 | 3300048924 | Bacteria | 3954 |
| 557 | Ga0496121_0108497 | 3300048924 | Bacteria | 2123 |
| 558 | Ga0496121_0153258 | 3300048924 | Bacteria | 1693 |
| 559 | Ga0496121_0160355 | 3300048924 | Bacteria | 1645 |
| 560 | Ga0496121_0240849 | 3300048924 | Bacteria | 1260 |
| 561 | Ga0496121_0302286 | 3300048924 | Bacteria | 1085 |
| 562 | Ga0496121_0410914 | 3300048924 | Bacteria | 883 |
| 563 | Ga0496124_0155175 | 3300048927 | Bacteria | 1791 |
| 564 | Ga0496124_0269614 | 3300048927 | Bacteria | 1247 |
| 565 | Ga0496125_0077954 | 3300048928 | Bacteria | 2550 |
| 566 | Ga0496125_0137243 | 3300048928 | Bacteria | 1708 |
| 567 | Ga0496125_0151052 | 3300048928 | Bacteria | 1595 |
| 568 | Ga0496125_0177104 | 3300048928 | Bacteria | 1425 |
| 569 | Ga0496125_0189198 | 3300048928 | Bacteria | 1361 |
| 570 | Ga0496126_0005480 | 3300048929 | Bacteria | 14467 |
| 571 | Ga0496126_0011540 | 3300048929 | Bacteria | 9128 |
| 572 | Ga0496126_0027538 | 3300048929 | Bacteria | 5427 |
| 573 | Ga0496126_0191567 | 3300048929 | Bacteria | 1731 |
| 574 | Ga0496126_0232554 | 3300048929 | Bacteria | 1544 |
| 575 | Ga0495682_0065096 | 3300049460 | Bacteria | 1314 |
| 576 | Ga0495682_0068330 | 3300049460 | Bacteria | 1280 |
| 577 | Ga0501067_0029547 | 3300049583 | Bacteria | 3038 |
| 578 | nmdc:mga03n38_1311_c1 | 3300050490 | Bacteria | 7027 |
| 579 | nmdc:mga0yw44_62951_c1 | 3300050492 | Bacteria | 2280 |
| 580 | nmdc:mga0yw44_83080_c1 | 3300050492 | Bacteria | 2011 |
| 581 | nmdc:mga06z11_147498_c1 | 3300050494 | Bacteria | 1335 |
| 582 | nmdc:mga04h51_49451_c1 | 3300050495 | Bacteria | 1405 |
| 583 | nmdc:mga07m45_243719_c1 | 3300050496 | Bacteria | 1046 |
| 584 | nmdc:mga07m45_3363_c1 | 3300050496 | Bacteria | 7708 |
| 585 | nmdc:mga0n895_33766_c1 | 3300050512 | Bacteria | 4918 |
| 586 | nmdc:mga0rr50_133350_c1 | 3300050513 | Bacteria | 1991 |
| 587 | nmdc:mga0sz30_110560_c1 | 3300050516 | Bacteria | 1204 |
| 588 | Ga0495601_0014124 | 3300053077 | Bacteria | 4811 |
| 589 | Ga0495601_0082240 | 3300053077 | Bacteria | 2067 |
| 590 | Ga0495601_0084741 | 3300053077 | Bacteria | 2036 |
| 591 | Ga0500635_0005911 | 3300053080 | Bacteria | 3245 |
| 592 | Ga0500635_0073005 | 3300053080 | Bacteria | 1220 |
| 593 | Ga0495655_0078412 | 3300053083 | Bacteria | 939 |
| 594 | Ga0495595_0000332 | 3300053084 | Bacteria | 18218 |
| 595 | Ga0495595_0205531 | 3300053084 | Bacteria | 981 |
| 596 | Ga0495619_0000633 | 3300053085 | Bacteria | 23194 |
| 597 | Ga0495619_0079603 | 3300053085 | Bacteria | 2204 |
| 598 | Ga0495619_0184087 | 3300053085 | Bacteria | 1445 |
| 599 | Ga0495619_0464073 | 3300053085 | Bacteria | 872 |
| 600 | Ga0500646_0049900 | 3300053090 | Bacteria | 1204 |
| 601 | Ga0500583_0232866 | 3300053092 | Bacteria | 911 |
| 602 | Ga0500651_0050027 | 3300053093 | Bacteria | 2624 |
| 603 | Ga0500566_0000078 | 3300053094 | Bacteria | 47558 |
| 604 | Ga0500566_0153323 | 3300053094 | Bacteria | 1209 |
| 605 | Ga0500640_000121 | 3300053095 | Bacteria | 14580 |
| 606 | Ga0500641_0001219 | 3300053096 | Bacteria | 9151 |
| 607 | Ga0500641_0011540 | 3300053096 | Bacteria | 3207 |
| 608 | Ga0500641_0072725 | 3300053096 | Bacteria | 1449 |
| 609 | Ga0500555_051033 | 3300053103 | Bacteria | 1132 |
| 610 | Ga0500562_023035 | 3300053108 | Bacteria | 1624 |
| 611 | Ga0500572_000170 | 3300053111 | Bacteria | 22863 |
| 612 | Ga0500572_000843 | 3300053111 | Bacteria | 9578 |
| 613 | Ga0500591_020796 | 3300053115 | Bacteria | 3183 |
| 614 | Ga0500594_0026472 | 3300053118 | Bacteria | 1495 |
| 615 | Ga0500595_012929 | 3300053119 | Bacteria | 3211 |
| 616 | Ga0500595_059998 | 3300053119 | Bacteria | 1152 |
| 617 | Ga0500608_003737 | 3300053122 | Bacteria | 5767 |
| 618 | Ga0500614_003747 | 3300053123 | Bacteria | 3255 |
| 619 | Ga0500642_0060625 | 3300053130 | Bacteria | 1698 |
| 620 | Ga0500642_0088920 | 3300053130 | Bacteria | 1426 |
| 621 | Ga0500658_0028241 | 3300053134 | Bacteria | 2175 |
| 622 | Ga0500559_0000829 | 3300053136 | Bacteria | 20012 |
| 623 | Ga0500561_0015338 | 3300053137 | Bacteria | 1698 |
| 624 | Ga0500577_0042421 | 3300053142 | Bacteria | 1665 |
| 625 | Ga0500588_0022229 | 3300053146 | Bacteria | 1724 |
| 626 | Ga0500589_024473 | 3300053147 | Bacteria | 2788 |
| 627 | Ga0500589_091169 | 3300053147 | Bacteria | 1342 |
| 628 | Ga0500603_000081 | 3300053150 | Bacteria | 22182 |
| 629 | Ga0500603_004752 | 3300053150 | Bacteria | 2907 |
| 630 | Ga0500604_0089674 | 3300053151 | Bacteria | 1003 |
| 631 | Ga0500622_0084460 | 3300053156 | Bacteria | 1585 |
| 632 | Ga0500627_0057447 | 3300053158 | Bacteria | 1707 |
| 633 | Ga0500630_011249 | 3300053159 | Bacteria | 4406 |
| 634 | Ga0500633_0076056 | 3300053160 | Bacteria | 1207 |
| 635 | Ga0500634_0102607 | 3300053161 | Bacteria | 1428 |
| 636 | Ga0500634_0149206 | 3300053161 | Bacteria | 1095 |
| 637 | Ga0500638_023658 | 3300053162 | Bacteria | 2922 |
| 638 | Ga0500636_0014194 | 3300053177 | Bacteria | 4683 |
| 639 | Ga0500636_0036403 | 3300053177 | Bacteria | 2913 |
| 640 | Ga0500637_0064768 | 3300053178 | Bacteria | 2096 |
| 641 | Ga0500576_016835 | 3300053725 | Bacteria | 3319 |
| 642 | Ga0500611_005740 | 3300053727 | Bacteria | 1766 |
| 643 | Ga0500645_010480 | 3300053730 | Bacteria | 3063 |
| 644 | Ga0500656_005513 | 3300053732 | Bacteria | 1253 |
| 645 | Ga0500596_001113 | 3300053735 | Bacteria | 5405 |
| 646 | Ga0500596_001115 | 3300053735 | Bacteria | 5397 |
| 647 | Ga0500601_002940 | 3300053737 | Bacteria | 1838 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053111 | Ga0500572_000843 | Ga0500572_000843_4334_5062 | 219 |
| 2 | 3300053136 | Ga0500559_0000829 | Ga0500559_0000829_10325_11053 | 219 |
| 3 | 3300053725 | Ga0500576_016835 | Ga0500576_016835_1359_2087 | 219 |
| 4 | 3300053735 | Ga0500596_001113 | Ga0500596_001113_2068_2796 | 219 |
| 5 | 3300048924 | Ga0496121_0042466 | Ga0496121_0042466_2498_3184 | 221 |
| 6 | 3300039437 | Ga0436365_1263660 | Ga0436365_1263660_348_1037 | 222 |
| 7 | 3300005355 | Ga0070671_100294267 | Ga0070671_1002942672 | 223 |
| 8 | 3300005983 | Ga0081540_1005865 | Ga0081540_10058656 | 223 |
| 9 | 3300025898 | Ga0207692_10379543 | Ga0207692_103795431 | 223 |
| 10 | 3300037853 | Ga0436364_1134021 | Ga0436364_1134021_2932_3627 | 224 |
| 11 | 3300045976 | Ga0466967_0743151 | Ga0466967_0743151_187_882 | 225 |
| 12 | 3300033442 | Ga0315911_1000022 | Ga0315911_1000022118 | 226 |
| 13 | 3300005471 | Ga0070698_100095110 | Ga0070698_1000951102 | 227 |
| 14 | 3300048915 | Ga0496112_0288614 | Ga0496112_0288614_370_1104 | 227 |
| 15 | 3300048924 | Ga0496121_0302286 | Ga0496121_0302286_43_777 | 227 |
| 16 | 3300005330 | Ga0070690_100235183 | Ga0070690_1002351832 | 228 |
| 17 | 3300005578 | Ga0068854_100380101 | Ga0068854_1003801012 | 228 |
| 18 | 3300009093 | Ga0105240_10022030 | Ga0105240_100220305 | 228 |
| 19 | 3300009098 | Ga0105245_10331862 | Ga0105245_103318622 | 228 |
| 20 | 3300009545 | Ga0105237_10045497 | Ga0105237_100454971 | 228 |
| 21 | 3300009551 | Ga0105238_10001743 | Ga0105238_1000174313 | 228 |
| 22 | 3300009551 | Ga0105238_10322618 | Ga0105238_103226182 | 228 |
| 23 | 3300010375 | Ga0105239_10230757 | Ga0105239_102307572 | 228 |
| 24 | 3300013104 | Ga0157370_10117448 | Ga0157370_101174482 | 228 |
| 25 | 3300013105 | Ga0157369_10141525 | Ga0157369_101415252 | 228 |
| 26 | 3300013307 | Ga0157372_10284184 | Ga0157372_102841842 | 228 |
| 27 | 3300013308 | Ga0157375_10621132 | Ga0157375_106211322 | 228 |
| 28 | 3300014745 | Ga0157377_10317756 | Ga0157377_103177561 | 228 |
| 29 | 3300025927 | Ga0207687_10242525 | Ga0207687_102425251 | 228 |
| 30 | 3300025927 | Ga0207687_10566042 | Ga0207687_105660421 | 228 |
| 31 | 3300025935 | Ga0207709_10228630 | Ga0207709_102286302 | 228 |
| 32 | 3300025941 | Ga0207711_10303706 | Ga0207711_103037062 | 228 |
| 33 | 3300048905 | Ga0496102_0679421 | Ga0496102_0679421_73_786 | 228 |
| 34 | 3300048924 | Ga0496121_0033170 | Ga0496121_0033170_3056_3784 | 228 |
| 35 | 3300053177 | Ga0500636_0036403 | Ga0500636_0036403_363_1082 | 228 |
| 36 | 3300048928 | Ga0496125_0177104 | Ga0496125_0177104_540_1271 | 229 |
| 37 | 3300010159 | Ga0099796_10089829 | Ga0099796_100898292 | 230 |
| 38 | 3300009148 | Ga0105243_10429427 | Ga0105243_104294271 | 231 |
| 39 | 3300005439 | Ga0070711_100184269 | Ga0070711_1001842692 | 232 |
| 40 | 3300005983 | Ga0081540_1009326 | Ga0081540_10093263 | 232 |
| 41 | 3300025912 | Ga0207707_10047779 | Ga0207707_100477792 | 232 |
| 42 | 3300035111 | Ga0373923_0055004 | Ga0373923_0055004_965_1666 | 232 |
| 43 | iso_pu_bacteria | 2876808645 | 2876817838 | 233 |
| 44 | 3300005548 | Ga0070665_100119008 | Ga0070665_1001190082 | 234 |
| 45 | 3300006038 | Ga0075365_10085847 | Ga0075365_100858472 | 234 |
| 46 | 3300006048 | Ga0075363_100193101 | Ga0075363_1001931011 | 234 |
| 47 | 3300006177 | Ga0075362_10057028 | Ga0075362_100570282 | 234 |
| 48 | 3300006186 | Ga0075369_10040659 | Ga0075369_100406591 | 234 |
| 49 | 3300006195 | Ga0075366_10212620 | Ga0075366_102126201 | 234 |
| 50 | 3300009093 | Ga0105240_10586306 | Ga0105240_105863061 | 234 |
| 51 | 3300009551 | Ga0105238_10004073 | Ga0105238_1000407311 | 234 |
| 52 | 3300010375 | Ga0105239_10014303 | Ga0105239_100143033 | 234 |
| 53 | 3300013105 | Ga0157369_10033001 | Ga0157369_100330015 | 234 |
| 54 | 3300013296 | Ga0157374_10113743 | Ga0157374_101137434 | 234 |
| 55 | 3300013307 | Ga0157372_10719698 | Ga0157372_107196981 | 234 |
| 56 | 3300022467 | Ga0224712_10037559 | Ga0224712_100375593 | 234 |
| 57 | 3300026142 | Ga0207698_10827665 | Ga0207698_108276651 | 234 |
| 58 | 3300044842 | Ga0466957_0082530 | Ga0466957_0082530_274_987 | 234 |
| 59 | iso_pu_bacteria | 2513237104 | 2513716385 | 234 |
| 60 | 3300005617 | Ga0068859_100089531 | Ga0068859_1000895312 | 235 |
| 61 | 3300005842 | Ga0068858_100191277 | Ga0068858_1001912772 | 235 |
| 62 | 3300006844 | Ga0075428_100140946 | Ga0075428_1001409462 | 235 |
| 63 | 3300006931 | Ga0097620_100089533 | Ga0097620_1000895332 | 235 |
| 64 | 3300009101 | Ga0105247_10013326 | Ga0105247_100133263 | 235 |
| 65 | 3300025253 | Ga0209677_102424 | Ga0209677_1024243 | 235 |
| 66 | 3300025261 | Ga0209233_1000694 | Ga0209233_100069410 | 235 |
| 67 | 3300025272 | Ga0209455_1005264 | Ga0209455_10052643 | 235 |
| 68 | 3300025900 | Ga0207710_10010402 | Ga0207710_100104022 | 235 |
| 69 | 3300025914 | Ga0207671_10117980 | Ga0207671_101179802 | 235 |
| 70 | 3300026035 | Ga0207703_10154187 | Ga0207703_101541871 | 235 |
| 71 | 3300035725 | Ga0373947_0110148 | Ga0373947_0110148_680_1420 | 235 |
| 72 | 3300048903 | Ga0496100_0182597 | Ga0496100_0182597_533_1264 | 236 |
| 73 | 3300048920 | Ga0496117_0035199 | Ga0496117_0035199_2601_3332 | 236 |
| 74 | 3300048921 | Ga0496118_0014251 | Ga0496118_0014251_2950_3681 | 236 |
| 75 | 3300048924 | Ga0496121_0240849 | Ga0496121_0240849_396_1127 | 236 |
| 76 | 3300048928 | Ga0496125_0137243 | Ga0496125_0137243_83_814 | 236 |
| 77 | iso_pu_bacteria | 2508501128 | 2509147829 | 236 |
| 78 | 3300009101 | Ga0105247_10074117 | Ga0105247_100741172 | 237 |
| 79 | 3300009174 | Ga0105241_10249209 | Ga0105241_102492091 | 237 |
| 80 | 3300009553 | Ga0105249_10726062 | Ga0105249_107260621 | 237 |
| 81 | 3300010375 | Ga0105239_10652548 | Ga0105239_106525482 | 237 |
| 82 | 3300013296 | Ga0157374_10466066 | Ga0157374_104660662 | 237 |
| 83 | 3300013308 | Ga0157375_10564250 | Ga0157375_105642501 | 237 |
| 84 | 3300014325 | Ga0163163_10776438 | Ga0163163_107764381 | 237 |
| 85 | 3300014326 | Ga0157380_10229900 | Ga0157380_102299002 | 237 |
| 86 | 3300025923 | Ga0207681_10453504 | Ga0207681_104535042 | 237 |
| 87 | 3300035086 | Ga0373934_0054370 | Ga0373934_0054370_197_916 | 237 |
| 88 | 3300035111 | Ga0373923_0039539 | Ga0373923_0039539_656_1372 | 237 |
| 89 | 3300035113 | Ga0373936_0078514 | Ga0373936_0078514_548_1264 | 237 |
| 90 | 3300035117 | Ga0373953_0000731 | Ga0373953_0000731_4352_5068 | 237 |
| 91 | 3300035118 | Ga0373954_0001719 | Ga0373954_0001719_4511_5227 | 237 |
| 92 | 3300035119 | Ga0373956_0002420 | Ga0373956_0002420_3969_4685 | 237 |
| 93 | 3300035120 | Ga0373957_0000218 | Ga0373957_0000218_6743_7459 | 237 |
| 94 | 3300035172 | Ga0373955_0003024 | Ga0373955_0003024_2456_3172 | 237 |
| 95 | 3300035724 | Ga0373933_0011360 | Ga0373933_0011360_4059_4775 | 237 |
| 96 | 3300036401 | Ga0373937_0023752 | Ga0373937_0023752_4797_5513 | 237 |
| 97 | 3300046454 | Ga0495592_0001238 | Ga0495592_0001238_4677_5393 | 237 |
| 98 | 3300046459 | Ga0495629_0000750 | Ga0495629_0000750_22007_22723 | 237 |
| 99 | 3300046462 | Ga0495651_0014625 | Ga0495651_0014625_5339_6055 | 237 |
| 100 | 3300046463 | Ga0495653_0007956 | Ga0495653_0007956_3664_4380 | 237 |
| 101 | 3300046475 | Ga0495639_0119608 | Ga0495639_0119608_444_1157 | 237 |
| 102 | 3300046492 | Ga0495585_0145034 | Ga0495585_0145034_299_1012 | 237 |
| 103 | 3300046511 | Ga0495608_0000738 | Ga0495608_0000738_13382_14098 | 237 |
| 104 | 3300046513 | Ga0495616_0116199 | Ga0495616_0116199_273_986 | 237 |
| 105 | 3300046514 | Ga0495618_0065409 | Ga0495618_0065409_1154_1870 | 237 |
| 106 | 3300046516 | Ga0495628_0005837 | Ga0495628_0005837_5393_6109 | 237 |
| 107 | 3300046529 | Ga0495652_0004125 | Ga0495652_0004125_9567_10283 | 237 |
| 108 | 3300046536 | Ga0495587_0006945 | Ga0495587_0006945_2929_3645 | 237 |
| 109 | 3300046538 | Ga0495609_0116488 | Ga0495609_0116488_191_904 | 237 |
| 110 | 3300046543 | Ga0495645_0053146 | Ga0495645_0053146_2027_2743 | 237 |
| 111 | 3300046559 | Ga0495667_0014506 | Ga0495667_0014506_2151_2867 | 237 |
| 112 | 3300046615 | Ga0495656_0014978 | Ga0495656_0014978_2040_2753 | 237 |
| 113 | 3300046642 | Ga0495634_0052709 | Ga0495634_0052709_817_1533 | 237 |
| 114 | 3300046663 | Ga0495635_0000166 | Ga0495635_0000166_8680_9396 | 237 |
| 115 | 3300046664 | Ga0495659_0009032 | Ga0495659_0009032_680_1393 | 237 |
| 116 | 3300046674 | Ga0495588_0009190 | Ga0495588_0009190_1090_1803 | 237 |
| 117 | 3300046675 | Ga0495657_0005822 | Ga0495657_0005822_6060_6776 | 237 |
| 118 | 3300046678 | Ga0495599_0014529 | Ga0495599_0014529_1476_2192 | 237 |
| 119 | 3300046679 | Ga0495623_0002267 | Ga0495623_0002267_3278_3994 | 237 |
| 120 | 3300046680 | Ga0495646_0002103 | Ga0495646_0002103_10169_10885 | 237 |
| 121 | 3300046689 | Ga0495613_0058031 | Ga0495613_0058031_1520_2236 | 237 |
| 122 | 3300046691 | Ga0495670_0081446 | Ga0495670_0081446_253_966 | 237 |
| 123 | 3300046692 | Ga0495671_0051376 | Ga0495671_0051376_1029_1742 | 237 |
| 124 | 3300046809 | Ga0495600_0005583 | Ga0495600_0005583_4553_5269 | 237 |
| 125 | 3300047317 | Ga0495604_0004924 | Ga0495604_0004924_3739_4455 | 237 |
| 126 | 3300047319 | Ga0495674_0005019 | Ga0495674_0005019_10628_11344 | 237 |
| 127 | 3300047321 | Ga0495676_0077799 | Ga0495676_0077799_747_1460 | 237 |
| 128 | 3300047322 | Ga0495680_0004903 | Ga0495680_0004903_4303_5019 | 237 |
| 129 | 3300047444 | Ga0495675_0000770 | Ga0495675_0000770_747_1463 | 237 |
| 130 | 3300047471 | Ga0495684_0000501 | Ga0495684_0000501_24444_25160 | 237 |
| 131 | 3300047673 | Ga0495593_0006360 | Ga0495593_0006360_3145_3861 | 237 |
| 132 | 3300048088 | Ga0495602_0019776 | Ga0495602_0019776_5339_6055 | 237 |
| 133 | 3300048907 | Ga0496104_0137623 | Ga0496104_0137623_882_1595 | 237 |
| 134 | 3300048909 | Ga0496106_0201150 | Ga0496106_0201150_307_1020 | 237 |
| 135 | 3300048910 | Ga0496107_0155125 | Ga0496107_0155125_229_942 | 237 |
| 136 | 3300048915 | Ga0496112_0284217 | Ga0496112_0284217_279_992 | 237 |
| 137 | 3300048918 | Ga0496115_0114644 | Ga0496115_0114644_318_1034 | 237 |
| 138 | 3300048922 | Ga0496119_0166993 | Ga0496119_0166993_202_915 | 237 |
| 139 | 3300048923 | Ga0496120_0255828 | Ga0496120_0255828_65_778 | 237 |
| 140 | 3300048924 | Ga0496121_0153258 | Ga0496121_0153258_238_951 | 237 |
| 141 | 3300048928 | Ga0496125_0151052 | Ga0496125_0151052_762_1475 | 237 |
| 142 | 3300048929 | Ga0496126_0011540 | Ga0496126_0011540_1129_1842 | 237 |
| 143 | 3300048929 | Ga0496126_0232554 | Ga0496126_0232554_342_1055 | 237 |
| 144 | 3300049460 | Ga0495682_0068330 | Ga0495682_0068330_337_1050 | 237 |
| 145 | 3300050490 | nmdc:mga03n38_1311_c1 | nmdc:mga03n38_1311_c1_3698_4411 | 237 |
| 146 | 3300050492 | nmdc:mga0yw44_62951_c1 | nmdc:mga0yw44_62951_c1_300_1013 | 237 |
| 147 | 3300050494 | nmdc:mga06z11_147498_c1 | nmdc:mga06z11_147498_c1_278_991 | 237 |
| 148 | 3300050495 | nmdc:mga04h51_49451_c1 | nmdc:mga04h51_49451_c1_233_946 | 237 |
| 149 | 3300050496 | nmdc:mga07m45_243719_c1 | nmdc:mga07m45_243719_c1_323_1036 | 237 |
| 150 | 3300050496 | nmdc:mga07m45_3363_c1 | nmdc:mga07m45_3363_c1_5025_5738 | 237 |
| 151 | 3300050516 | nmdc:mga0sz30_110560_c1 | nmdc:mga0sz30_110560_c1_341_1054 | 237 |
| 152 | 3300053077 | Ga0495601_0014124 | Ga0495601_0014124_3677_4393 | 237 |
| 153 | 3300053084 | Ga0495595_0000332 | Ga0495595_0000332_4226_4942 | 237 |
| 154 | 3300053085 | Ga0495619_0000633 | Ga0495619_0000633_15726_16442 | 237 |
| 155 | 3300053096 | Ga0500641_0072725 | Ga0500641_0072725_229_942 | 237 |
| 156 | 3300053103 | Ga0500555_051033 | Ga0500555_051033_26_739 | 237 |
| 157 | 3300053118 | Ga0500594_0026472 | Ga0500594_0026472_181_894 | 237 |
| 158 | 3300053119 | Ga0500595_012929 | Ga0500595_012929_2269_2982 | 237 |
| 159 | 3300053130 | Ga0500642_0060625 | Ga0500642_0060625_46_759 | 237 |
| 160 | 3300053147 | Ga0500589_024473 | Ga0500589_024473_402_1115 | 237 |
| 161 | 3300053158 | Ga0500627_0057447 | Ga0500627_0057447_674_1387 | 237 |
| 162 | 3300046499 | Ga0495594_0346493 | Ga0495594_0346493_18_734 | 238 |
| 163 | 3300053080 | Ga0500635_0005911 | Ga0500635_0005911_2262_2987 | 238 |
| 164 | 3300053080 | Ga0500635_0073005 | Ga0500635_0073005_78_794 | 238 |
| 165 | 3300053094 | Ga0500566_0153323 | Ga0500566_0153323_426_1142 | 238 |
| 166 | 3300053150 | Ga0500603_004752 | Ga0500603_004752_1482_2198 | 238 |
| 167 | 3300053178 | Ga0500637_0064768 | Ga0500637_0064768_671_1387 | 238 |
| 168 | 3300003322 | rootL2_10232803 | rootL2_102328033 | 239 |
| 169 | 3300039438 | Ga0436360_0175672 | Ga0436360_0175672_968_1699 | 239 |
| 170 | 3300053177 | Ga0500636_0014194 | Ga0500636_0014194_3182_3925 | 239 |
| 171 | 3300005937 | Ga0081455_10204961 | Ga0081455_102049612 | 240 |
| 172 | 3300005983 | Ga0081540_1004015 | Ga0081540_10040152 | 240 |
| 173 | 3300009093 | Ga0105240_10427003 | Ga0105240_104270032 | 240 |
| 174 | 3300028653 | Ga0265323_10009075 | Ga0265323_100090754 | 240 |
| 175 | 3300028666 | Ga0265336_10019148 | Ga0265336_100191482 | 240 |
| 176 | 3300028800 | Ga0265338_10011039 | Ga0265338_100110393 | 240 |
| 177 | 3300029957 | Ga0265324_10093029 | Ga0265324_100930291 | 240 |
| 178 | 3300049583 | Ga0501067_0029547 | Ga0501067_0029547_47_769 | 240 |
| 179 | iso_pu_bacteria | 2513237137 | 2513859159 | 240 |
| 180 | iso_pu_bacteria | 2903768456 | 2903777304 | 240 |
| 181 | 3300005435 | Ga0070714_100015426 | Ga0070714_1000154262 | 241 |
| 182 | 3300005436 | Ga0070713_100238859 | Ga0070713_1002388592 | 241 |
| 183 | 3300006175 | Ga0070712_100337765 | Ga0070712_1003377652 | 241 |
| 184 | 3300013104 | Ga0157370_10365171 | Ga0157370_103651712 | 241 |
| 185 | 3300013297 | Ga0157378_11255832 | Ga0157378_112558321 | 241 |
| 186 | 3300025929 | Ga0207664_10011265 | Ga0207664_100112652 | 241 |
| 187 | 3300035083 | Ga0373926_0009183 | Ga0373926_0009183_2235_2966 | 241 |
| 188 | 3300035170 | Ga0373943_0013605 | Ga0373943_0013605_57_788 | 241 |
| 189 | 3300035171 | Ga0373946_0076943 | Ga0373946_0076943_564_1295 | 241 |
| 190 | 3300035410 | Ga0373924_0043328 | Ga0373924_0043328_75_806 | 241 |
| 191 | 3300035692 | Ga0373935_0656560 | Ga0373935_0656560_13_744 | 241 |
| 192 | 3300035724 | Ga0373933_0326977 | Ga0373933_0326977_146_877 | 241 |
| 193 | 3300035725 | Ga0373947_0007461 | Ga0373947_0007461_2129_2860 | 241 |
| 194 | 3300036401 | Ga0373937_0048069 | Ga0373937_0048069_1469_2200 | 241 |
| 195 | 3300039450 | Ga0436363_1660925 | Ga0436363_1660925_1023_1760 | 241 |
| 196 | 3300046454 | Ga0495592_0213444 | Ga0495592_0213444_77_808 | 241 |
| 197 | 3300046459 | Ga0495629_0048286 | Ga0495629_0048286_2203_2934 | 241 |
| 198 | 3300046475 | Ga0495639_0012974 | Ga0495639_0012974_60_791 | 241 |
| 199 | 3300046477 | Ga0495664_0004921 | Ga0495664_0004921_3917_4648 | 241 |
| 200 | 3300046511 | Ga0495608_0221870 | Ga0495608_0221870_30_761 | 241 |
| 201 | 3300046526 | Ga0495666_0033207 | Ga0495666_0033207_766_1497 | 241 |
| 202 | 3300046529 | Ga0495652_0138768 | Ga0495652_0138768_557_1288 | 241 |
| 203 | 3300046533 | Ga0495640_0042745 | Ga0495640_0042745_666_1397 | 241 |
| 204 | 3300046536 | Ga0495587_0049585 | Ga0495587_0049585_1553_2284 | 241 |
| 205 | 3300046543 | Ga0495645_0117193 | Ga0495645_0117193_441_1172 | 241 |
| 206 | 3300046543 | Ga0495645_0371989 | Ga0495645_0371989_102_851 | 241 |
| 207 | 3300046642 | Ga0495634_0043116 | Ga0495634_0043116_46_777 | 241 |
| 208 | 3300046648 | Ga0495611_0214843 | Ga0495611_0214843_92_820 | 241 |
| 209 | 3300046680 | Ga0495646_0184454 | Ga0495646_0184454_117_848 | 241 |
| 210 | 3300046683 | Ga0495658_0015804 | Ga0495658_0015804_1010_1741 | 241 |
| 211 | 3300046809 | Ga0495600_0049111 | Ga0495600_0049111_1234_1983 | 241 |
| 212 | 3300047317 | Ga0495604_0422841 | Ga0495604_0422841_131_862 | 241 |
| 213 | 3300047319 | Ga0495674_0013003 | Ga0495674_0013003_6547_7278 | 241 |
| 214 | 3300047321 | Ga0495676_0094780 | Ga0495676_0094780_506_1237 | 241 |
| 215 | 3300047471 | Ga0495684_0195971 | Ga0495684_0195971_582_1313 | 241 |
| 216 | 3300048921 | Ga0496118_0245440 | Ga0496118_0245440_112_840 | 241 |
| 217 | 3300053077 | Ga0495601_0082240 | Ga0495601_0082240_861_1592 | 241 |
| 218 | 3300053085 | Ga0495619_0464073 | Ga0495619_0464073_40_771 | 241 |
| 219 | iso_pu_bacteria | 2728368998 | 2728750777 | 241 |
| 220 | iso_pu_bacteria | 8056681323 | 8056681744 | 241 |
| 221 | 3300003320 | rootH2_10065279 | rootH2_100652792 | 242 |
| 222 | 3300003323 | rootH1_10056145 | rootH1_100561452 | 242 |
| 223 | 3300005434 | Ga0070709_10016670 | Ga0070709_100166702 | 242 |
| 224 | 3300005458 | Ga0070681_10107417 | Ga0070681_101074172 | 242 |
| 225 | 3300005577 | Ga0068857_100085418 | Ga0068857_1000854182 | 242 |
| 226 | 3300005614 | Ga0068856_100226087 | Ga0068856_1002260871 | 242 |
| 227 | 3300009551 | Ga0105238_10067648 | Ga0105238_100676482 | 242 |
| 228 | 3300010375 | Ga0105239_11102021 | Ga0105239_111020211 | 242 |
| 229 | 3300013307 | Ga0157372_10693423 | Ga0157372_106934231 | 242 |
| 230 | 3300025297 | Ga0209758_1018978 | Ga0209758_10189782 | 242 |
| 231 | 3300025912 | Ga0207707_10039598 | Ga0207707_100395983 | 242 |
| 232 | 3300026078 | Ga0207702_10349794 | Ga0207702_103497942 | 242 |
| 233 | 3300026116 | Ga0207674_10046764 | Ga0207674_100467643 | 242 |
| 234 | 3300037068 | Ga0373925_0123513 | Ga0373925_0123513_759_1490 | 242 |
| 235 | 3300044694 | Ga0466963_0053540 | Ga0466963_0053540_853_1584 | 242 |
| 236 | 3300048924 | Ga0496121_0016292 | Ga0496121_0016292_2676_3407 | 242 |
| 237 | 3300048929 | Ga0496126_0027538 | Ga0496126_0027538_2711_3442 | 242 |
| 238 | 3300053094 | Ga0500566_0000078 | Ga0500566_0000078_23902_24636 | 242 |
| 239 | 3300053095 | Ga0500640_000121 | Ga0500640_000121_1492_2226 | 242 |
| 240 | 3300053111 | Ga0500572_000170 | Ga0500572_000170_17643_18377 | 242 |
| 241 | 3300053115 | Ga0500591_020796 | Ga0500591_020796_1128_1862 | 242 |
| 242 | 3300053122 | Ga0500608_003737 | Ga0500608_003737_3017_3751 | 242 |
| 243 | 3300053123 | Ga0500614_003747 | Ga0500614_003747_2501_3235 | 242 |
| 244 | 3300053150 | Ga0500603_000081 | Ga0500603_000081_17643_18377 | 242 |
| 245 | 3300053159 | Ga0500630_011249 | Ga0500630_011249_2262_2996 | 242 |
| 246 | 3300053162 | Ga0500638_023658 | Ga0500638_023658_1459_2193 | 242 |
| 247 | 3300053735 | Ga0500596_001115 | Ga0500596_001115_4166_4900 | 242 |
| 248 | 3300053737 | Ga0500601_002940 | Ga0500601_002940_125_859 | 242 |
| 249 | iso_pu_bacteria | 2721755755 | 2723848823 | 242 |
| 250 | iso_pu_bacteria | 2879110137 | 2879116789 | 242 |
| 251 | 3300005336 | Ga0070680_100368291 | Ga0070680_1003682911 | 243 |
| 252 | 3300005458 | Ga0070681_10033857 | Ga0070681_100338571 | 243 |
| 253 | 3300005458 | Ga0070681_10066584 | Ga0070681_100665842 | 243 |
| 254 | 3300005535 | Ga0070684_100541892 | Ga0070684_1005418921 | 243 |
| 255 | 3300009545 | Ga0105237_10508266 | Ga0105237_105082661 | 243 |
| 256 | 3300013105 | Ga0157369_10018060 | Ga0157369_100180607 | 243 |
| 257 | 3300025912 | Ga0207707_10000386 | Ga0207707_100003864 | 243 |
| 258 | 3300025913 | Ga0207695_10404305 | Ga0207695_104043051 | 243 |
| 259 | 3300025914 | Ga0207671_10451980 | Ga0207671_104519801 | 243 |
| 260 | 3300025917 | Ga0207660_10187511 | Ga0207660_101875111 | 243 |
| 261 | 3300025921 | Ga0207652_10076797 | Ga0207652_100767973 | 243 |
| 262 | 3300031731 | Ga0307405_10216953 | Ga0307405_102169532 | 243 |
| 263 | 3300031901 | Ga0307406_10210029 | Ga0307406_102100292 | 243 |
| 264 | 3300032002 | Ga0307416_100275087 | Ga0307416_1002750872 | 243 |
| 265 | 3300032126 | Ga0307415_100048349 | Ga0307415_1000483492 | 243 |
| 266 | 3300035695 | Ga0373927_0128792 | Ga0373927_0128792_398_1135 | 243 |
| 267 | 3300048924 | Ga0496121_0108497 | Ga0496121_0108497_1104_1844 | 243 |
| 268 | 3300006871 | Ga0075434_100027848 | Ga0075434_1000278486 | 244 |
| 269 | 3300007076 | Ga0075435_100012504 | Ga0075435_1000125046 | 244 |
| 270 | 3300007788 | Ga0099795_10036535 | Ga0099795_100365352 | 244 |
| 271 | 3300010159 | Ga0099796_10059880 | Ga0099796_100598801 | 244 |
| 272 | 3300025907 | Ga0207645_10134844 | Ga0207645_101348442 | 244 |
| 273 | 3300025925 | Ga0207650_10422366 | Ga0207650_104223661 | 244 |
| 274 | 3300048915 | Ga0496112_0309803 | Ga0496112_0309803_440_1174 | 244 |
| 275 | 3300050512 | nmdc:mga0n895_33766_c1 | nmdc:mga0n895_33766_c1_455_1195 | 244 |
| 276 | 3300050513 | nmdc:mga0rr50_133350_c1 | nmdc:mga0rr50_133350_c1_615_1355 | 244 |
| 277 | 3300005328 | Ga0070676_10069179 | Ga0070676_100691792 | 245 |
| 278 | 3300005331 | Ga0070670_100215051 | Ga0070670_1002150512 | 245 |
| 279 | 3300005334 | Ga0068869_100027419 | Ga0068869_1000274192 | 245 |
| 280 | 3300005338 | Ga0068868_100026005 | Ga0068868_1000260052 | 245 |
| 281 | 3300005341 | Ga0070691_10050182 | Ga0070691_100501822 | 245 |
| 282 | 3300005353 | Ga0070669_100637346 | Ga0070669_1006373461 | 245 |
| 283 | 3300005355 | Ga0070671_100146906 | Ga0070671_1001469062 | 245 |
| 284 | 3300005364 | Ga0070673_100155297 | Ga0070673_1001552972 | 245 |
| 285 | 3300005366 | Ga0070659_100531847 | Ga0070659_1005318471 | 245 |
| 286 | 3300005434 | Ga0070709_10001487 | Ga0070709_100014874 | 245 |
| 287 | 3300005435 | Ga0070714_100594497 | Ga0070714_1005944971 | 245 |
| 288 | 3300005436 | Ga0070713_100030133 | Ga0070713_1000301333 | 245 |
| 289 | 3300005437 | Ga0070710_10015094 | Ga0070710_100150942 | 245 |
| 290 | 3300005439 | Ga0070711_100003888 | Ga0070711_1000038883 | 245 |
| 291 | 3300005456 | Ga0070678_100158439 | Ga0070678_1001584392 | 245 |
| 292 | 3300005457 | Ga0070662_100035970 | Ga0070662_1000359703 | 245 |
| 293 | 3300005459 | Ga0068867_100540291 | Ga0068867_1005402911 | 245 |
| 294 | 3300005539 | Ga0068853_100136738 | Ga0068853_1001367382 | 245 |
| 295 | 3300005539 | Ga0068853_100292389 | Ga0068853_1002923892 | 245 |
| 296 | 3300005547 | Ga0070693_100013877 | Ga0070693_1000138772 | 245 |
| 297 | 3300005548 | Ga0070665_100083124 | Ga0070665_1000831242 | 245 |
| 298 | 3300005548 | Ga0070665_100525923 | Ga0070665_1005259231 | 245 |
| 299 | 3300005563 | Ga0068855_100130222 | Ga0068855_1001302224 | 245 |
| 300 | 3300005563 | Ga0068855_100212071 | Ga0068855_1002120712 | 245 |
| 301 | 3300005564 | Ga0070664_100450466 | Ga0070664_1004504662 | 245 |
| 302 | 3300005577 | Ga0068857_100151750 | Ga0068857_1001517501 | 245 |
| 303 | 3300005578 | Ga0068854_100079839 | Ga0068854_1000798392 | 245 |
| 304 | 3300005614 | Ga0068856_100293585 | Ga0068856_1002935852 | 245 |
| 305 | 3300005616 | Ga0068852_100114629 | Ga0068852_1001146291 | 245 |
| 306 | 3300005617 | Ga0068859_100338557 | Ga0068859_1003385571 | 245 |
| 307 | 3300005618 | Ga0068864_100065929 | Ga0068864_1000659293 | 245 |
| 308 | 3300005719 | Ga0068861_100195902 | Ga0068861_1001959022 | 245 |
| 309 | 3300005841 | Ga0068863_100266058 | Ga0068863_1002660581 | 245 |
| 310 | 3300005842 | Ga0068858_100052617 | Ga0068858_1000526174 | 245 |
| 311 | 3300005843 | Ga0068860_100216348 | Ga0068860_1002163482 | 245 |
| 312 | 3300005983 | Ga0081540_1023846 | Ga0081540_10238462 | 245 |
| 313 | 3300006038 | Ga0075365_10271295 | Ga0075365_102712951 | 245 |
| 314 | 3300006038 | Ga0075365_10432090 | Ga0075365_104320901 | 245 |
| 315 | 3300006042 | Ga0075368_10045183 | Ga0075368_100451832 | 245 |
| 316 | 3300006051 | Ga0075364_10106168 | Ga0075364_101061682 | 245 |
| 317 | 3300006058 | Ga0075432_10107655 | Ga0075432_101076551 | 245 |
| 318 | 3300006175 | Ga0070712_100008298 | Ga0070712_1000082984 | 245 |
| 319 | 3300006186 | Ga0075369_10055700 | Ga0075369_100557002 | 245 |
| 320 | 3300006195 | Ga0075366_10175116 | Ga0075366_101751161 | 245 |
| 321 | 3300006852 | Ga0075433_10467919 | Ga0075433_104679192 | 245 |
| 322 | 3300006931 | Ga0097620_100338545 | Ga0097620_1003385451 | 245 |
| 323 | 3300006943 | Ga0099822_1012261 | Ga0099822_10122619 | 245 |
| 324 | 3300009094 | Ga0111539_10759872 | Ga0111539_107598722 | 245 |
| 325 | 3300009098 | Ga0105245_10082903 | Ga0105245_100829032 | 245 |
| 326 | 3300009101 | Ga0105247_10302205 | Ga0105247_103022051 | 245 |
| 327 | 3300009148 | Ga0105243_10276725 | Ga0105243_102767252 | 245 |
| 328 | 3300009174 | Ga0105241_10227278 | Ga0105241_102272781 | 245 |
| 329 | 3300009176 | Ga0105242_10302434 | Ga0105242_103024342 | 245 |
| 330 | 3300009177 | Ga0105248_10076907 | Ga0105248_100769074 | 245 |
| 331 | 3300009545 | Ga0105237_10220415 | Ga0105237_102204151 | 245 |
| 332 | 3300009551 | Ga0105238_10030170 | Ga0105238_100301705 | 245 |
| 333 | 3300009551 | Ga0105238_10196680 | Ga0105238_101966802 | 245 |
| 334 | 3300009553 | Ga0105249_10367885 | Ga0105249_103678852 | 245 |
| 335 | 3300010159 | Ga0099796_10101441 | Ga0099796_101014412 | 245 |
| 336 | 3300010375 | Ga0105239_10179856 | Ga0105239_101798562 | 245 |
| 337 | 3300011119 | Ga0105246_10030767 | Ga0105246_100307672 | 245 |
| 338 | 3300013296 | Ga0157374_10227925 | Ga0157374_102279252 | 245 |
| 339 | 3300013297 | Ga0157378_10598189 | Ga0157378_105981891 | 245 |
| 340 | 3300013306 | Ga0163162_10572632 | Ga0163162_105726322 | 245 |
| 341 | 3300013308 | Ga0157375_10536581 | Ga0157375_105365812 | 245 |
| 342 | 3300014325 | Ga0163163_10119609 | Ga0163163_101196092 | 245 |
| 343 | 3300014745 | Ga0157377_10113406 | Ga0157377_101134061 | 245 |
| 344 | 3300014969 | Ga0157376_10210638 | Ga0157376_102106382 | 245 |
| 345 | 3300025898 | Ga0207692_10016278 | Ga0207692_100162783 | 245 |
| 346 | 3300025900 | Ga0207710_10035623 | Ga0207710_100356232 | 245 |
| 347 | 3300025901 | Ga0207688_10132020 | Ga0207688_101320201 | 245 |
| 348 | 3300025903 | Ga0207680_10290781 | Ga0207680_102907811 | 245 |
| 349 | 3300025906 | Ga0207699_10010672 | Ga0207699_100106723 | 245 |
| 350 | 3300025915 | Ga0207693_10025202 | Ga0207693_100252022 | 245 |
| 351 | 3300025916 | Ga0207663_10113642 | Ga0207663_101136422 | 245 |
| 352 | 3300025920 | Ga0207649_10652612 | Ga0207649_106526121 | 245 |
| 353 | 3300025926 | Ga0207659_10136108 | Ga0207659_101361082 | 245 |
| 354 | 3300025927 | Ga0207687_10221465 | Ga0207687_102214653 | 245 |
| 355 | 3300025929 | Ga0207664_10073307 | Ga0207664_100733072 | 245 |
| 356 | 3300025932 | Ga0207690_10150002 | Ga0207690_101500022 | 245 |
| 357 | 3300025933 | Ga0207706_10340910 | Ga0207706_103409101 | 245 |
| 358 | 3300025942 | Ga0207689_10164622 | Ga0207689_101646222 | 245 |
| 359 | 3300025949 | Ga0207667_10114401 | Ga0207667_101144014 | 245 |
| 360 | 3300025960 | Ga0207651_10318840 | Ga0207651_103188402 | 245 |
| 361 | 3300026023 | Ga0207677_10042292 | Ga0207677_100422922 | 245 |
| 362 | 3300026035 | Ga0207703_10072541 | Ga0207703_100725413 | 245 |
| 363 | 3300026035 | Ga0207703_10073571 | Ga0207703_100735713 | 245 |
| 364 | 3300026041 | Ga0207639_10230641 | Ga0207639_102306412 | 245 |
| 365 | 3300026067 | Ga0207678_10054475 | Ga0207678_100544752 | 245 |
| 366 | 3300026095 | Ga0207676_10006429 | Ga0207676_100064292 | 245 |
| 367 | 3300026116 | Ga0207674_10199010 | Ga0207674_101990102 | 245 |
| 368 | 3300026118 | Ga0207675_100276971 | Ga0207675_1002769712 | 245 |
| 369 | 3300026121 | Ga0207683_10178366 | Ga0207683_101783662 | 245 |
| 370 | 3300027357 | Ga0209589_1000005 | Ga0209589_100000545 | 245 |
| 371 | 3300027361 | Ga0209489_100005 | Ga0209489_10000545 | 245 |
| 372 | 3300027363 | Ga0209700_100006 | Ga0209700_10000645 | 245 |
| 373 | 3300028379 | Ga0268266_10192392 | Ga0268266_101923921 | 245 |
| 374 | 3300028381 | Ga0268264_10157699 | Ga0268264_101576992 | 245 |
| 375 | 3300048907 | Ga0496104_0251224 | Ga0496104_0251224_379_1116 | 245 |
| 376 | 3300048912 | Ga0496109_0271311 | Ga0496109_0271311_788_1525 | 245 |
| 377 | 3300048915 | Ga0496112_0020266 | Ga0496112_0020266_2887_3624 | 245 |
| 378 | 3300048922 | Ga0496119_0071247 | Ga0496119_0071247_737_1474 | 245 |
| 379 | 3300048924 | Ga0496121_0410914 | Ga0496121_0410914_12_749 | 245 |
| 380 | 3300048927 | Ga0496124_0269614 | Ga0496124_0269614_74_853 | 245 |
| 381 | 3300048928 | Ga0496125_0077954 | Ga0496125_0077954_54_833 | 245 |
| 382 | 3300048929 | Ga0496126_0005480 | Ga0496126_0005480_5020_5760 | 245 |
| 383 | 3300050492 | nmdc:mga0yw44_83080_c1 | nmdc:mga0yw44_83080_c1_356_1093 | 245 |
| 384 | 3300053096 | Ga0500641_0001219 | Ga0500641_0001219_1858_2613 | 245 |
| 385 | 3300053119 | Ga0500595_059998 | Ga0500595_059998_244_981 | 245 |
| 386 | 3300053151 | Ga0500604_0089674 | Ga0500604_0089674_20_757 | 245 |
| 387 | 3300003215 | JGI25153J46596_10002652 | JGI25153J46596_100026526 | 246 |
| 388 | 3300005329 | Ga0070683_100024418 | Ga0070683_1000244184 | 246 |
| 389 | 3300005330 | Ga0070690_100312513 | Ga0070690_1003125132 | 246 |
| 390 | 3300005331 | Ga0070670_100197497 | Ga0070670_1001974972 | 246 |
| 391 | 3300005334 | Ga0068869_100138760 | Ga0068869_1001387602 | 246 |
| 392 | 3300005334 | Ga0068869_100291234 | Ga0068869_1002912342 | 246 |
| 393 | 3300005336 | Ga0070680_100006843 | Ga0070680_1000068439 | 246 |
| 394 | 3300005338 | Ga0068868_100232886 | Ga0068868_1002328862 | 246 |
| 395 | 3300005339 | Ga0070660_100135773 | Ga0070660_1001357731 | 246 |
| 396 | 3300005339 | Ga0070660_100291849 | Ga0070660_1002918491 | 246 |
| 397 | 3300005344 | Ga0070661_100166021 | Ga0070661_1001660212 | 246 |
| 398 | 3300005345 | Ga0070692_10079244 | Ga0070692_100792442 | 246 |
| 399 | 3300005347 | Ga0070668_100305439 | Ga0070668_1003054391 | 246 |
| 400 | 3300005347 | Ga0070668_100393734 | Ga0070668_1003937341 | 246 |
| 401 | 3300005355 | Ga0070671_100186437 | Ga0070671_1001864372 | 246 |
| 402 | 3300005356 | Ga0070674_100742015 | Ga0070674_1007420151 | 246 |
| 403 | 3300005365 | Ga0070688_100409779 | Ga0070688_1004097791 | 246 |
| 404 | 3300005367 | Ga0070667_100239516 | Ga0070667_1002395161 | 246 |
| 405 | 3300005437 | Ga0070710_10204679 | Ga0070710_102046791 | 246 |
| 406 | 3300005441 | Ga0070700_100425868 | Ga0070700_1004258681 | 246 |
| 407 | 3300005445 | Ga0070708_100181247 | Ga0070708_1001812473 | 246 |
| 408 | 3300005455 | Ga0070663_100054420 | Ga0070663_1000544202 | 246 |
| 409 | 3300005455 | Ga0070663_100135637 | Ga0070663_1001356372 | 246 |
| 410 | 3300005456 | Ga0070678_100106351 | Ga0070678_1001063512 | 246 |
| 411 | 3300005456 | Ga0070678_101018804 | Ga0070678_1010188041 | 246 |
| 412 | 3300005468 | Ga0070707_100045951 | Ga0070707_1000459512 | 246 |
| 413 | 3300005535 | Ga0070684_100007774 | Ga0070684_1000077742 | 246 |
| 414 | 3300005535 | Ga0070684_100397204 | Ga0070684_1003972041 | 246 |
| 415 | 3300005539 | Ga0068853_100003590 | Ga0068853_1000035903 | 246 |
| 416 | 3300005539 | Ga0068853_100401044 | Ga0068853_1004010442 | 246 |
| 417 | 3300005543 | Ga0070672_100081783 | Ga0070672_1000817832 | 246 |
| 418 | 3300005548 | Ga0070665_100013002 | Ga0070665_1000130027 | 246 |
| 419 | 3300005548 | Ga0070665_100132590 | Ga0070665_1001325902 | 246 |
| 420 | 3300005548 | Ga0070665_100552682 | Ga0070665_1005526822 | 246 |
| 421 | 3300005577 | Ga0068857_100084537 | Ga0068857_1000845372 | 246 |
| 422 | 3300005614 | Ga0068856_100000055 | Ga0068856_10000005551 | 246 |
| 423 | 3300005614 | Ga0068856_100782777 | Ga0068856_1007827771 | 246 |
| 424 | 3300005615 | Ga0070702_100104952 | Ga0070702_1001049521 | 246 |
| 425 | 3300005616 | Ga0068852_100221209 | Ga0068852_1002212091 | 246 |
| 426 | 3300005616 | Ga0068852_100263109 | Ga0068852_1002631092 | 246 |
| 427 | 3300005617 | Ga0068859_100142154 | Ga0068859_1001421542 | 246 |
| 428 | 3300005618 | Ga0068864_100366767 | Ga0068864_1003667672 | 246 |
| 429 | 3300005718 | Ga0068866_10157642 | Ga0068866_101576421 | 246 |
| 430 | 3300005719 | Ga0068861_100719120 | Ga0068861_1007191201 | 246 |
| 431 | 3300005719 | Ga0068861_100780771 | Ga0068861_1007807711 | 246 |
| 432 | 3300005841 | Ga0068863_100346571 | Ga0068863_1003465712 | 246 |
| 433 | 3300005841 | Ga0068863_100391809 | Ga0068863_1003918091 | 246 |
| 434 | 3300005842 | Ga0068858_100104845 | Ga0068858_1001048453 | 246 |
| 435 | 3300005842 | Ga0068858_100154086 | Ga0068858_1001540862 | 246 |
| 436 | 3300005842 | Ga0068858_100250382 | Ga0068858_1002503822 | 246 |
| 437 | 3300005842 | Ga0068858_100701475 | Ga0068858_1007014751 | 246 |
| 438 | 3300005842 | Ga0068858_100801910 | Ga0068858_1008019101 | 246 |
| 439 | 3300005843 | Ga0068860_100362846 | Ga0068860_1003628461 | 246 |
| 440 | 3300005844 | Ga0068862_100351642 | Ga0068862_1003516421 | 246 |
| 441 | 3300005983 | Ga0081540_1003764 | Ga0081540_10037645 | 246 |
| 442 | 3300005983 | Ga0081540_1145600 | Ga0081540_11456001 | 246 |
| 443 | 3300006038 | Ga0075365_10011031 | Ga0075365_100110311 | 246 |
| 444 | 3300006038 | Ga0075365_10028198 | Ga0075365_100281982 | 246 |
| 445 | 3300006042 | Ga0075368_10053190 | Ga0075368_100531902 | 246 |
| 446 | 3300006051 | Ga0075364_10115370 | Ga0075364_101153702 | 246 |
| 447 | 3300006177 | Ga0075362_10176981 | Ga0075362_101769812 | 246 |
| 448 | 3300006178 | Ga0075367_10030593 | Ga0075367_100305932 | 246 |
| 449 | 3300006178 | Ga0075367_10150222 | Ga0075367_101502222 | 246 |
| 450 | 3300006178 | Ga0075367_10170947 | Ga0075367_101709472 | 246 |
| 451 | 3300006195 | Ga0075366_10139491 | Ga0075366_101394912 | 246 |
| 452 | 3300006237 | Ga0097621_100302697 | Ga0097621_1003026972 | 246 |
| 453 | 3300006353 | Ga0075370_10020057 | Ga0075370_100200572 | 246 |
| 454 | 3300006353 | Ga0075370_10132925 | Ga0075370_101329252 | 246 |
| 455 | 3300006881 | Ga0068865_100317631 | Ga0068865_1003176311 | 246 |
| 456 | 3300006931 | Ga0097620_100142152 | Ga0097620_1001421522 | 246 |
| 457 | 3300007265 | Ga0099794_10013774 | Ga0099794_100137741 | 246 |
| 458 | 3300007265 | Ga0099794_10079252 | Ga0099794_100792522 | 246 |
| 459 | 3300007788 | Ga0099795_10031449 | Ga0099795_100314491 | 246 |
| 460 | 3300009093 | Ga0105240_10437572 | Ga0105240_104375721 | 246 |
| 461 | 3300009098 | Ga0105245_10363741 | Ga0105245_103637411 | 246 |
| 462 | 3300009101 | Ga0105247_10053876 | Ga0105247_100538764 | 246 |
| 463 | 3300009101 | Ga0105247_10253921 | Ga0105247_102539212 | 246 |
| 464 | 3300009177 | Ga0105248_10184785 | Ga0105248_101847852 | 246 |
| 465 | 3300009177 | Ga0105248_10185973 | Ga0105248_101859731 | 246 |
| 466 | 3300009553 | Ga0105249_10230558 | Ga0105249_102305582 | 246 |
| 467 | 3300009553 | Ga0105249_10329798 | Ga0105249_103297982 | 246 |
| 468 | 3300010375 | Ga0105239_10025293 | Ga0105239_100252936 | 246 |
| 469 | 3300011119 | Ga0105246_10064349 | Ga0105246_100643493 | 246 |
| 470 | 3300013297 | Ga0157378_10247296 | Ga0157378_102472961 | 246 |
| 471 | 3300013306 | Ga0163162_10257682 | Ga0163162_102576821 | 246 |
| 472 | 3300013308 | Ga0157375_10044068 | Ga0157375_100440682 | 246 |
| 473 | 3300013308 | Ga0157375_10350668 | Ga0157375_103506682 | 246 |
| 474 | 3300014326 | Ga0157380_10137822 | Ga0157380_101378222 | 246 |
| 475 | 3300014326 | Ga0157380_10332748 | Ga0157380_103327482 | 246 |
| 476 | 3300014745 | Ga0157377_10249794 | Ga0157377_102497941 | 246 |
| 477 | 3300014968 | Ga0157379_10135592 | Ga0157379_101355922 | 246 |
| 478 | 3300014968 | Ga0157379_10545212 | Ga0157379_105452122 | 246 |
| 479 | 3300017792 | Ga0163161_10194886 | Ga0163161_101948862 | 246 |
| 480 | 3300017792 | Ga0163161_10222728 | Ga0163161_102227282 | 246 |
| 481 | 3300025315 | Ga0207697_10052681 | Ga0207697_100526812 | 246 |
| 482 | 3300025899 | Ga0207642_10113215 | Ga0207642_101132151 | 246 |
| 483 | 3300025900 | Ga0207710_10084753 | Ga0207710_100847532 | 246 |
| 484 | 3300025911 | Ga0207654_10125342 | Ga0207654_101253422 | 246 |
| 485 | 3300025912 | Ga0207707_10001016 | Ga0207707_1000101627 | 246 |
| 486 | 3300025914 | Ga0207671_10016121 | Ga0207671_100161211 | 246 |
| 487 | 3300025917 | Ga0207660_10000887 | Ga0207660_1000088717 | 246 |
| 488 | 3300025918 | Ga0207662_10080894 | Ga0207662_100808943 | 246 |
| 489 | 3300025919 | Ga0207657_10001391 | Ga0207657_1000139110 | 246 |
| 490 | 3300025920 | Ga0207649_10214878 | Ga0207649_102148782 | 246 |
| 491 | 3300025921 | Ga0207652_10068736 | Ga0207652_100687362 | 246 |
| 492 | 3300025923 | Ga0207681_10274777 | Ga0207681_102747772 | 246 |
| 493 | 3300025924 | Ga0207694_10492973 | Ga0207694_104929732 | 246 |
| 494 | 3300025925 | Ga0207650_10387506 | Ga0207650_103875062 | 246 |
| 495 | 3300025928 | Ga0207700_10090686 | Ga0207700_100906862 | 246 |
| 496 | 3300025931 | Ga0207644_10187010 | Ga0207644_101870101 | 246 |
| 497 | 3300025931 | Ga0207644_10290872 | Ga0207644_102908722 | 246 |
| 498 | 3300025936 | Ga0207670_10301362 | Ga0207670_103013621 | 246 |
| 499 | 3300025937 | Ga0207669_10178991 | Ga0207669_101789912 | 246 |
| 500 | 3300025937 | Ga0207669_10186272 | Ga0207669_101862722 | 246 |
| 501 | 3300025938 | Ga0207704_10281903 | Ga0207704_102819031 | 246 |
| 502 | 3300025940 | Ga0207691_10048268 | Ga0207691_100482683 | 246 |
| 503 | 3300025940 | Ga0207691_10314333 | Ga0207691_103143332 | 246 |
| 504 | 3300025941 | Ga0207711_10022786 | Ga0207711_100227863 | 246 |
| 505 | 3300025942 | Ga0207689_10043282 | Ga0207689_100432821 | 246 |
| 506 | 3300025942 | Ga0207689_10301957 | Ga0207689_103019572 | 246 |
| 507 | 3300025944 | Ga0207661_10185885 | Ga0207661_101858851 | 246 |
| 508 | 3300025949 | Ga0207667_10011614 | Ga0207667_100116141 | 246 |
| 509 | 3300025961 | Ga0207712_10352662 | Ga0207712_103526622 | 246 |
| 510 | 3300025972 | Ga0207668_10358018 | Ga0207668_103580181 | 246 |
| 511 | 3300025972 | Ga0207668_10414523 | Ga0207668_104145231 | 246 |
| 512 | 3300025986 | Ga0207658_10184991 | Ga0207658_101849912 | 246 |
| 513 | 3300026035 | Ga0207703_10135872 | Ga0207703_101358722 | 246 |
| 514 | 3300026035 | Ga0207703_10288310 | Ga0207703_102883101 | 246 |
| 515 | 3300026041 | Ga0207639_10056384 | Ga0207639_100563842 | 246 |
| 516 | 3300026041 | Ga0207639_10196308 | Ga0207639_101963082 | 246 |
| 517 | 3300026067 | Ga0207678_10036846 | Ga0207678_100368462 | 246 |
| 518 | 3300026067 | Ga0207678_10084475 | Ga0207678_100844752 | 246 |
| 519 | 3300026067 | Ga0207678_10199195 | Ga0207678_101991952 | 246 |
| 520 | 3300026067 | Ga0207678_10724034 | Ga0207678_107240341 | 246 |
| 521 | 3300026075 | Ga0207708_10156038 | Ga0207708_101560382 | 246 |
| 522 | 3300026075 | Ga0207708_10462004 | Ga0207708_104620041 | 246 |
| 523 | 3300026078 | Ga0207702_10000688 | Ga0207702_1000068830 | 246 |
| 524 | 3300026078 | Ga0207702_10734827 | Ga0207702_107348271 | 246 |
| 525 | 3300026088 | Ga0207641_10321703 | Ga0207641_103217032 | 246 |
| 526 | 3300026095 | Ga0207676_10233070 | Ga0207676_102330701 | 246 |
| 527 | 3300026116 | Ga0207674_10119218 | Ga0207674_101192182 | 246 |
| 528 | 3300026118 | Ga0207675_100053066 | Ga0207675_1000530663 | 246 |
| 529 | 3300026118 | Ga0207675_100649196 | Ga0207675_1006491961 | 246 |
| 530 | 3300026118 | Ga0207675_100736886 | Ga0207675_1007368861 | 246 |
| 531 | 3300026121 | Ga0207683_10015315 | Ga0207683_100153152 | 246 |
| 532 | 3300026121 | Ga0207683_10165753 | Ga0207683_101657532 | 246 |
| 533 | 3300026121 | Ga0207683_10175207 | Ga0207683_101752072 | 246 |
| 534 | 3300026142 | Ga0207698_10042920 | Ga0207698_100429202 | 246 |
| 535 | 3300026142 | Ga0207698_10757892 | Ga0207698_107578921 | 246 |
| 536 | 3300027671 | Ga0209588_1048888 | Ga0209588_10488881 | 246 |
| 537 | 3300027866 | Ga0209813_10012310 | Ga0209813_100123102 | 246 |
| 538 | 3300028379 | Ga0268266_10001136 | Ga0268266_1000113636 | 246 |
| 539 | 3300028380 | Ga0268265_10546896 | Ga0268265_105468961 | 246 |
| 540 | 3300028381 | Ga0268264_10395672 | Ga0268264_103956722 | 246 |
| 541 | 3300028381 | Ga0268264_10721493 | Ga0268264_107214931 | 246 |
| 542 | 3300031507 | Ga0307509_10192424 | Ga0307509_101924242 | 246 |
| 543 | 3300031824 | Ga0307413_10149407 | Ga0307413_101494072 | 246 |
| 544 | 3300031901 | Ga0307406_10467644 | Ga0307406_104676441 | 246 |
| 545 | 3300031903 | Ga0307407_10156021 | Ga0307407_101560211 | 246 |
| 546 | 3300031911 | Ga0307412_10041561 | Ga0307412_100415612 | 246 |
| 547 | 3300031995 | Ga0307409_100861543 | Ga0307409_1008615431 | 246 |
| 548 | 3300032126 | Ga0307415_100125344 | Ga0307415_1001253442 | 246 |
| 549 | 3300035115 | Ga0373941_0037811 | Ga0373941_0037811_350_1090 | 246 |
| 550 | 3300035118 | Ga0373954_0213288 | Ga0373954_0213288_102_842 | 246 |
| 551 | 3300035170 | Ga0373943_0000806 | Ga0373943_0000806_7563_8303 | 246 |
| 552 | 3300035171 | Ga0373946_0005160 | Ga0373946_0005160_1757_2497 | 246 |
| 553 | 3300035172 | Ga0373955_0061584 | Ga0373955_0061584_294_1034 | 246 |
| 554 | 3300035242 | Ga0373962_0030019 | Ga0373962_0030019_330_1070 | 246 |
| 555 | 3300035410 | Ga0373924_0041117 | Ga0373924_0041117_1012_1752 | 246 |
| 556 | 3300035691 | Ga0373931_0000654 | Ga0373931_0000654_6602_7342 | 246 |
| 557 | 3300035695 | Ga0373927_0000046 | Ga0373927_0000046_62076_62816 | 246 |
| 558 | 3300035695 | Ga0373927_0027284 | Ga0373927_0027284_2167_2907 | 246 |
| 559 | 3300035725 | Ga0373947_0003991 | Ga0373947_0003991_3279_4019 | 246 |
| 560 | 3300036401 | Ga0373937_0011908 | Ga0373937_0011908_2117_2857 | 246 |
| 561 | 3300036459 | Ga0372808_005113 | Ga0372808_005113_154_900 | 246 |
| 562 | 3300037068 | Ga0373925_0011487 | Ga0373925_0011487_3287_4027 | 246 |
| 563 | 3300042438 | Ga0439459_0025575 | Ga0439459_0025575_307_1047 | 246 |
| 564 | 3300046454 | Ga0495592_0012178 | Ga0495592_0012178_3043_3783 | 246 |
| 565 | 3300046455 | Ga0495603_0000051 | Ga0495603_0000051_25237_25977 | 246 |
| 566 | 3300046459 | Ga0495629_0000182 | Ga0495629_0000182_53129_53869 | 246 |
| 567 | 3300046461 | Ga0495641_0006669 | Ga0495641_0006669_5503_6243 | 246 |
| 568 | 3300046472 | Ga0495580_0009446 | Ga0495580_0009446_291_1031 | 246 |
| 569 | 3300046473 | Ga0495582_0000025 | Ga0495582_0000025_2491_3231 | 246 |
| 570 | 3300046475 | Ga0495639_0007403 | Ga0495639_0007403_1612_2352 | 246 |
| 571 | 3300046476 | Ga0495662_0000583 | Ga0495662_0000583_9602_10342 | 246 |
| 572 | 3300046477 | Ga0495664_0004145 | Ga0495664_0004145_3470_4210 | 246 |
| 573 | 3300046491 | Ga0495584_0100035 | Ga0495584_0100035_441_1184 | 246 |
| 574 | 3300046499 | Ga0495594_0002799 | Ga0495594_0002799_7122_7862 | 246 |
| 575 | 3300046500 | Ga0495596_0060204 | Ga0495596_0060204_383_1126 | 246 |
| 576 | 3300046507 | Ga0495606_0099170 | Ga0495606_0099170_329_1072 | 246 |
| 577 | 3300046517 | Ga0495630_0034359 | Ga0495630_0034359_3003_3743 | 246 |
| 578 | 3300046519 | Ga0495632_0094115 | Ga0495632_0094115_384_1124 | 246 |
| 579 | 3300046522 | Ga0495643_0149056 | Ga0495643_0149056_151_891 | 246 |
| 580 | 3300046524 | Ga0495648_0197744 | Ga0495648_0197744_32_772 | 246 |
| 581 | 3300046526 | Ga0495666_0042079 | Ga0495666_0042079_1399_2139 | 246 |
| 582 | 3300046529 | Ga0495652_0044488 | Ga0495652_0044488_748_1488 | 246 |
| 583 | 3300046531 | Ga0495665_0000195 | Ga0495665_0000195_26101_26841 | 246 |
| 584 | 3300046533 | Ga0495640_0023048 | Ga0495640_0023048_1325_2065 | 246 |
| 585 | 3300046557 | Ga0495622_0001733 | Ga0495622_0001733_3891_4631 | 246 |
| 586 | 3300046559 | Ga0495667_0004219 | Ga0495667_0004219_7151_7891 | 246 |
| 587 | 3300046642 | Ga0495634_0005743 | Ga0495634_0005743_5601_6341 | 246 |
| 588 | 3300046660 | Ga0495625_0064442 | Ga0495625_0064442_1805_2545 | 246 |
| 589 | 3300046660 | Ga0495625_0218024 | Ga0495625_0218024_111_854 | 246 |
| 590 | 3300046663 | Ga0495635_0004315 | Ga0495635_0004315_308_1048 | 246 |
| 591 | 3300046674 | Ga0495588_0002009 | Ga0495588_0002009_3724_4464 | 246 |
| 592 | 3300046674 | Ga0495588_0161339 | Ga0495588_0161339_71_811 | 246 |
| 593 | 3300046675 | Ga0495657_0054952 | Ga0495657_0054952_375_1115 | 246 |
| 594 | 3300046680 | Ga0495646_0088643 | Ga0495646_0088643_232_972 | 246 |
| 595 | 3300046681 | Ga0495647_0002805 | Ga0495647_0002805_3534_4274 | 246 |
| 596 | 3300046683 | Ga0495658_0002361 | Ga0495658_0002361_5494_6234 | 246 |
| 597 | 3300046689 | Ga0495613_0006158 | Ga0495613_0006158_3442_4182 | 246 |
| 598 | 3300046690 | Ga0495624_0000898 | Ga0495624_0000898_21562_22302 | 246 |
| 599 | 3300046694 | Ga0495649_0041544 | Ga0495649_0041544_1051_1794 | 246 |
| 600 | 3300046794 | Ga0495589_0092486 | Ga0495589_0092486_414_1154 | 246 |
| 601 | 3300047315 | Ga0495581_0000187 | Ga0495581_0000187_25580_26320 | 246 |
| 602 | 3300047319 | Ga0495674_0003575 | Ga0495674_0003575_5458_6198 | 246 |
| 603 | 3300047321 | Ga0495676_0013511 | Ga0495676_0013511_4014_4754 | 246 |
| 604 | 3300047471 | Ga0495684_0344128 | Ga0495684_0344128_60_800 | 246 |
| 605 | 3300047673 | Ga0495593_0000469 | Ga0495593_0000469_7334_8074 | 246 |
| 606 | 3300048904 | Ga0496101_0001656 | Ga0496101_0001656_5369_6109 | 246 |
| 607 | 3300048904 | Ga0496101_0302144 | Ga0496101_0302144_417_1157 | 246 |
| 608 | 3300048905 | Ga0496102_0010759 | Ga0496102_0010759_960_1700 | 246 |
| 609 | 3300048905 | Ga0496102_0514120 | Ga0496102_0514120_332_1072 | 246 |
| 610 | 3300048906 | Ga0496103_0016825 | Ga0496103_0016825_2722_3462 | 246 |
| 611 | 3300048907 | Ga0496104_0004595 | Ga0496104_0004595_3420_4160 | 246 |
| 612 | 3300048908 | Ga0496105_0040208 | Ga0496105_0040208_1269_2009 | 246 |
| 613 | 3300048909 | Ga0496106_0026288 | Ga0496106_0026288_1080_1820 | 246 |
| 614 | 3300048909 | Ga0496106_0166386 | Ga0496106_0166386_646_1386 | 246 |
| 615 | 3300048910 | Ga0496107_0005918 | Ga0496107_0005918_4777_5517 | 246 |
| 616 | 3300048911 | Ga0496108_0041009 | Ga0496108_0041009_233_973 | 246 |
| 617 | 3300048911 | Ga0496108_0159548 | Ga0496108_0159548_1171_1911 | 246 |
| 618 | 3300048911 | Ga0496108_0496324 | Ga0496108_0496324_107_847 | 246 |
| 619 | 3300048912 | Ga0496109_0011243 | Ga0496109_0011243_76_816 | 246 |
| 620 | 3300048913 | Ga0496110_0020972 | Ga0496110_0020972_3181_3921 | 246 |
| 621 | 3300048914 | Ga0496111_0012551 | Ga0496111_0012551_321_1061 | 246 |
| 622 | 3300048914 | Ga0496111_0138489 | Ga0496111_0138489_874_1614 | 246 |
| 623 | 3300048915 | Ga0496112_0002949 | Ga0496112_0002949_6176_6916 | 246 |
| 624 | 3300048916 | Ga0496113_0020040 | Ga0496113_0020040_2827_3567 | 246 |
| 625 | 3300048917 | Ga0496114_0008695 | Ga0496114_0008695_5521_6261 | 246 |
| 626 | 3300048918 | Ga0496115_0057832 | Ga0496115_0057832_1477_2217 | 246 |
| 627 | 3300048920 | Ga0496117_0127876 | Ga0496117_0127876_168_908 | 246 |
| 628 | 3300048922 | Ga0496119_0087993 | Ga0496119_0087993_517_1257 | 246 |
| 629 | 3300048924 | Ga0496121_0160355 | Ga0496121_0160355_444_1184 | 246 |
| 630 | 3300048927 | Ga0496124_0155175 | Ga0496124_0155175_662_1402 | 246 |
| 631 | 3300048928 | Ga0496125_0189198 | Ga0496125_0189198_355_1095 | 246 |
| 632 | 3300048929 | Ga0496126_0191567 | Ga0496126_0191567_214_954 | 246 |
| 633 | 3300049460 | Ga0495682_0065096 | Ga0495682_0065096_149_892 | 246 |
| 634 | 3300053077 | Ga0495601_0084741 | Ga0495601_0084741_987_1727 | 246 |
| 635 | 3300053083 | Ga0495655_0078412 | Ga0495655_0078412_148_888 | 246 |
| 636 | 3300053084 | Ga0495595_0205531 | Ga0495595_0205531_176_919 | 246 |
| 637 | 3300053085 | Ga0495619_0079603 | Ga0495619_0079603_1204_1944 | 246 |
| 638 | 3300053085 | Ga0495619_0184087 | Ga0495619_0184087_275_1015 | 246 |
| 639 | 3300053090 | Ga0500646_0049900 | Ga0500646_0049900_343_1083 | 246 |
| 640 | 3300053092 | Ga0500583_0232866 | Ga0500583_0232866_20_760 | 246 |
| 641 | 3300053093 | Ga0500651_0050027 | Ga0500651_0050027_1250_1993 | 246 |
| 642 | 3300053096 | Ga0500641_0011540 | Ga0500641_0011540_586_1326 | 246 |
| 643 | 3300053108 | Ga0500562_023035 | Ga0500562_023035_292_1035 | 246 |
| 644 | 3300053130 | Ga0500642_0088920 | Ga0500642_0088920_392_1135 | 246 |
| 645 | 3300053134 | Ga0500658_0028241 | Ga0500658_0028241_385_1128 | 246 |
| 646 | 3300053137 | Ga0500561_0015338 | Ga0500561_0015338_483_1226 | 246 |
| 647 | 3300053142 | Ga0500577_0042421 | Ga0500577_0042421_768_1508 | 246 |
| 648 | 3300053146 | Ga0500588_0022229 | Ga0500588_0022229_373_1113 | 246 |
| 649 | 3300053147 | Ga0500589_091169 | Ga0500589_091169_222_965 | 246 |
| 650 | 3300053156 | Ga0500622_0084460 | Ga0500622_0084460_250_993 | 246 |
| 651 | 3300053160 | Ga0500633_0076056 | Ga0500633_0076056_263_1003 | 246 |
| 652 | 3300053161 | Ga0500634_0102607 | Ga0500634_0102607_231_974 | 246 |
| 653 | 3300053161 | Ga0500634_0149206 | Ga0500634_0149206_267_1007 | 246 |
| 654 | 3300053727 | Ga0500611_005740 | Ga0500611_005740_417_1157 | 246 |
| 655 | 3300053730 | Ga0500645_010480 | Ga0500645_010480_906_1646 | 246 |
| 656 | 3300053732 | Ga0500656_005513 | Ga0500656_005513_454_1197 | 246 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g0b-assembly8.cif.gz_H | the structure of feem, an n-acyl amino acid synthase from uncultured soil microbes | 0.8141 | 22 | 205 |
| 2g0b-assembly10.cif.gz_B | the structure of feem, an n-acyl amino acid synthase from uncultured soil microbes | 0.806 | 22 | 205 |
| 2g0b-assembly11.cif.gz_D | the structure of feem, an n-acyl amino acid synthase from uncultured soil microbes | 0.8051 | 22 | 203 |
| 2g0b-assembly1.cif.gz_A | the structure of feem, an n-acyl amino acid synthase from uncultured soil microbes | 0.8049 | 22 | 205 |
| 2g0b-assembly8.cif.gz_H | the structure of feem, an n-acyl amino acid synthase from uncultured soil microbes | 0.8012 | 22 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2g0bC01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8194 | 23 | 199 | 3.40.630.30 |
| af_P0ADQ2_18_164_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8163 | 23 | 193 | 3.40.630.30 |
| 2g0bC01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7986 | 23 | 199 | 3.40.630.30 |
| 1q2yA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7957 | 23 | 191 | 3.40.630.30 |
| 2bswA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7896 | 23 | 190 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A4YMF6-F1-model_v4 | N-acyl amino acid synthase FeeM catalytic core domain-containing protein | 0.9918 | 17 | 221 |
|
| AF-A0A530C242-F1-model_v4 | N-acyl amino acid synthase FeeM catalytic core domain-containing protein | 0.9876 | 19 | 126 |
|
| AF-A0A2S0NCC8-F1-model_v4 | N-acyl amino acid synthase FeeM catalytic core domain-containing protein | 0.9813 | 17 | 219 |
|
| AF-A0A3S2GZ92-F1-model_v4 | deleted | 0.9813 | 19 | 124 |
|
| AF-A0A1Q3KD09-F1-model_v4 | deleted | 0.979 | 19 | 221 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar