F472773

General Info

Members Datasets Scaffolds Average Seq Length
653 302 1306 264

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10172783|Ga0307514_101727832
Length 297
Sequence MTVVGPSAGPPKAAEGPTFVDPAGPNPLGGSSDVPGRRGAPLRVLVVDDEELARLRLRQLVGDCTDPVASVVGEAANAVQALAWFATQTCDLVLLDVQMPGRDGTQLAAELKRLTEPPAVVFVTAHAEHALRAFDLEAVDYLTKPVRRERLHAALQRVAQRLVLQRGPAGAPATAAEAPVIIVTDRGRLVRVPVAEALYFKAELKYVTLRTAAHTYVLDEALTDLEQRLGDRFLRVHRNALVARHAVRALERRAMAGEGDEDGGETWAVCMAPVDEWLAVSRRQVAAVREALVAAGR

Samples

Sample ID Description Type Environment
1 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
193 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
203 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
204 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
264 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
265 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
266 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
271 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
278 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
279 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
280 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
281 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
282 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
283 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
284 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
285 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
286 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
289 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
290 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
291 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
292 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
293 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
296 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
297 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
298 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
299 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
300 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
301 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
302 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.4
Nodule 0
Rhizoplane 3.22
Rhizosphere 77.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307514_10172783 3300031649 Bacteria 1408
2 JGI25152J39213_1003968 3300002773 Bacteria 4831
3 JGI25153J46596_10013898 3300003215 Bacteria 3378
4 rootH2_10045721 3300003320 Bacteria 3921
5 rootH1_10015935 3300003323 Bacteria 3970
6 Ga0055526_1001909 3300003771 Bacteria 14438
7 Ga0070658_10027033 3300005327 Bacteria 4607
8 Ga0070658_10063041 3300005327 Bacteria 3021
9 Ga0070658_10298036 3300005327 Bacteria 1375
10 Ga0070676_10001611 3300005328 Bacteria 11473
11 Ga0070676_10007770 3300005328 Bacteria 5760
12 Ga0070676_10024955 3300005328 Bacteria 3374
13 Ga0070676_10313285 3300005328 Bacteria 1068
14 Ga0070683_100026824 3300005329 Bacteria 5191
15 Ga0070683_100599206 3300005329 Bacteria 1054
16 Ga0070690_100074891 3300005330 Bacteria 2206
17 Ga0070670_100006690 3300005331 Bacteria 9772
18 Ga0070670_100043165 3300005331 Bacteria 3876
19 Ga0070670_100046341 3300005331 Bacteria 3738
20 Ga0070670_100056723 3300005331 Bacteria 3362
21 Ga0070670_100085069 3300005331 Bacteria 2717
22 Ga0070670_100162982 3300005331 Bacteria 1933
23 Ga0070670_100172636 3300005331 Bacteria 1875
24 Ga0070670_100573047 3300005331 Bacteria 1008
25 Ga0070677_10006651 3300005333 Bacteria 3843
26 Ga0070677_10009064 3300005333 Bacteria 3368
27 Ga0070677_10012670 3300005333 Bacteria 2931
28 Ga0070677_10035070 3300005333 Bacteria 1942
29 Ga0070677_10042779 3300005333 Bacteria 1796
30 Ga0068869_100006643 3300005334 Bacteria 7345
31 Ga0068869_100008107 3300005334 Bacteria 6756
32 Ga0068869_100019365 3300005334 Bacteria 4648
33 Ga0070666_10000601 3300005335 Bacteria 21615
34 Ga0070666_10043451 3300005335 Bacteria 3010
35 Ga0070666_10125933 3300005335 Bacteria 1778
36 Ga0070680_100039594 3300005336 Bacteria 3813
37 Ga0068868_100006388 3300005338 Bacteria 8338
38 Ga0068868_100010447 3300005338 Bacteria 6721
39 Ga0068868_100010849 3300005338 Bacteria 6610
40 Ga0068868_100028445 3300005338 Bacteria 4274
41 Ga0070660_100033424 3300005339 Bacteria 3877
42 Ga0070660_100091037 3300005339 Bacteria 2406
43 Ga0070689_100254211 3300005340 Bacteria 1451
44 Ga0070687_100011936 3300005343 Bacteria 3819
45 Ga0070687_100178675 3300005343 Bacteria 1270
46 Ga0070661_100111809 3300005344 Bacteria 2040
47 Ga0070692_10020138 3300005345 Bacteria 3231
48 Ga0070668_100006370 3300005347 Bacteria 8745
49 Ga0070668_100040485 3300005347 Bacteria 3566
50 Ga0070668_100067999 3300005347 Bacteria 2769
51 Ga0070668_100390277 3300005347 Bacteria 1187
52 Ga0070669_100005118 3300005353 Bacteria 9479
53 Ga0070669_100088217 3300005353 Bacteria 2321
54 Ga0070675_100002437 3300005354 Bacteria 13893
55 Ga0070675_100002524 3300005354 Bacteria 13700
56 Ga0070675_100024456 3300005354 Bacteria 4837
57 Ga0070675_100039856 3300005354 Bacteria 3834
58 Ga0070675_100041283 3300005354 Bacteria 3768
59 Ga0070675_100056329 3300005354 Bacteria 3239
60 Ga0070671_100033458 3300005355 Bacteria 4252
61 Ga0070671_100064571 3300005355 Bacteria 3048
62 Ga0070671_100076627 3300005355 Bacteria 2794
63 Ga0070671_100194419 3300005355 Bacteria 1720
64 Ga0070671_100323929 3300005355 Bacteria 1313
65 Ga0070674_100028752 3300005356 Bacteria 3652
66 Ga0070674_100048139 3300005356 Bacteria 2925
67 Ga0070674_100539621 3300005356 Bacteria 977
68 Ga0070673_100002831 3300005364 Bacteria 10677
69 Ga0070673_100020631 3300005364 Bacteria 4755
70 Ga0070673_100053157 3300005364 Bacteria 3180
71 Ga0070673_100135536 3300005364 Bacteria 2072
72 Ga0070673_100138627 3300005364 Bacteria 2050
73 Ga0070673_100159578 3300005364 Bacteria 1917
74 Ga0070688_100024535 3300005365 Bacteria 3560
75 Ga0070659_100188914 3300005366 Bacteria 1692
76 Ga0070659_100394319 3300005366 Bacteria 1168
77 Ga0070667_100002909 3300005367 Bacteria 14715
78 Ga0070667_100011298 3300005367 Bacteria 7386
79 Ga0070667_100129156 3300005367 Bacteria 2204
80 Ga0070667_100193033 3300005367 Bacteria 1805
81 Ga0070667_100201566 3300005367 Bacteria 1766
82 Ga0070667_100348335 3300005367 Bacteria 1340
83 Ga0070700_100245034 3300005441 Bacteria 1283
84 Ga0070708_100630231 3300005445 Bacteria 1011
85 Ga0070663_100001718 3300005455 Bacteria 12149
86 Ga0070663_100003146 3300005455 Bacteria 9463
87 Ga0070663_100071894 3300005455 Bacteria 2518
88 Ga0070663_100282757 3300005455 Bacteria 1322
89 Ga0070678_100001353 3300005456 Bacteria 13046
90 Ga0070678_100007938 3300005456 Bacteria 6322
91 Ga0070678_100070501 3300005456 Bacteria 2613
92 Ga0070678_100515747 3300005456 Bacteria 1057
93 Ga0070662_100001682 3300005457 Bacteria 13598
94 Ga0070662_100013298 3300005457 Bacteria 5475
95 Ga0070662_100054826 3300005457 Bacteria 2889
96 Ga0070662_100144330 3300005457 Bacteria 1848
97 Ga0070662_100396864 3300005457 Bacteria 1138
98 Ga0070681_10070808 3300005458 Bacteria 3452
99 Ga0070681_10123230 3300005458 Bacteria 2525
100 Ga0068867_100000118 3300005459 Bacteria 50315
101 Ga0068867_100010409 3300005459 Bacteria 6562
102 Ga0068867_100013383 3300005459 Bacteria 5812
103 Ga0068867_100028188 3300005459 Bacteria 4041
104 Ga0068867_100066655 3300005459 Bacteria 2682
105 Ga0068867_100132666 3300005459 Bacteria 1938
106 Ga0068867_100295939 3300005459 Bacteria 1332
107 Ga0070685_10151051 3300005466 Bacteria 1472
108 Ga0070685_10369909 3300005466 Bacteria 985
109 Ga0070706_100000965 3300005467 Bacteria 31374
110 Ga0070699_100123620 3300005518 Bacteria 2277
111 Ga0070679_100048911 3300005530 Bacteria 4212
112 Ga0070684_100031023 3300005535 Bacteria 4547
113 Ga0068853_100022443 3300005539 Bacteria 5271
114 Ga0068853_100042110 3300005539 Bacteria 3903
115 Ga0070672_100003887 3300005543 Bacteria 9733
116 Ga0070672_100006503 3300005543 Bacteria 7853
117 Ga0070672_100007981 3300005543 Bacteria 7231
118 Ga0070672_100030004 3300005543 Bacteria 4082
119 Ga0070672_100079552 3300005543 Bacteria 2624
120 Ga0070672_100160394 3300005543 Bacteria 1865
121 Ga0070672_100169980 3300005543 Bacteria 1812
122 Ga0070672_100543151 3300005543 Bacteria 1008
123 Ga0070686_100198740 3300005544 Bacteria 1436
124 Ga0070695_100165203 3300005545 Bacteria 1557
125 Ga0070693_100127077 3300005547 Bacteria 1589
126 Ga0070693_100159243 3300005547 Bacteria 1436
127 Ga0070665_100024704 3300005548 Bacteria 6054
128 Ga0070665_100112682 3300005548 Bacteria 2723
129 Ga0068855_100637529 3300005563 Bacteria 1146
130 Ga0070664_100184559 3300005564 Bacteria 1856
131 Ga0070664_100295653 3300005564 Bacteria 1462
132 Ga0070664_100340585 3300005564 Bacteria 1362
133 Ga0070664_100490533 3300005564 Bacteria 1131
134 Ga0070664_100498100 3300005564 Bacteria 1123
135 Ga0068857_100053448 3300005577 Bacteria 3583
136 Ga0068857_100056743 3300005577 Bacteria 3475
137 Ga0068857_100057677 3300005577 Bacteria 3446
138 Ga0068854_100064998 3300005578 Bacteria 2651
139 Ga0068854_100136926 3300005578 Bacteria 1875
140 Ga0068856_100036566 3300005614 Bacteria 4814
141 Ga0068856_100726837 3300005614 Bacteria 1013
142 Ga0070702_100010660 3300005615 Bacteria 4539
143 Ga0068852_100013245 3300005616 Bacteria 6305
144 Ga0068852_100019713 3300005616 Bacteria 5346
145 Ga0068852_100070959 3300005616 Bacteria 3057
146 Ga0068852_100259130 3300005616 Bacteria 1669
147 Ga0068852_100405391 3300005616 Bacteria 1342
148 Ga0068859_100117627 3300005617 Bacteria 2723
149 Ga0068864_100005532 3300005618 Bacteria 10357
150 Ga0068864_100015862 3300005618 Bacteria 6268
151 Ga0068864_100021008 3300005618 Bacteria 5466
152 Ga0068864_100042789 3300005618 Bacteria 3876
153 Ga0068864_100076307 3300005618 Bacteria 2928
154 Ga0068861_100001984 3300005719 Bacteria 13218
155 Ga0068861_100004050 3300005719 Bacteria 9813
156 Ga0068861_100137740 3300005719 Bacteria 1988
157 Ga0068851_10003613 3300005834 Bacteria 6896
158 Ga0068851_10019980 3300005834 Bacteria 3240
159 Ga0068851_10221814 3300005834 Bacteria 1062
160 Ga0068870_10015312 3300005840 Bacteria 3636
161 Ga0068863_100008538 3300005841 Bacteria 10009
162 Ga0068863_100020081 3300005841 Bacteria 6391
163 Ga0068863_100034043 3300005841 Bacteria 4853
164 Ga0068863_100165027 3300005841 Bacteria 2123
165 Ga0068858_100000366 3300005842 Bacteria 47603
166 Ga0068858_100003535 3300005842 Bacteria 15479
167 Ga0068858_100007014 3300005842 Bacteria 10948
168 Ga0068860_100010516 3300005843 Bacteria 9149
169 Ga0068860_100012879 3300005843 Bacteria 8221
170 Ga0068860_100057768 3300005843 Bacteria 3689
171 Ga0068860_100083236 3300005843 Bacteria 3043
172 Ga0068860_100150832 3300005843 Bacteria 2238
173 Ga0068862_100014899 3300005844 Bacteria 6459
174 Ga0068862_100030402 3300005844 Bacteria 4552
175 Ga0068862_100221819 3300005844 Bacteria 1712
176 Ga0075368_10017629 3300006042 Bacteria 2675
177 Ga0075368_10076261 3300006042 Bacteria 1360
178 Ga0075368_10107159 3300006042 Bacteria 1150
179 Ga0075363_100023860 3300006048 Bacteria 3105
180 Ga0075363_100154196 3300006048 Bacteria 1298
181 Ga0075364_10105575 3300006051 Bacteria 1877
182 Ga0075364_10284118 3300006051 Bacteria 1126
183 Ga0075362_10005831 3300006177 Bacteria 4543
184 Ga0075362_10022328 3300006177 Bacteria 2665
185 Ga0075362_10064265 3300006177 Bacteria 1665
186 Ga0075362_10120893 3300006177 Bacteria 1239
187 Ga0075367_10008921 3300006178 Bacteria 5218
188 Ga0075367_10013328 3300006178 Bacteria 4416
189 Ga0075367_10026931 3300006178 Bacteria 3265
190 Ga0075367_10196888 3300006178 Bacteria 1258
191 Ga0075369_10010697 3300006186 Bacteria 3595
192 Ga0075366_10003454 3300006195 Bacteria 8338
193 Ga0075366_10033486 3300006195 Bacteria 3027
194 Ga0075366_10043038 3300006195 Bacteria 2674
195 Ga0075366_10049304 3300006195 Bacteria 2499
196 Ga0075366_10109108 3300006195 Bacteria 1664
197 Ga0075366_10191578 3300006195 Bacteria 1243
198 Ga0097621_100014905 3300006237 Bacteria 5832
199 Ga0097621_100039158 3300006237 Bacteria 3807
200 Ga0097621_100047833 3300006237 Bacteria 3467
201 Ga0075370_10000130 3300006353 Bacteria 25186
202 Ga0075370_10012739 3300006353 Bacteria 4452
203 Ga0075370_10026075 3300006353 Bacteria 3235
204 Ga0075370_10031975 3300006353 Bacteria 2939
205 Ga0075370_10043478 3300006353 Bacteria 2539
206 Ga0075370_10059096 3300006353 Bacteria 2181
207 Ga0075370_10194949 3300006353 Bacteria 1194
208 Ga0068871_100022996 3300006358 Bacteria 4813
209 Ga0068871_100040487 3300006358 Bacteria 3732
210 Ga0068871_100108866 3300006358 Bacteria 2329
211 Ga0068871_100135466 3300006358 Bacteria 2091
212 Ga0075434_100504068 3300006871 Bacteria 1231
213 Ga0068865_100024616 3300006881 Bacteria 3951
214 Ga0068865_100084797 3300006881 Bacteria 2284
215 Ga0068865_100189447 3300006881 Bacteria 1589
216 Ga0097620_100117632 3300006931 Bacteria 2723
217 Ga0105240_10079271 3300009093 Bacteria 4042
218 Ga0111539_10513838 3300009094 Bacteria 1395
219 Ga0105245_10047200 3300009098 Bacteria 3849
220 Ga0105245_10058736 3300009098 Bacteria 3462
221 Ga0105245_10100343 3300009098 Bacteria 2677
222 Ga0105245_10270701 3300009098 Bacteria 1657
223 Ga0114129_10235563 3300009147 Bacteria 2463
224 Ga0105243_10001408 3300009148 Bacteria 21265
225 Ga0105243_10066478 3300009148 Bacteria 2899
226 Ga0105241_10341734 3300009174 Bacteria 1297
227 Ga0105242_10119067 3300009176 Bacteria 2263
228 Ga0105248_10002745 3300009177 Bacteria 19554
229 Ga0105248_10073729 3300009177 Bacteria 3836
230 Ga0105248_10221259 3300009177 Bacteria 2131
231 Ga0105237_10157770 3300009545 Bacteria 2266
232 Ga0105238_10016418 3300009551 Bacteria 7496
233 Ga0105238_10268095 3300009551 Bacteria 1688
234 Ga0105249_10004419 3300009553 Bacteria 12156
235 Ga0105249_10114312 3300009553 Bacteria 2555
236 Ga0105249_10377239 3300009553 Bacteria 1443
237 Ga0105239_10018823 3300010375 Bacteria 7629
238 Ga0105246_10307663 3300011119 Bacteria 1282
239 Ga0157371_10147599 3300013102 Bacteria 1676
240 Ga0157370_10135076 3300013104 Bacteria 2299
241 Ga0157369_10065369 3300013105 Bacteria 3914
242 Ga0157374_10014987 3300013296 Bacteria 6793
243 Ga0157374_10086987 3300013296 Bacteria 2974
244 Ga0157374_10390775 3300013296 Bacteria 1387
245 Ga0157378_10252813 3300013297 Bacteria 1688
246 Ga0163162_10037870 3300013306 Bacteria 4813
247 Ga0163162_10065499 3300013306 Bacteria 3680
248 Ga0163162_10450209 3300013306 Bacteria 1419
249 Ga0163162_10478152 3300013306 Bacteria 1377
250 Ga0157372_10107189 3300013307 Bacteria 3197
251 Ga0157375_10007448 3300013308 Bacteria 9577
252 Ga0157375_10020991 3300013308 Bacteria 5979
253 Ga0157375_10041370 3300013308 Bacteria 4449
254 Ga0157375_10090976 3300013308 Bacteria 3111
255 Ga0157375_10097314 3300013308 Bacteria 3017
256 Ga0157375_10139441 3300013308 Bacteria 2551
257 Ga0157375_10268431 3300013308 Bacteria 1868
258 Ga0157375_10846694 3300013308 Bacteria 1061
259 Ga0163163_10013972 3300014325 Bacteria 7369
260 Ga0163163_10376867 3300014325 Bacteria 1476
261 Ga0163163_10446279 3300014325 Bacteria 1354
262 Ga0157380_10033410 3300014326 Bacteria 3961
263 Ga0157380_10055786 3300014326 Bacteria 3139
264 Ga0157380_10617425 3300014326 Bacteria 1076
265 Ga0157377_10000343 3300014745 Bacteria 20731
266 Ga0157377_10008399 3300014745 Bacteria 5035
267 Ga0157377_10449766 3300014745 Bacteria 889
268 Ga0157379_10014124 3300014968 Bacteria 7001
269 Ga0157379_10017039 3300014968 Bacteria 6396
270 Ga0157379_10025223 3300014968 Bacteria 5279
271 Ga0157379_10027564 3300014968 Bacteria 5058
272 Ga0157379_10079503 3300014968 Bacteria 2936
273 Ga0157376_10079724 3300014969 Bacteria 2807
274 Ga0157376_10388097 3300014969 Bacteria 1347
275 Ga0157376_10454696 3300014969 Bacteria 1250
276 Ga0163161_10022192 3300017792 Bacteria 4467
277 Ga0163161_10023866 3300017792 Bacteria 4316
278 Ga0163161_10247209 3300017792 Bacteria 1389
279 Ga0163161_10337685 3300017792 Bacteria 1194
280 Ga0213876_10179811 3300021384 Bacteria 1125
281 Ga0207425_1002947 3300025245 Bacteria 5695
282 Ga0209759_1003238 3300025256 Bacteria 6585
283 Ga0209129_1000043 3300025258 Bacteria 298978
284 Ga0209564_1000014 3300025295 Bacteria 621501
285 Ga0209758_1000307 3300025297 Bacteria 95192
286 Ga0209758_1000492 3300025297 Bacteria 64511
287 Ga0209050_1000493 3300025298 Bacteria 67885
288 Ga0207656_10036385 3300025321 Bacteria 2066
289 Ga0207656_10088129 3300025321 Bacteria 1405
290 Ga0207682_10003952 3300025893 Bacteria 6314
291 Ga0207682_10016294 3300025893 Bacteria 2899
292 Ga0207682_10026747 3300025893 Bacteria 2296
293 Ga0207642_10109241 3300025899 Bacteria 1405
294 Ga0207642_10142517 3300025899 Bacteria 1265
295 Ga0207688_10031694 3300025901 Bacteria 2920
296 Ga0207680_10033910 3300025903 Bacteria 2916
297 Ga0207645_10001578 3300025907 Bacteria 18608
298 Ga0207645_10005999 3300025907 Bacteria 8742
299 Ga0207645_10019747 3300025907 Bacteria 4414
300 Ga0207645_10069115 3300025907 Bacteria 2259
301 Ga0207645_10188261 3300025907 Bacteria 1356
302 Ga0207705_10045377 3300025909 Bacteria 3158
303 Ga0207705_10061559 3300025909 Bacteria 2711
304 Ga0207705_10147103 3300025909 Bacteria 1763
305 Ga0207705_10284776 3300025909 Bacteria 1266
306 Ga0207684_10002804 3300025910 Bacteria 17330
307 Ga0207654_10067671 3300025911 Bacteria 2111
308 Ga0207695_10097869 3300025913 Bacteria 2934
309 Ga0207671_10044427 3300025914 Bacteria 3286
310 Ga0207671_10080970 3300025914 Bacteria 2435
311 Ga0207660_10092905 3300025917 Bacteria 2240
312 Ga0207662_10001240 3300025918 Bacteria 12250
313 Ga0207649_10028048 3300025920 Bacteria 3312
314 Ga0207652_10291402 3300025921 Bacteria 1472
315 Ga0207646_10014090 3300025922 Bacteria 7605
316 Ga0207681_10000634 3300025923 Bacteria 23457
317 Ga0207681_10009755 3300025923 Bacteria 5873
318 Ga0207681_10442728 3300025923 Bacteria 1056
319 Ga0207694_10041513 3300025924 Bacteria 3545
320 Ga0207694_10104715 3300025924 Bacteria 2245
321 Ga0207650_10001855 3300025925 Bacteria 14901
322 Ga0207650_10009236 3300025925 Bacteria 6737
323 Ga0207650_10040693 3300025925 Bacteria 3402
324 Ga0207650_10048664 3300025925 Bacteria 3128
325 Ga0207650_10226082 3300025925 Bacteria 1508
326 Ga0207659_10002325 3300025926 Bacteria 11323
327 Ga0207659_10002524 3300025926 Bacteria 10891
328 Ga0207659_10017565 3300025926 Bacteria 4674
329 Ga0207659_10018246 3300025926 Bacteria 4597
330 Ga0207659_10080909 3300025926 Bacteria 2401
331 Ga0207659_10339221 3300025926 Bacteria 1244
332 Ga0207687_10035415 3300025927 Bacteria 3395
333 Ga0207687_10081272 3300025927 Bacteria 2341
334 Ga0207687_10145231 3300025927 Bacteria 1804
335 Ga0207687_10287821 3300025927 Bacteria 1319
336 Ga0207644_10000264 3300025931 Bacteria 35311
337 Ga0207644_10003222 3300025931 Bacteria 10521
338 Ga0207644_10043921 3300025931 Bacteria 3173
339 Ga0207644_10045173 3300025931 Bacteria 3133
340 Ga0207644_10155677 3300025931 Bacteria 1772
341 Ga0207644_10226801 3300025931 Bacteria 1483
342 Ga0207644_10239809 3300025931 Bacteria 1443
343 Ga0207644_10252519 3300025931 Bacteria 1407
344 Ga0207690_10004434 3300025932 Bacteria 8282
345 Ga0207690_10267078 3300025932 Bacteria 1328
346 Ga0207690_10338423 3300025932 Bacteria 1187
347 Ga0207706_10001386 3300025933 Bacteria 24177
348 Ga0207706_10003415 3300025933 Bacteria 15171
349 Ga0207706_10066514 3300025933 Bacteria 3172
350 Ga0207706_10126250 3300025933 Bacteria 2250
351 Ga0207706_10139677 3300025933 Bacteria 2131
352 Ga0207706_10153691 3300025933 Bacteria 2024
353 Ga0207709_10000850 3300025935 Bacteria 23364
354 Ga0207709_10028530 3300025935 Bacteria 3227
355 Ga0207709_10198449 3300025935 Bacteria 1431
356 Ga0207670_10224119 3300025936 Bacteria 1441
357 Ga0207669_10031921 3300025937 Bacteria 2950
358 Ga0207704_10012840 3300025938 Bacteria 4169
359 Ga0207704_10071979 3300025938 Bacteria 2196
360 Ga0207704_10221417 3300025938 Bacteria 1401
361 Ga0207691_10005307 3300025940 Bacteria 12438
362 Ga0207691_10007010 3300025940 Bacteria 10872
363 Ga0207691_10031990 3300025940 Bacteria 4909
364 Ga0207691_10045319 3300025940 Bacteria 4043
365 Ga0207691_10051561 3300025940 Bacteria 3761
366 Ga0207691_10072750 3300025940 Bacteria 3101
367 Ga0207711_10001750 3300025941 Bacteria 19915
368 Ga0207711_10003373 3300025941 Bacteria 13834
369 Ga0207711_10218203 3300025941 Bacteria 1744
370 Ga0207711_10221243 3300025941 Bacteria 1732
371 Ga0207689_10003399 3300025942 Bacteria 14536
372 Ga0207689_10009456 3300025942 Bacteria 8415
373 Ga0207689_10022214 3300025942 Bacteria 5334
374 Ga0207689_10120358 3300025942 Bacteria 2160
375 Ga0207689_10419526 3300025942 Bacteria 1117
376 Ga0207661_10197377 3300025944 Bacteria 1767
377 Ga0207661_10253093 3300025944 Bacteria 1566
378 Ga0207679_10046298 3300025945 Bacteria 3152
379 Ga0207679_10146323 3300025945 Bacteria 1917
380 Ga0207667_10066908 3300025949 Bacteria 3744
381 Ga0207651_10000726 3300025960 Bacteria 14099
382 Ga0207651_10016312 3300025960 Bacteria 4347
383 Ga0207651_10144598 3300025960 Bacteria 1842
384 Ga0207712_10012921 3300025961 Bacteria 5344
385 Ga0207712_10086416 3300025961 Bacteria 2297
386 Ga0207668_10000316 3300025972 Bacteria 31416
387 Ga0207668_10008970 3300025972 Bacteria 5981
388 Ga0207668_10306146 3300025972 Bacteria 1313
389 Ga0207640_10361898 3300025981 Bacteria 1169
390 Ga0207658_10001493 3300025986 Bacteria 18184
391 Ga0207658_10003581 3300025986 Bacteria 10968
392 Ga0207658_10029135 3300025986 Bacteria 3895
393 Ga0207658_10069255 3300025986 Bacteria 2665
394 Ga0207658_10236993 3300025986 Bacteria 1543
395 Ga0207658_10283783 3300025986 Bacteria 1420
396 Ga0207658_10538306 3300025986 Bacteria 1044
397 Ga0207677_10001252 3300026023 Bacteria 13677
398 Ga0207677_10001906 3300026023 Bacteria 11016
399 Ga0207677_10027519 3300026023 Bacteria 3582
400 Ga0207677_10054454 3300026023 Bacteria 2730
401 Ga0207677_10122392 3300026023 Bacteria 1960
402 Ga0207703_10000616 3300026035 Bacteria 36009
403 Ga0207703_10005986 3300026035 Bacteria 9744
404 Ga0207703_10017344 3300026035 Bacteria 5620
405 Ga0207703_10075878 3300026035 Bacteria 2787
406 Ga0207703_10233916 3300026035 Bacteria 1649
407 Ga0207639_10021939 3300026041 Bacteria 4593
408 Ga0207678_10001164 3300026067 Bacteria 24067
409 Ga0207678_10023154 3300026067 Bacteria 5434
410 Ga0207678_10052464 3300026067 Bacteria 3518
411 Ga0207708_10009445 3300026075 Bacteria 7222
412 Ga0207702_10039291 3300026078 Bacteria 3964
413 Ga0207641_10004967 3300026088 Bacteria 11410
414 Ga0207641_10035633 3300026088 Bacteria 4147
415 Ga0207641_10049815 3300026088 Bacteria 3541
416 Ga0207641_10113934 3300026088 Bacteria 2402
417 Ga0207641_10122564 3300026088 Bacteria 2322
418 Ga0207641_10236963 3300026088 Bacteria 1698
419 Ga0207641_10254103 3300026088 Bacteria 1642
420 Ga0207648_10002014 3300026089 Bacteria 22175
421 Ga0207648_10011543 3300026089 Bacteria 8318
422 Ga0207648_10038737 3300026089 Bacteria 4193
423 Ga0207648_10041423 3300026089 Bacteria 4044
424 Ga0207648_10159467 3300026089 Bacteria 1992
425 Ga0207648_10248109 3300026089 Bacteria 1587
426 Ga0207648_10344084 3300026089 Bacteria 1343
427 Ga0207676_10002431 3300026095 Bacteria 13264
428 Ga0207676_10068909 3300026095 Bacteria 2831
429 Ga0207676_10200582 3300026095 Bacteria 1762
430 Ga0207674_10036973 3300026116 Bacteria 5081
431 Ga0207674_10082149 3300026116 Bacteria 3224
432 Ga0207675_100001106 3300026118 Bacteria 26680
433 Ga0207675_100009921 3300026118 Bacteria 8914
434 Ga0207675_100042026 3300026118 Bacteria 4267
435 Ga0207675_100513468 3300026118 Bacteria 1194
436 Ga0207683_10004615 3300026121 Bacteria 11873
437 Ga0207683_10044600 3300026121 Bacteria 3876
438 Ga0207683_10047674 3300026121 Bacteria 3752
439 Ga0207683_10059063 3300026121 Bacteria 3368
440 Ga0207683_10128521 3300026121 Bacteria 2278
441 Ga0207683_10147498 3300026121 Bacteria 2122
442 Ga0207683_10272610 3300026121 Bacteria 1546
443 Ga0207683_10376163 3300026121 Bacteria 1305
444 Ga0207698_10010883 3300026142 Bacteria 5873
445 Ga0207698_10034043 3300026142 Bacteria 3709
446 Ga0207698_10240589 3300026142 Bacteria 1649
447 Ga0207698_10770010 3300026142 Bacteria 963
448 Ga0209968_1000368 3300027526 Bacteria 7397
449 Ga0209966_1001083 3300027695 Bacteria 4965
450 Ga0209813_10061778 3300027866 Bacteria 1197
451 Ga0268266_10082289 3300028379 Bacteria 2808
452 Ga0268266_10099876 3300028379 Bacteria 2555
453 Ga0268265_10055497 3300028380 Bacteria 3010
454 Ga0268265_10090730 3300028380 Bacteria 2441
455 Ga0268265_10172527 3300028380 Bacteria 1850
456 Ga0268264_10017259 3300028381 Bacteria 5913
457 Ga0268264_10024008 3300028381 Bacteria 4976
458 Ga0268264_10078747 3300028381 Bacteria 2810
459 Ga0268264_10079952 3300028381 Bacteria 2791
460 Ga0307517_10002551 3300028786 Bacteria 29003
461 Ga0307517_10090676 3300028786 Bacteria 2505
462 Ga0307517_10098134 3300028786 Bacteria 2333
463 Ga0307515_10006463 3300028794 Bacteria 23455
464 Ga0265328_10018410 3300031239 Bacteria 2694
465 Ga0265327_10001687 3300031251 Bacteria 26413
466 Ga0265316_10000456 3300031344 Bacteria 46381
467 Ga0307513_10157331 3300031456 Bacteria 2170
468 Ga0307513_10245193 3300031456 Bacteria 1593
469 Ga0307509_10003013 3300031507 Bacteria 26337
470 Ga0307509_10006419 3300031507 Bacteria 15842
471 Ga0307509_10071396 3300031507 Bacteria 3622
472 Ga0307509_10140520 3300031507 Bacteria 2351
473 Ga0307509_10199261 3300031507 Bacteria 1841
474 Ga0307408_100062372 3300031548 Bacteria 2724
475 Ga0307408_100098808 3300031548 Bacteria 2220
476 Ga0307408_100127662 3300031548 Bacteria 1980
477 Ga0307508_10002994 3300031616 Bacteria 17413
478 Ga0307508_10183040 3300031616 Bacteria 1697
479 Ga0307508_10411848 3300031616 Bacteria 943
480 Ga0307514_10021350 3300031649 Bacteria 5278
481 Ga0307516_10152331 3300031730 Bacteria 2071
482 Ga0307405_10106122 3300031731 Bacteria 1894
483 Ga0307410_10204689 3300031852 Bacteria 1509
484 Ga0307406_10099621 3300031901 Bacteria 1976
485 Ga0307406_10344049 3300031901 Bacteria 1163
486 Ga0307407_10368402 3300031903 Bacteria 1022
487 Ga0307412_10202851 3300031911 Bacteria 1507
488 Ga0307412_10657886 3300031911 Bacteria 894
489 Ga0307409_100004091 3300031995 Bacteria 8115
490 Ga0307416_100011104 3300032002 Bacteria 5989
491 Ga0307416_100223200 3300032002 Bacteria 1809
492 Ga0307414_10098143 3300032004 Bacteria 2197
493 Ga0307411_10141292 3300032005 Bacteria 1776
494 Ga0307415_100065856 3300032126 Bacteria 2526
495 Ga0307507_10036366 3300033179 Bacteria 5034
496 Ga0307510_10001378 3300033180 Bacteria 26617
497 Ga0307510_10037621 3300033180 Bacteria 5367
498 Ga0307510_10123077 3300033180 Bacteria 2291
499 Ga0307510_10251475 3300033180 Bacteria 1255
500 Ga0373948_0075616 3300034817 Bacteria 761
501 Ga0373959_0003203 3300034820 Bacteria 2604
502 Ga0373959_0035103 3300034820 Bacteria 1029
503 Ga0373945_0018072 3300035116 Bacteria 2396
504 Ga0373945_0060705 3300035116 Bacteria 1411
505 Ga0373924_0231219 3300035410 Bacteria 817
506 Ga0373931_0003277 3300035691 Bacteria 7247
507 Ga0373931_0062596 3300035691 Bacteria 2009
508 Ga0373927_0183508 3300035695 Bacteria 1373
509 Ga0373947_0102450 3300035725 Bacteria 1800
510 Ga0373937_0053732 3300036401 Bacteria 3695
511 Ga0373937_0415952 3300036401 Bacteria 1276
512 Ga0373925_0174101 3300037068 Bacteria 1700
513 Ga0395905_0000140 3300037471 Bacteria 120221
514 Ga0395905_0086338 3300037471 Bacteria 2940
515 Ga0400490_21704 3300038726 Bacteria 10665
516 Ga0400491_21814 3300038727 Bacteria 3549
517 Ga0400488_15179 3300038741 Bacteria 2524
518 Ga0400488_42115 3300038741 Bacteria 1785
519 Ga0436365_1073955 3300039437 Bacteria 5171
520 Ga0436363_0646332 3300039450 Bacteria 4178
521 Ga0436363_1347774 3300039450 Bacteria 1090
522 Ga0436363_1365510 3300039450 Bacteria 1182
523 Ga0451853_0707298 3300041512 Bacteria 1189
524 Ga0439464_0002603 3300042439 Bacteria 4462
525 Ga0451577_0000190 3300042876 Bacteria 130692
526 Ga0466965_0107553 3300044683 Bacteria 1431
527 Ga0466961_0205481 3300044693 Bacteria 1217
528 Ga0453684_0000618 3300044712 Bacteria 129995
529 Ga0453684_0011131 3300044712 Bacteria 15174
530 Ga0451576_0004117 3300045051 Bacteria 19177
531 Ga0451576_0118016 3300045051 Bacteria 2762
532 Ga0495592_0000120 3300046454 Bacteria 69531
533 Ga0495590_0022162 3300046457 Bacteria 2248
534 Ga0495629_0024318 3300046459 Bacteria 4313
535 Ga0495638_0062159 3300046460 Bacteria 2306
536 Ga0495580_0058490 3300046472 Bacteria 2711
537 Ga0495582_0194397 3300046473 Bacteria 1158
538 Ga0495664_0202422 3300046477 Bacteria 1203
539 Ga0495610_0044815 3300046512 Bacteria 2193
540 Ga0495610_0116951 3300046512 Bacteria 1174
541 Ga0495616_0121226 3300046513 Bacteria 1207
542 Ga0495618_0191897 3300046514 Bacteria 1295
543 Ga0495620_0042465 3300046515 Bacteria 1986
544 Ga0495628_0099503 3300046516 Bacteria 2246
545 Ga0495632_0012220 3300046519 Bacteria 4960
546 Ga0495666_0074511 3300046526 Bacteria 1610
547 Ga0495642_0130464 3300046528 Bacteria 1082
548 Ga0495640_0077554 3300046533 Bacteria 2215
549 Ga0495621_0039577 3300046539 Bacteria 1649
550 Ga0495621_0059490 3300046539 Bacteria 1384
551 Ga0495597_0031114 3300046542 Bacteria 2430
552 Ga0495645_0045349 3300046543 Bacteria 3207
553 Ga0495622_0061959 3300046557 Bacteria 1732
554 Ga0495668_0097345 3300046616 Bacteria 1610
555 Ga0495625_0029797 3300046660 Bacteria 4078
556 Ga0495635_0364051 3300046663 Bacteria 964
557 Ga0495647_0156804 3300046681 Bacteria 979
558 Ga0495658_0010955 3300046683 Bacteria 4546
559 Ga0495658_0016612 3300046683 Bacteria 3789
560 Ga0495658_0229767 3300046683 Bacteria 1163
561 Ga0495613_0176758 3300046689 Bacteria 1513
562 Ga0495624_0016572 3300046690 Bacteria 4960
563 Ga0495649_0002611 3300046694 Bacteria 12572
564 Ga0495676_0063034 3300047321 Bacteria 2891
565 Ga0495687_002945 3300047443 Bacteria 12931
566 Ga0495593_0036875 3300047673 Bacteria 2648
567 Ga0496101_0412706 3300048904 Bacteria 1064
568 Ga0496102_0023399 3300048905 Bacteria 5487
569 Ga0496102_0067896 3300048905 Bacteria 3271
570 Ga0496104_0017569 3300048907 Bacteria 6517
571 Ga0496104_0076693 3300048907 Bacteria 3184
572 Ga0496105_0048432 3300048908 Bacteria 3508
573 Ga0496105_0196040 3300048908 Bacteria 1650
574 Ga0496106_0011177 3300048909 Bacteria 6642
575 Ga0496106_0030810 3300048909 Bacteria 3998
576 Ga0496107_0018033 3300048910 Bacteria 4967
577 Ga0496108_0024318 3300048911 Bacteria 4986
578 Ga0496108_0290250 3300048911 Bacteria 1424
579 Ga0496109_0022535 3300048912 Bacteria 5581
580 Ga0496109_0067571 3300048912 Bacteria 3275
581 Ga0496109_0224515 3300048912 Bacteria 1767
582 Ga0496110_0045231 3300048913 Bacteria 3847
583 Ga0496110_0464803 3300048913 Bacteria 1153
584 Ga0496111_0368605 3300048914 Bacteria 1063
585 Ga0496114_0048659 3300048917 Bacteria 3526
586 Ga0496114_0184658 3300048917 Bacteria 1822
587 Ga0496114_0512113 3300048917 Bacteria 1061
588 Ga0496121_0014455 3300048924 Bacteria 8373
589 Ga0496124_0001179 3300048927 Bacteria 40803
590 Ga0496125_0037009 3300048928 Bacteria 4249
591 Ga0501034_0179580 3300049571 Bacteria 2082
592 Ga0501043_0000439 3300049579 Bacteria 37482
593 Ga0501046_0001371 3300049580 Bacteria 23462
594 Ga0501047_0000069 3300049581 Bacteria 129231
595 Ga0501047_0461452 3300049581 Bacteria 1099
596 Ga0501198_000004 3300049649 Bacteria 175146
597 Ga0501206_004233 3300049653 Bacteria 1823
598 Ga0501222_000095 3300049662 Bacteria 23714
599 Ga0501265_005957 3300049762 Bacteria 1413
600 Ga0501045_0031168 3300049824 Bacteria 3861
601 nmdc:mga03683_22219_c1 3300050489 Bacteria 2458
602 nmdc:mga03683_43323_c1 3300050489 Bacteria 1856
603 nmdc:mga0k408_107515_c1 3300050493 Bacteria 1648
604 nmdc:mga0k408_13334_c1 3300050493 Bacteria 4505
605 nmdc:mga0k408_18654_c1 3300050493 Bacteria 3875
606 nmdc:mga0k408_23847_c1 3300050493 Bacteria 3456
607 nmdc:mga0k408_26908_c1 3300050493 Bacteria 3263
608 nmdc:mga0k408_2872_c1 3300050493 Bacteria 9148
609 nmdc:mga0k408_41558_c2 3300050493 Bacteria 1574
610 nmdc:mga0k408_49089_c1 3300050493 Bacteria 2443
611 nmdc:mga06z11_115241_c1 3300050494 Bacteria 1493
612 nmdc:mga06z11_182117_c1 3300050494 Bacteria 1212
613 nmdc:mga06z11_297719_c1 3300050494 Bacteria 959
614 nmdc:mga04h51_43242_c1 3300050495 Bacteria 1481
615 nmdc:mga07m45_13482_c1 3300050496 Bacteria 4339
616 nmdc:mga07m45_213048_c1 3300050496 Bacteria 1124
617 nmdc:mga07m45_26367_c1 3300050496 Bacteria 3195
618 nmdc:mga07m45_4706_c1 3300050496 Bacteria 6701
619 nmdc:mga07m45_501_c1 3300050496 Bacteria 16602
620 nmdc:mga07m45_6744_c1 3300050496 Bacteria 5827
621 nmdc:mga05p37_333067_c1 3300050507 Bacteria 1792
622 nmdc:mga0n895_469510_c1 3300050512 Bacteria 1269
623 nmdc:mga0a205_253609_c1 3300050515 Bacteria 1638
624 Ga0495612_0077186 3300053078 Bacteria 1396
625 Ga0500644_0004841 3300053088 Bacteria 3383
626 Ga0500646_0002363 3300053090 Bacteria 4902
627 Ga0500651_0047708 3300053093 Bacteria 2692
628 Ga0500651_0080984 3300053093 Bacteria 2010
629 Ga0500593_026510 3300053117 Bacteria 2581
630 Ga0500594_0000567 3300053118 Bacteria 7978
631 Ga0500628_002413 3300053129 Bacteria 3097
632 Ga0500642_0078953 3300053130 Bacteria 1508
633 Ga0500652_000642 3300053131 Bacteria 11936
634 Ga0500658_0009957 3300053134 Bacteria 3506
635 Ga0500559_0000138 3300053136 Bacteria 56620
636 Ga0500568_0010699 3300053139 Bacteria 4285
637 Ga0500568_0010934 3300053139 Bacteria 4230
638 Ga0500577_0053118 3300053142 Bacteria 1530
639 Ga0500579_118851 3300053143 Bacteria 1292
640 Ga0500590_044154 3300053148 Bacteria 2283
641 Ga0500604_0010984 3300053151 Bacteria 2428
642 Ga0500619_000201 3300053154 Bacteria 13773
643 Ga0500622_0000221 3300053156 Bacteria 59833
644 Ga0500622_0025039 3300053156 Bacteria 3154
645 Ga0500645_015214 3300053730 Bacteria 2440
646 Ga0500587_006189 3300053739 Bacteria 1594
647 2587730795 2585428057 Bacteria 6737412
648 2587737166 2585428058 Bacteria 6853932
649 2588294635 2588253510 Bacteria 6901809
650 2643971649 2643221592 Bacteria 6608788
651 2644142727 2643221625 Bacteria 6512927
652 2644272712 2643221648 Bacteria 6521465
653 2644340418 2643221660 Bacteria 4208257
654 Ga0307514_10172783
655 JGI25152J39213_1003968
656 JGI25153J46596_10013898
657 rootH2_10045721
658 rootH1_10015935
659 Ga0055526_1001909
660 Ga0070658_10027033
661 Ga0070658_10063041
662 Ga0070658_10298036
663 Ga0070676_10001611
664 Ga0070676_10007770
665 Ga0070676_10024955
666 Ga0070676_10313285
667 Ga0070683_100026824
668 Ga0070683_100599206
669 Ga0070690_100074891
670 Ga0070670_100006690
671 Ga0070670_100043165
672 Ga0070670_100046341
673 Ga0070670_100056723
674 Ga0070670_100085069
675 Ga0070670_100162982
676 Ga0070670_100172636
677 Ga0070670_100573047
678 Ga0070677_10006651
679 Ga0070677_10009064
680 Ga0070677_10012670
681 Ga0070677_10035070
682 Ga0070677_10042779
683 Ga0068869_100006643
684 Ga0068869_100008107
685 Ga0068869_100019365
686 Ga0070666_10000601
687 Ga0070666_10043451
688 Ga0070666_10125933
689 Ga0070680_100039594
690 Ga0068868_100006388
691 Ga0068868_100010447
692 Ga0068868_100010849
693 Ga0068868_100028445
694 Ga0070660_100033424
695 Ga0070660_100091037
696 Ga0070689_100254211
697 Ga0070687_100011936
698 Ga0070687_100178675
699 Ga0070661_100111809
700 Ga0070692_10020138
701 Ga0070668_100006370
702 Ga0070668_100040485
703 Ga0070668_100067999
704 Ga0070668_100390277
705 Ga0070669_100005118
706 Ga0070669_100088217
707 Ga0070675_100002437
708 Ga0070675_100002524
709 Ga0070675_100024456
710 Ga0070675_100039856
711 Ga0070675_100041283
712 Ga0070675_100056329
713 Ga0070671_100033458
714 Ga0070671_100064571
715 Ga0070671_100076627
716 Ga0070671_100194419
717 Ga0070671_100323929
718 Ga0070674_100028752
719 Ga0070674_100048139
720 Ga0070674_100539621
721 Ga0070673_100002831
722 Ga0070673_100020631
723 Ga0070673_100053157
724 Ga0070673_100135536
725 Ga0070673_100138627
726 Ga0070673_100159578
727 Ga0070688_100024535
728 Ga0070659_100188914
729 Ga0070659_100394319
730 Ga0070667_100002909
731 Ga0070667_100011298
732 Ga0070667_100129156
733 Ga0070667_100193033
734 Ga0070667_100201566
735 Ga0070667_100348335
736 Ga0070700_100245034
737 Ga0070708_100630231
738 Ga0070663_100001718
739 Ga0070663_100003146
740 Ga0070663_100071894
741 Ga0070663_100282757
742 Ga0070678_100001353
743 Ga0070678_100007938
744 Ga0070678_100070501
745 Ga0070678_100515747
746 Ga0070662_100001682
747 Ga0070662_100013298
748 Ga0070662_100054826
749 Ga0070662_100144330
750 Ga0070662_100396864
751 Ga0070681_10070808
752 Ga0070681_10123230
753 Ga0068867_100000118
754 Ga0068867_100010409
755 Ga0068867_100013383
756 Ga0068867_100028188
757 Ga0068867_100066655
758 Ga0068867_100132666
759 Ga0068867_100295939
760 Ga0070685_10151051
761 Ga0070685_10369909
762 Ga0070706_100000965
763 Ga0070699_100123620
764 Ga0070679_100048911
765 Ga0070684_100031023
766 Ga0068853_100022443
767 Ga0068853_100042110
768 Ga0070672_100003887
769 Ga0070672_100006503
770 Ga0070672_100007981
771 Ga0070672_100030004
772 Ga0070672_100079552
773 Ga0070672_100160394
774 Ga0070672_100169980
775 Ga0070672_100543151
776 Ga0070686_100198740
777 Ga0070695_100165203
778 Ga0070693_100127077
779 Ga0070693_100159243
780 Ga0070665_100024704
781 Ga0070665_100112682
782 Ga0068855_100637529
783 Ga0070664_100184559
784 Ga0070664_100295653
785 Ga0070664_100340585
786 Ga0070664_100490533
787 Ga0070664_100498100
788 Ga0068857_100053448
789 Ga0068857_100056743
790 Ga0068857_100057677
791 Ga0068854_100064998
792 Ga0068854_100136926
793 Ga0068856_100036566
794 Ga0068856_100726837
795 Ga0070702_100010660
796 Ga0068852_100013245
797 Ga0068852_100019713
798 Ga0068852_100070959
799 Ga0068852_100259130
800 Ga0068852_100405391
801 Ga0068859_100117627
802 Ga0068864_100005532
803 Ga0068864_100015862
804 Ga0068864_100021008
805 Ga0068864_100042789
806 Ga0068864_100076307
807 Ga0068861_100001984
808 Ga0068861_100004050
809 Ga0068861_100137740
810 Ga0068851_10003613
811 Ga0068851_10019980
812 Ga0068851_10221814
813 Ga0068870_10015312
814 Ga0068863_100008538
815 Ga0068863_100020081
816 Ga0068863_100034043
817 Ga0068863_100165027
818 Ga0068858_100000366
819 Ga0068858_100003535
820 Ga0068858_100007014
821 Ga0068860_100010516
822 Ga0068860_100012879
823 Ga0068860_100057768
824 Ga0068860_100083236
825 Ga0068860_100150832
826 Ga0068862_100014899
827 Ga0068862_100030402
828 Ga0068862_100221819
829 Ga0075368_10017629
830 Ga0075368_10076261
831 Ga0075368_10107159
832 Ga0075363_100023860
833 Ga0075363_100154196
834 Ga0075364_10105575
835 Ga0075364_10284118
836 Ga0075362_10005831
837 Ga0075362_10022328
838 Ga0075362_10064265
839 Ga0075362_10120893
840 Ga0075367_10008921
841 Ga0075367_10013328
842 Ga0075367_10026931
843 Ga0075367_10196888
844 Ga0075369_10010697
845 Ga0075366_10003454
846 Ga0075366_10033486
847 Ga0075366_10043038
848 Ga0075366_10049304
849 Ga0075366_10109108
850 Ga0075366_10191578
851 Ga0097621_100014905
852 Ga0097621_100039158
853 Ga0097621_100047833
854 Ga0075370_10000130
855 Ga0075370_10012739
856 Ga0075370_10026075
857 Ga0075370_10031975
858 Ga0075370_10043478
859 Ga0075370_10059096
860 Ga0075370_10194949
861 Ga0068871_100022996
862 Ga0068871_100040487
863 Ga0068871_100108866
864 Ga0068871_100135466
865 Ga0075434_100504068
866 Ga0068865_100024616
867 Ga0068865_100084797
868 Ga0068865_100189447
869 Ga0097620_100117632
870 Ga0105240_10079271
871 Ga0111539_10513838
872 Ga0105245_10047200
873 Ga0105245_10058736
874 Ga0105245_10100343
875 Ga0105245_10270701
876 Ga0114129_10235563
877 Ga0105243_10001408
878 Ga0105243_10066478
879 Ga0105241_10341734
880 Ga0105242_10119067
881 Ga0105248_10002745
882 Ga0105248_10073729
883 Ga0105248_10221259
884 Ga0105237_10157770
885 Ga0105238_10016418
886 Ga0105238_10268095
887 Ga0105249_10004419
888 Ga0105249_10114312
889 Ga0105249_10377239
890 Ga0105239_10018823
891 Ga0105246_10307663
892 Ga0157371_10147599
893 Ga0157370_10135076
894 Ga0157369_10065369
895 Ga0157374_10014987
896 Ga0157374_10086987
897 Ga0157374_10390775
898 Ga0157378_10252813
899 Ga0163162_10037870
900 Ga0163162_10065499
901 Ga0163162_10450209
902 Ga0163162_10478152
903 Ga0157372_10107189
904 Ga0157375_10007448
905 Ga0157375_10020991
906 Ga0157375_10041370
907 Ga0157375_10090976
908 Ga0157375_10097314
909 Ga0157375_10139441
910 Ga0157375_10268431
911 Ga0157375_10846694
912 Ga0163163_10013972
913 Ga0163163_10376867
914 Ga0163163_10446279
915 Ga0157380_10033410
916 Ga0157380_10055786
917 Ga0157380_10617425
918 Ga0157377_10000343
919 Ga0157377_10008399
920 Ga0157377_10449766
921 Ga0157379_10014124
922 Ga0157379_10017039
923 Ga0157379_10025223
924 Ga0157379_10027564
925 Ga0157379_10079503
926 Ga0157376_10079724
927 Ga0157376_10388097
928 Ga0157376_10454696
929 Ga0163161_10022192
930 Ga0163161_10023866
931 Ga0163161_10247209
932 Ga0163161_10337685
933 Ga0213876_10179811
934 Ga0207425_1002947
935 Ga0209759_1003238
936 Ga0209129_1000043
937 Ga0209564_1000014
938 Ga0209758_1000307
939 Ga0209758_1000492
940 Ga0209050_1000493
941 Ga0207656_10036385
942 Ga0207656_10088129
943 Ga0207682_10003952
944 Ga0207682_10016294
945 Ga0207682_10026747
946 Ga0207642_10109241
947 Ga0207642_10142517
948 Ga0207688_10031694
949 Ga0207680_10033910
950 Ga0207645_10001578
951 Ga0207645_10005999
952 Ga0207645_10019747
953 Ga0207645_10069115
954 Ga0207645_10188261
955 Ga0207705_10045377
956 Ga0207705_10061559
957 Ga0207705_10147103
958 Ga0207705_10284776
959 Ga0207684_10002804
960 Ga0207654_10067671
961 Ga0207695_10097869
962 Ga0207671_10044427
963 Ga0207671_10080970
964 Ga0207660_10092905
965 Ga0207662_10001240
966 Ga0207649_10028048
967 Ga0207652_10291402
968 Ga0207646_10014090
969 Ga0207681_10000634
970 Ga0207681_10009755
971 Ga0207681_10442728
972 Ga0207694_10041513
973 Ga0207694_10104715
974 Ga0207650_10001855
975 Ga0207650_10009236
976 Ga0207650_10040693
977 Ga0207650_10048664
978 Ga0207650_10226082
979 Ga0207659_10002325
980 Ga0207659_10002524
981 Ga0207659_10017565
982 Ga0207659_10018246
983 Ga0207659_10080909
984 Ga0207659_10339221
985 Ga0207687_10035415
986 Ga0207687_10081272
987 Ga0207687_10145231
988 Ga0207687_10287821
989 Ga0207644_10000264
990 Ga0207644_10003222
991 Ga0207644_10043921
992 Ga0207644_10045173
993 Ga0207644_10155677
994 Ga0207644_10226801
995 Ga0207644_10239809
996 Ga0207644_10252519
997 Ga0207690_10004434
998 Ga0207690_10267078
999 Ga0207690_10338423
1000 Ga0207706_10001386
1001 Ga0207706_10003415
1002 Ga0207706_10066514
1003 Ga0207706_10126250
1004 Ga0207706_10139677
1005 Ga0207706_10153691
1006 Ga0207709_10000850
1007 Ga0207709_10028530
1008 Ga0207709_10198449
1009 Ga0207670_10224119
1010 Ga0207669_10031921
1011 Ga0207704_10012840
1012 Ga0207704_10071979
1013 Ga0207704_10221417
1014 Ga0207691_10005307
1015 Ga0207691_10007010
1016 Ga0207691_10031990
1017 Ga0207691_10045319
1018 Ga0207691_10051561
1019 Ga0207691_10072750
1020 Ga0207711_10001750
1021 Ga0207711_10003373
1022 Ga0207711_10218203
1023 Ga0207711_10221243
1024 Ga0207689_10003399
1025 Ga0207689_10009456
1026 Ga0207689_10022214
1027 Ga0207689_10120358
1028 Ga0207689_10419526
1029 Ga0207661_10197377
1030 Ga0207661_10253093
1031 Ga0207679_10046298
1032 Ga0207679_10146323
1033 Ga0207667_10066908
1034 Ga0207651_10000726
1035 Ga0207651_10016312
1036 Ga0207651_10144598
1037 Ga0207712_10012921
1038 Ga0207712_10086416
1039 Ga0207668_10000316
1040 Ga0207668_10008970
1041 Ga0207668_10306146
1042 Ga0207640_10361898
1043 Ga0207658_10001493
1044 Ga0207658_10003581
1045 Ga0207658_10029135
1046 Ga0207658_10069255
1047 Ga0207658_10236993
1048 Ga0207658_10283783
1049 Ga0207658_10538306
1050 Ga0207677_10001252
1051 Ga0207677_10001906
1052 Ga0207677_10027519
1053 Ga0207677_10054454
1054 Ga0207677_10122392
1055 Ga0207703_10000616
1056 Ga0207703_10005986
1057 Ga0207703_10017344
1058 Ga0207703_10075878
1059 Ga0207703_10233916
1060 Ga0207639_10021939
1061 Ga0207678_10001164
1062 Ga0207678_10023154
1063 Ga0207678_10052464
1064 Ga0207708_10009445
1065 Ga0207702_10039291
1066 Ga0207641_10004967
1067 Ga0207641_10035633
1068 Ga0207641_10049815
1069 Ga0207641_10113934
1070 Ga0207641_10122564
1071 Ga0207641_10236963
1072 Ga0207641_10254103
1073 Ga0207648_10002014
1074 Ga0207648_10011543
1075 Ga0207648_10038737
1076 Ga0207648_10041423
1077 Ga0207648_10159467
1078 Ga0207648_10248109
1079 Ga0207648_10344084
1080 Ga0207676_10002431
1081 Ga0207676_10068909
1082 Ga0207676_10200582
1083 Ga0207674_10036973
1084 Ga0207674_10082149
1085 Ga0207675_100001106
1086 Ga0207675_100009921
1087 Ga0207675_100042026
1088 Ga0207675_100513468
1089 Ga0207683_10004615
1090 Ga0207683_10044600
1091 Ga0207683_10047674
1092 Ga0207683_10059063
1093 Ga0207683_10128521
1094 Ga0207683_10147498
1095 Ga0207683_10272610
1096 Ga0207683_10376163
1097 Ga0207698_10010883
1098 Ga0207698_10034043
1099 Ga0207698_10240589
1100 Ga0207698_10770010
1101 Ga0209968_1000368
1102 Ga0209966_1001083
1103 Ga0209813_10061778
1104 Ga0268266_10082289
1105 Ga0268266_10099876
1106 Ga0268265_10055497
1107 Ga0268265_10090730
1108 Ga0268265_10172527
1109 Ga0268264_10017259
1110 Ga0268264_10024008
1111 Ga0268264_10078747
1112 Ga0268264_10079952
1113 Ga0307517_10002551
1114 Ga0307517_10090676
1115 Ga0307517_10098134
1116 Ga0307515_10006463
1117 Ga0265328_10018410
1118 Ga0265327_10001687
1119 Ga0265316_10000456
1120 Ga0307513_10157331
1121 Ga0307513_10245193
1122 Ga0307509_10003013
1123 Ga0307509_10006419
1124 Ga0307509_10071396
1125 Ga0307509_10140520
1126 Ga0307509_10199261
1127 Ga0307408_100062372
1128 Ga0307408_100098808
1129 Ga0307408_100127662
1130 Ga0307508_10002994
1131 Ga0307508_10183040
1132 Ga0307508_10411848
1133 Ga0307514_10021350
1134 Ga0307516_10152331
1135 Ga0307405_10106122
1136 Ga0307410_10204689
1137 Ga0307406_10099621
1138 Ga0307406_10344049
1139 Ga0307407_10368402
1140 Ga0307412_10202851
1141 Ga0307412_10657886
1142 Ga0307409_100004091
1143 Ga0307416_100011104
1144 Ga0307416_100223200
1145 Ga0307414_10098143
1146 Ga0307411_10141292
1147 Ga0307415_100065856
1148 Ga0307507_10036366
1149 Ga0307510_10001378
1150 Ga0307510_10037621
1151 Ga0307510_10123077
1152 Ga0307510_10251475
1153 Ga0373948_0075616
1154 Ga0373959_0003203
1155 Ga0373959_0035103
1156 Ga0373945_0018072
1157 Ga0373945_0060705
1158 Ga0373924_0231219
1159 Ga0373931_0003277
1160 Ga0373931_0062596
1161 Ga0373927_0183508
1162 Ga0373947_0102450
1163 Ga0373937_0053732
1164 Ga0373937_0415952
1165 Ga0373925_0174101
1166 Ga0395905_0000140
1167 Ga0395905_0086338
1168 Ga0400490_21704
1169 Ga0400491_21814
1170 Ga0400488_15179
1171 Ga0400488_42115
1172 Ga0436365_1073955
1173 Ga0436363_0646332
1174 Ga0436363_1347774
1175 Ga0436363_1365510
1176 Ga0451853_0707298
1177 Ga0439464_0002603
1178 Ga0451577_0000190
1179 Ga0466965_0107553
1180 Ga0466961_0205481
1181 Ga0453684_0000618
1182 Ga0453684_0011131
1183 Ga0451576_0004117
1184 Ga0451576_0118016
1185 Ga0495592_0000120
1186 Ga0495590_0022162
1187 Ga0495629_0024318
1188 Ga0495638_0062159
1189 Ga0495580_0058490
1190 Ga0495582_0194397
1191 Ga0495664_0202422
1192 Ga0495610_0044815
1193 Ga0495610_0116951
1194 Ga0495616_0121226
1195 Ga0495618_0191897
1196 Ga0495620_0042465
1197 Ga0495628_0099503
1198 Ga0495632_0012220
1199 Ga0495666_0074511
1200 Ga0495642_0130464
1201 Ga0495640_0077554
1202 Ga0495621_0039577
1203 Ga0495621_0059490
1204 Ga0495597_0031114
1205 Ga0495645_0045349
1206 Ga0495622_0061959
1207 Ga0495668_0097345
1208 Ga0495625_0029797
1209 Ga0495635_0364051
1210 Ga0495647_0156804
1211 Ga0495658_0010955
1212 Ga0495658_0016612
1213 Ga0495658_0229767
1214 Ga0495613_0176758
1215 Ga0495624_0016572
1216 Ga0495649_0002611
1217 Ga0495676_0063034
1218 Ga0495687_002945
1219 Ga0495593_0036875
1220 Ga0496101_0412706
1221 Ga0496102_0023399
1222 Ga0496102_0067896
1223 Ga0496104_0017569
1224 Ga0496104_0076693
1225 Ga0496105_0048432
1226 Ga0496105_0196040
1227 Ga0496106_0011177
1228 Ga0496106_0030810
1229 Ga0496107_0018033
1230 Ga0496108_0024318
1231 Ga0496108_0290250
1232 Ga0496109_0022535
1233 Ga0496109_0067571
1234 Ga0496109_0224515
1235 Ga0496110_0045231
1236 Ga0496110_0464803
1237 Ga0496111_0368605
1238 Ga0496114_0048659
1239 Ga0496114_0184658
1240 Ga0496114_0512113
1241 Ga0496121_0014455
1242 Ga0496124_0001179
1243 Ga0496125_0037009
1244 Ga0501034_0179580
1245 Ga0501043_0000439
1246 Ga0501046_0001371
1247 Ga0501047_0000069
1248 Ga0501047_0461452
1249 Ga0501198_000004
1250 Ga0501206_004233
1251 Ga0501222_000095
1252 Ga0501265_005957
1253 Ga0501045_0031168
1254 nmdc:mga03683_22219_c1
1255 nmdc:mga03683_43323_c1
1256 nmdc:mga0k408_107515_c1
1257 nmdc:mga0k408_13334_c1
1258 nmdc:mga0k408_18654_c1
1259 nmdc:mga0k408_23847_c1
1260 nmdc:mga0k408_26908_c1
1261 nmdc:mga0k408_2872_c1
1262 nmdc:mga0k408_41558_c2
1263 nmdc:mga0k408_49089_c1
1264 nmdc:mga06z11_115241_c1
1265 nmdc:mga06z11_182117_c1
1266 nmdc:mga06z11_297719_c1
1267 nmdc:mga04h51_43242_c1
1268 nmdc:mga07m45_13482_c1
1269 nmdc:mga07m45_213048_c1
1270 nmdc:mga07m45_26367_c1
1271 nmdc:mga07m45_4706_c1
1272 nmdc:mga07m45_501_c1
1273 nmdc:mga07m45_6744_c1
1274 nmdc:mga05p37_333067_c1
1275 nmdc:mga0n895_469510_c1
1276 nmdc:mga0a205_253609_c1
1277 Ga0495612_0077186
1278 Ga0500644_0004841
1279 Ga0500646_0002363
1280 Ga0500651_0047708
1281 Ga0500651_0080984
1282 Ga0500593_026510
1283 Ga0500594_0000567
1284 Ga0500628_002413
1285 Ga0500642_0078953
1286 Ga0500652_000642
1287 Ga0500658_0009957
1288 Ga0500559_0000138
1289 Ga0500568_0010699
1290 Ga0500568_0010934
1291 Ga0500577_0053118
1292 Ga0500579_118851
1293 Ga0500590_044154
1294 Ga0500604_0010984
1295 Ga0500619_000201
1296 Ga0500622_0000221
1297 Ga0500622_0025039
1298 Ga0500645_015214
1299 Ga0500587_006189
1300 2587730795
1301 2587737166
1302 2588294635
1303 2643971649
1304 2644142727
1305 2644272712
1306 2644340418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

187

293

0.96

PF00072

Response_reg

Response regulator receiver domain

44

156

0.95

Map