F472673

General Info

Members Datasets Scaffolds Average Seq Length
652 297 1304 291

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100006955|Ga0070696_1000069551
Length 316
Sequence MTAHADPTPAAGAGADVASTQGPVPSPPDTPGRRLAAALYRRPRAQLAILLSAPLGWLLIGYIGALALLFISAFWRLDPFSGNIVTEPTLQNFQELLTKDIYRTVALRTIGIAALVTLTDIVLAFPIAYFMARVASPRTRALLVVSILLPLWSGYLVKVYAWRLILSEEGLLNWALAPFGLKGPGYGEVAVWLVMSYLWLPYMIIPVFAGLERIPNSLIEASGDLGARASTTFQRVILPLAFPAVVAGSIFTFSLTLGDYITPTLVSGTQFIGNVIYSNVGVAGNQPLAAAYAFVPALVMSIYLLVARRLGAFEAL

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
187 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
291 2643221604 Nocardioides sp. Root190 Isolate Unclassified
292 2643221617 Nocardioides sp. Root79 Isolate Unclassified
293 2643221620 Nocardioides sp. Root240 Isolate Unclassified
294 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
295 2738541305 Nocardioides sp. CF167 Isolate Unclassified
296 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
297 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0.46
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.07
Nodule 0
Rhizoplane 7.21
Rhizosphere 86.2
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100006955 3300005546 Bacteria 7553
2 Ga0006562J51391_1063616 3300003578 Bacteria 2236
3 Ga0006562J51391_1063617 3300003578 Bacteria 1180
4 Ga0070658_10388672 3300005327 Bacteria 1197
5 Ga0070658_10427670 3300005327 Bacteria 1139
6 Ga0070683_100012996 3300005329 Bacteria 7247
7 Ga0070683_100026737 3300005329 Bacteria 5200
8 Ga0070683_100319035 3300005329 Bacteria 1479
9 Ga0070690_100241382 3300005330 Bacteria 1274
10 Ga0070670_100003070 3300005331 Bacteria 13807
11 Ga0068869_100035504 3300005334 Bacteria 3533
12 Ga0068869_100368701 3300005334 Bacteria 1174
13 Ga0070680_100019045 3300005336 Bacteria 5433
14 Ga0070680_100039707 3300005336 Bacteria 3807
15 Ga0070680_100502055 3300005336 Bacteria 1038
16 Ga0070682_100007811 3300005337 Bacteria 6021
17 Ga0070682_100041855 3300005337 Bacteria 2826
18 Ga0070682_100112440 3300005337 Bacteria 1817
19 Ga0070682_100270811 3300005337 Bacteria 1233
20 Ga0068868_100105316 3300005338 Bacteria 2287
21 Ga0068868_100390239 3300005338 Bacteria 1199
22 Ga0070660_100100005 3300005339 Bacteria 2296
23 Ga0070660_100106823 3300005339 Bacteria 2224
24 Ga0070660_100129725 3300005339 Bacteria 2017
25 Ga0070660_100145730 3300005339 Bacteria 1902
26 Ga0070689_100029332 3300005340 Bacteria 4163
27 Ga0070689_100049291 3300005340 Bacteria 3251
28 Ga0070689_100246986 3300005340 Bacteria 1471
29 Ga0070691_10054668 3300005341 Bacteria 1911
30 Ga0070661_100066494 3300005344 Bacteria 2648
31 Ga0070661_100160859 3300005344 Bacteria 1700
32 Ga0070668_100314827 3300005347 Bacteria 1316
33 Ga0070669_100001465 3300005353 Bacteria 17081
34 Ga0070669_100383528 3300005353 Bacteria 1146
35 Ga0070675_100024824 3300005354 Bacteria 4801
36 Ga0070675_100113770 3300005354 Bacteria 2292
37 Ga0070674_100054242 3300005356 Bacteria 2771
38 Ga0070673_100401269 3300005364 Bacteria 1226
39 Ga0070688_100030225 3300005365 Bacteria 3249
40 Ga0070688_100046866 3300005365 Bacteria 2678
41 Ga0070659_100023753 3300005366 Bacteria 4694
42 Ga0070659_100048605 3300005366 Bacteria 3333
43 Ga0070667_100000073 3300005367 Bacteria 122757
44 Ga0070667_100254170 3300005367 Bacteria 1572
45 Ga0070703_10000005 3300005406 Bacteria 127348
46 Ga0070701_10019585 3300005438 Bacteria 3198
47 Ga0070701_10045173 3300005438 Bacteria 2259
48 Ga0070705_100002139 3300005440 Bacteria 10050
49 Ga0070705_100019005 3300005440 Bacteria 3611
50 Ga0070705_100036662 3300005440 Bacteria 2759
51 Ga0070705_100303794 3300005440 Bacteria 1145
52 Ga0070700_100032415 3300005441 Bacteria 3139
53 Ga0070708_100000794 3300005445 Bacteria 23825
54 Ga0070708_100001587 3300005445 Bacteria 17418
55 Ga0070708_100007817 3300005445 Bacteria 8570
56 Ga0070708_100087401 3300005445 Bacteria 2833
57 Ga0070663_100092621 3300005455 Bacteria 2241
58 Ga0070678_100385611 3300005456 Bacteria 1213
59 Ga0070678_100401397 3300005456 Bacteria 1191
60 Ga0070662_100025389 3300005457 Bacteria 4091
61 Ga0070662_100027410 3300005457 Bacteria 3954
62 Ga0070681_10029688 3300005458 Bacteria 5490
63 Ga0068867_100073133 3300005459 Bacteria 2567
64 Ga0070685_10045429 3300005466 Bacteria 2519
65 Ga0070685_10059075 3300005466 Bacteria 2237
66 Ga0070685_10154461 3300005466 Bacteria 1457
67 Ga0070706_100002481 3300005467 Bacteria 18576
68 Ga0070706_100003465 3300005467 Bacteria 15530
69 Ga0070706_100005224 3300005467 Bacteria 12384
70 Ga0070706_100044163 3300005467 Bacteria 4117
71 Ga0070706_100069240 3300005467 Bacteria 3264
72 Ga0070707_100000985 3300005468 Bacteria 28162
73 Ga0070707_100009666 3300005468 Bacteria 8962
74 Ga0070707_100014256 3300005468 Bacteria 7451
75 Ga0070707_100023767 3300005468 Bacteria 5796
76 Ga0070707_100044237 3300005468 Bacteria 4262
77 Ga0070707_100116058 3300005468 Bacteria 2598
78 Ga0070698_100004585 3300005471 Bacteria 15177
79 Ga0070698_100005445 3300005471 Bacteria 13901
80 Ga0070698_100070030 3300005471 Bacteria 3520
81 Ga0070698_100101429 3300005471 Bacteria 2849
82 Ga0070699_100005041 3300005518 Bacteria 11625
83 Ga0070699_100020854 3300005518 Bacteria 5651
84 Ga0070699_100062287 3300005518 Bacteria 3233
85 Ga0070699_100077922 3300005518 Bacteria 2886
86 Ga0070699_100237556 3300005518 Bacteria 1626
87 Ga0070679_100009090 3300005530 Bacteria 9377
88 Ga0070679_100108700 3300005530 Bacteria 2759
89 Ga0070679_100228232 3300005530 Bacteria 1822
90 Ga0070684_100007890 3300005535 Bacteria 8303
91 Ga0070684_100031032 3300005535 Bacteria 4546
92 Ga0070684_100153169 3300005535 Bacteria 2089
93 Ga0070697_100057613 3300005536 Bacteria 3161
94 Ga0070697_100161403 3300005536 Bacteria 1894
95 Ga0070697_100185770 3300005536 Bacteria 1763
96 Ga0068853_100014718 3300005539 Bacteria 6418
97 Ga0070686_100034595 3300005544 Bacteria 3115
98 Ga0070695_100059320 3300005545 Bacteria 2477
99 Ga0070695_100089441 3300005545 Bacteria 2053
100 Ga0070696_100076913 3300005546 Bacteria 2357
101 Ga0070696_100086327 3300005546 Bacteria 2228
102 Ga0070665_100011077 3300005548 Bacteria 9112
103 Ga0070665_100248305 3300005548 Bacteria 1780
104 Ga0070704_100016930 3300005549 Bacteria 4622
105 Ga0070704_100092243 3300005549 Bacteria 2260
106 Ga0068855_100432428 3300005563 Bacteria 1439
107 Ga0070664_100097256 3300005564 Bacteria 2556
108 Ga0070664_100202820 3300005564 Bacteria 1770
109 Ga0070664_100444618 3300005564 Bacteria 1189
110 Ga0068857_100019198 3300005577 Bacteria 6000
111 Ga0068857_100217515 3300005577 Bacteria 1744
112 Ga0068854_100074264 3300005578 Bacteria 2494
113 Ga0068854_100118671 3300005578 Bacteria 2005
114 Ga0068854_100181423 3300005578 Bacteria 1645
115 Ga0068854_100357695 3300005578 Bacteria 1197
116 Ga0070702_100129533 3300005615 Bacteria 1591
117 Ga0070702_100307198 3300005615 Bacteria 1100
118 Ga0068852_100506793 3300005616 Bacteria 1202
119 Ga0068859_100001171 3300005617 Bacteria 26821
120 Ga0068859_100257075 3300005617 Bacteria 1837
121 Ga0068864_100008550 3300005618 Bacteria 8450
122 Ga0068864_100058644 3300005618 Bacteria 3328
123 Ga0068866_10168150 3300005718 Bacteria 1285
124 Ga0068861_100272165 3300005719 Bacteria 1455
125 Ga0068861_100393077 3300005719 Bacteria 1228
126 Ga0068870_10004899 3300005840 Bacteria 5793
127 Ga0068870_10229108 3300005840 Bacteria 1141
128 Ga0068863_100000644 3300005841 Bacteria 35359
129 Ga0068863_100601947 3300005841 Bacteria 1088
130 Ga0068858_100074569 3300005842 Bacteria 3150
131 Ga0068860_100000127 3300005843 Bacteria 122766
132 Ga0068862_100000052 3300005844 Bacteria 144622
133 Ga0081455_10001178 3300005937 Bacteria 32690
134 Ga0081455_10018092 3300005937 Bacteria 6728
135 Ga0081455_10053793 3300005937 Bacteria 3437
136 Ga0081455_10313405 3300005937 Bacteria 1120
137 Ga0081538_10000466 3300005981 Bacteria 45388
138 Ga0081539_10000936 3300005985 Bacteria 54722
139 Ga0081539_10002707 3300005985 Bacteria 24044
140 Ga0081539_10002844 3300005985 Bacteria 23084
141 Ga0075365_10003559 3300006038 Bacteria 8058
142 Ga0075365_10008137 3300006038 Bacteria 5925
143 Ga0075365_10018960 3300006038 Bacteria 4238
144 Ga0075365_10067078 3300006038 Bacteria 2408
145 Ga0075365_10076333 3300006038 Bacteria 2262
146 Ga0075365_10103741 3300006038 Bacteria 1949
147 Ga0075365_10307526 3300006038 Bacteria 1116
148 Ga0075363_100012276 3300006048 Bacteria 4125
149 Ga0075364_10011464 3300006051 Bacteria 5383
150 Ga0075364_10089499 3300006051 Bacteria 2041
151 Ga0075432_10005941 3300006058 Bacteria 4154
152 Ga0075432_10017905 3300006058 Bacteria 2415
153 Ga0070712_100167542 3300006175 Bacteria 1702
154 Ga0075370_10156803 3300006353 Bacteria 1335
155 Ga0075428_100001830 3300006844 Bacteria 22766
156 Ga0075428_100082203 3300006844 Bacteria 3515
157 Ga0075428_100096829 3300006844 Bacteria 3216
158 Ga0075428_100417110 3300006844 Bacteria 1438
159 Ga0075428_100419204 3300006844 Bacteria 1434
160 Ga0075428_100422053 3300006844 Bacteria 1429
161 Ga0075430_100029156 3300006846 Bacteria 4684
162 Ga0075430_100034523 3300006846 Bacteria 4293
163 Ga0075430_100035869 3300006846 Bacteria 4205
164 Ga0075430_100065840 3300006846 Bacteria 3044
165 Ga0075431_100042147 3300006847 Bacteria 4707
166 Ga0075431_100080068 3300006847 Bacteria 3372
167 Ga0075431_100143475 3300006847 Bacteria 2461
168 Ga0075431_100300930 3300006847 Bacteria 1620
169 Ga0075433_10082713 3300006852 Bacteria 2832
170 Ga0075434_100146464 3300006871 Bacteria 2382
171 Ga0075429_100004464 3300006880 Bacteria 12040
172 Ga0075429_100096330 3300006880 Bacteria 2581
173 Ga0075429_100230966 3300006880 Bacteria 1620
174 Ga0075429_100281804 3300006880 Bacteria 1455
175 Ga0068865_100003111 3300006881 Bacteria 9924
176 Ga0068865_100009066 3300006881 Bacteria 6154
177 Ga0097620_100001171 3300006931 Bacteria 26821
178 Ga0097620_100257070 3300006931 Bacteria 1837
179 Ga0111539_10013826 3300009094 Bacteria 10088
180 Ga0111539_10043995 3300009094 Bacteria 5351
181 Ga0111539_10130526 3300009094 Bacteria 2942
182 Ga0111539_10165303 3300009094 Bacteria 2587
183 Ga0111539_10257867 3300009094 Bacteria 2030
184 Ga0111539_10521416 3300009094 Bacteria 1384
185 Ga0111539_10552783 3300009094 Bacteria 1341
186 Ga0105245_10032238 3300009098 Bacteria 4639
187 Ga0105247_10000066 3300009101 Bacteria 121025
188 Ga0114129_10002538 3300009147 Bacteria 25350
189 Ga0114129_10003660 3300009147 Bacteria 21613
190 Ga0114129_10034320 3300009147 Bacteria 7163
191 Ga0114129_10116895 3300009147 Bacteria 3675
192 Ga0114129_10152182 3300009147 Bacteria 3165
193 Ga0114129_10200089 3300009147 Bacteria 2706
194 Ga0114129_10289762 3300009147 Bacteria 2185
195 Ga0105243_10012002 3300009148 Bacteria 6549
196 Ga0105243_10033694 3300009148 Bacteria 3961
197 Ga0105243_10303397 3300009148 Bacteria 1448
198 Ga0105243_10314805 3300009148 Bacteria 1424
199 Ga0105243_10486377 3300009148 Bacteria 1166
200 Ga0105242_10030369 3300009176 Bacteria 4314
201 Ga0105242_10044490 3300009176 Bacteria 3596
202 Ga0105242_10167509 3300009176 Bacteria 1928
203 Ga0105248_10000144 3300009177 Bacteria 81953
204 Ga0105248_10050668 3300009177 Bacteria 4657
205 Ga0105248_10221935 3300009177 Bacteria 2128
206 Ga0105238_10168916 3300009551 Bacteria 2163
207 Ga0105249_10000093 3300009553 Bacteria 122840
208 Ga0105249_10479478 3300009553 Bacteria 1286
209 Ga0105249_10617341 3300009553 Bacteria 1140
210 Ga0105239_10068923 3300010375 Bacteria 3887
211 Ga0105239_10085718 3300010375 Bacteria 3472
212 Ga0105239_10447102 3300010375 Bacteria 1466
213 Ga0105239_10692172 3300010375 Bacteria 1165
214 Ga0105239_10890235 3300010375 Bacteria 1021
215 Ga0105246_10016159 3300011119 Bacteria 4723
216 Ga0105246_10230780 3300011119 Unclassified 1457
217 Ga0105246_10261754 3300011119 Bacteria 1378
218 Ga0105246_10422880 3300011119 Bacteria 1112
219 Ga0157338_1000639 3300012515 Bacteria 2165
220 Ga0157373_10110375 3300013100 Bacteria 1934
221 Ga0157371_10030479 3300013102 Bacteria 3892
222 Ga0157371_10079958 3300013102 Bacteria 2315
223 Ga0157370_10092661 3300013104 Bacteria 2836
224 Ga0157369_10005945 3300013105 Bacteria 14168
225 Ga0157369_10227643 3300013105 Bacteria 1950
226 Ga0157374_10360490 3300013296 Bacteria 1446
227 Ga0157378_10095222 3300013297 Bacteria 2712
228 Ga0157378_10177749 3300013297 Bacteria 2000
229 Ga0157378_10450411 3300013297 Bacteria 1277
230 Ga0163162_10190128 3300013306 Bacteria 2180
231 Ga0163162_10201907 3300013306 Bacteria 2117
232 Ga0163162_10395747 3300013306 Bacteria 1514
233 Ga0163162_10457537 3300013306 Bacteria 1408
234 Ga0157372_10030716 3300013307 Bacteria 5878
235 Ga0157372_10229527 3300013307 Bacteria 2152
236 Ga0157372_10286283 3300013307 Bacteria 1916
237 Ga0157372_10396066 3300013307 Bacteria 1609
238 Ga0157375_10190943 3300013308 Bacteria 2203
239 Ga0157375_10220032 3300013308 Bacteria 2057
240 Ga0157375_10534461 3300013308 Bacteria 1335
241 Ga0163163_10016520 3300014325 Bacteria 6863
242 Ga0163163_10022172 3300014325 Bacteria 6008
243 Ga0163163_10294508 3300014325 Bacteria 1675
244 Ga0157380_10020199 3300014326 Bacteria 4977
245 Ga0157380_10138950 3300014326 Bacteria 2084
246 Ga0157380_10219801 3300014326 Bacteria 1699
247 Ga0157377_10004605 3300014745 Bacteria 6374
248 Ga0157377_10011066 3300014745 Bacteria 4489
249 Ga0157377_10066468 3300014745 Bacteria 2073
250 Ga0157377_10110144 3300014745 Bacteria 1654
251 Ga0157379_10056521 3300014968 Bacteria 3506
252 Ga0157379_10402918 3300014968 Bacteria 1258
253 Ga0157376_10016665 3300014969 Bacteria 5585
254 Ga0157376_10143940 3300014969 Bacteria 2142
255 Ga0157376_10289412 3300014969 Bacteria 1546
256 Ga0163161_10026167 3300017792 Bacteria 4133
257 Ga0206353_10203068 3300020082 Bacteria 1509
258 Ga0207656_10045594 3300025321 Bacteria 1877
259 Ga0207653_10000002 3300025885 Bacteria 270513
260 Ga0207653_10011611 3300025885 Bacteria 2748
261 Ga0207682_10032941 3300025893 Bacteria 2084
262 Ga0207710_10000090 3300025900 Bacteria 121405
263 Ga0207688_10209045 3300025901 Bacteria 1172
264 Ga0207643_10002402 3300025908 Bacteria 10134
265 Ga0207643_10003044 3300025908 Bacteria 9011
266 Ga0207705_10082741 3300025909 Bacteria 2341
267 Ga0207684_10000123 3300025910 Bacteria 142518
268 Ga0207684_10000719 3300025910 Bacteria 38948
269 Ga0207684_10026250 3300025910 Bacteria 4966
270 Ga0207684_10242186 3300025910 Bacteria 1556
271 Ga0207707_10011292 3300025912 Bacteria 7773
272 Ga0207660_10089684 3300025917 Bacteria 2276
273 Ga0207660_10285518 3300025917 Bacteria 1311
274 Ga0207662_10086442 3300025918 Bacteria 1922
275 Ga0207657_10007888 3300025919 Bacteria 10860
276 Ga0207657_10291690 3300025919 Bacteria 1293
277 Ga0207657_10332133 3300025919 Bacteria 1200
278 Ga0207649_10133519 3300025920 Bacteria 1689
279 Ga0207652_10009179 3300025921 Bacteria 7960
280 Ga0207646_10001078 3300025922 Bacteria 34778
281 Ga0207646_10004643 3300025922 Bacteria 14826
282 Ga0207646_10013004 3300025922 Bacteria 7974
283 Ga0207646_10014304 3300025922 Bacteria 7541
284 Ga0207646_10067542 3300025922 Bacteria 3192
285 Ga0207646_10305384 3300025922 Bacteria 1437
286 Ga0207681_10004935 3300025923 Bacteria 8200
287 Ga0207694_10220037 3300025924 Bacteria 1548
288 Ga0207650_10051828 3300025925 Bacteria 3038
289 Ga0207650_10119563 3300025925 Bacteria 2049
290 Ga0207687_10126309 3300025927 Bacteria 1921
291 Ga0207690_10028434 3300025932 Bacteria 3544
292 Ga0207706_10006958 3300025933 Bacteria 10454
293 Ga0207706_10010330 3300025933 Bacteria 8533
294 Ga0207686_10096400 3300025934 Bacteria 1965
295 Ga0207686_10179187 3300025934 Bacteria 1502
296 Ga0207709_10219033 3300025935 Bacteria 1371
297 Ga0207670_10027221 3300025936 Bacteria 3613
298 Ga0207670_10034649 3300025936 Bacteria 3265
299 Ga0207669_10054532 3300025937 Bacteria 2415
300 Ga0207669_10159506 3300025937 Bacteria 1591
301 Ga0207669_10282445 3300025937 Bacteria 1253
302 Ga0207669_10304607 3300025937 Bacteria 1213
303 Ga0207704_10009446 3300025938 Bacteria 4706
304 Ga0207704_10016222 3300025938 Bacteria 3823
305 Ga0207704_10033386 3300025938 Bacteria 2925
306 Ga0207704_10076897 3300025938 Bacteria 2140
307 Ga0207691_10006210 3300025940 Bacteria 11542
308 Ga0207691_10027491 3300025940 Bacteria 5332
309 Ga0207711_10001782 3300025941 Bacteria 19720
310 Ga0207711_10120451 3300025941 Bacteria 2342
311 Ga0207711_10163729 3300025941 Bacteria 2015
312 Ga0207689_10021376 3300025942 Bacteria 5442
313 Ga0207661_10001125 3300025944 Bacteria 17839
314 Ga0207661_10021764 3300025944 Bacteria 4811
315 Ga0207661_10031093 3300025944 Bacteria 4119
316 Ga0207661_10040270 3300025944 Bacteria 3672
317 Ga0207661_10056243 3300025944 Bacteria 3158
318 Ga0207679_10057331 3300025945 Bacteria 2881
319 Ga0207679_10082257 3300025945 Bacteria 2465
320 Ga0207679_10441810 3300025945 Bacteria 1152
321 Ga0207712_10000073 3300025961 Bacteria 123046
322 Ga0207712_10028052 3300025961 Bacteria 3764
323 Ga0207668_10348017 3300025972 Bacteria 1238
324 Ga0207640_10176849 3300025981 Bacteria 1596
325 Ga0207640_10271156 3300025981 Bacteria 1328
326 Ga0207658_10000304 3300025986 Bacteria 50815
327 Ga0207677_10132556 3300026023 Bacteria 1895
328 Ga0207639_10021519 3300026041 Bacteria 4633
329 Ga0207639_10138363 3300026041 Bacteria 2026
330 Ga0207678_10131546 3300026067 Bacteria 2135
331 Ga0207678_10410105 3300026067 Bacteria 1174
332 Ga0207678_10416634 3300026067 Bacteria 1164
333 Ga0207708_10027162 3300026075 Bacteria 4334
334 Ga0207708_10055458 3300026075 Bacteria 3022
335 Ga0207708_10065768 3300026075 Bacteria 2772
336 Ga0207641_10002712 3300026088 Bacteria 16154
337 Ga0207648_10307536 3300026089 Bacteria 1422
338 Ga0207648_10383828 3300026089 Bacteria 1270
339 Ga0207676_10103957 3300026095 Bacteria 2361
340 Ga0207676_10239336 3300026095 Bacteria 1627
341 Ga0207676_10250290 3300026095 Bacteria 1595
342 Ga0207674_10017694 3300026116 Bacteria 7767
343 Ga0207674_10049206 3300026116 Bacteria 4313
344 Ga0207674_10225020 3300026116 Bacteria 1825
345 Ga0207675_100128542 3300026118 Bacteria 2401
346 Ga0207683_10036927 3300026121 Bacteria 4255
347 Ga0207683_10339380 3300026121 Bacteria 1378
348 Ga0207428_10001384 3300027907 Bacteria 25610
349 Ga0207428_10016322 3300027907 Bacteria 6389
350 Ga0207428_10016704 3300027907 Bacteria 6313
351 Ga0207428_10017721 3300027907 Bacteria 6108
352 Ga0207428_10090111 3300027907 Bacteria 2383
353 Ga0207428_10130311 3300027907 Bacteria 1925
354 Ga0207428_10358519 3300027907 Bacteria 1072
355 Ga0268266_10024295 3300028379 Bacteria 5156
356 Ga0268266_10052955 3300028379 Bacteria 3486
357 Ga0268266_10064582 3300028379 Bacteria 3163
358 Ga0268265_10000063 3300028380 Bacteria 144643
359 Ga0268264_10000007 3300028381 Bacteria 815790
360 Ga0268264_10599788 3300028381 Bacteria 1085
361 Ga0265318_10003903 3300028577 Bacteria 7350
362 Ga0307517_10006154 3300028786 Bacteria 17876
363 Ga0265340_10004866 3300031247 Bacteria 7472
364 Ga0307408_100045751 3300031548 Bacteria 3127
365 Ga0307408_100186694 3300031548 Bacteria 1667
366 Ga0265313_10092278 3300031595 Bacteria 1357
367 Ga0307516_10077158 3300031730 Bacteria 3181
368 Ga0307405_10310394 3300031731 Bacteria 1200
369 Ga0316577_10042739 3300031733 Bacteria 2536
370 Ga0307413_10056970 3300031824 Bacteria 2387
371 Ga0307410_10055555 3300031852 Bacteria 2688
372 Ga0307407_10001467 3300031903 Bacteria 8566
373 Ga0307407_10071687 3300031903 Bacteria 2064
374 Ga0307409_100006706 3300031995 Bacteria 6806
375 Ga0307409_100016273 3300031995 Bacteria 4915
376 Ga0307409_100022433 3300031995 Bacteria 4353
377 Ga0307416_100008877 3300032002 Bacteria 6527
378 Ga0307416_100012858 3300032002 Bacteria 5662
379 Ga0307416_100055962 3300032002 Bacteria 3179
380 Ga0307416_100107946 3300032002 Bacteria 2444
381 Ga0307416_100763774 3300032002 Bacteria 1060
382 Ga0307411_10070137 3300032005 Bacteria 2370
383 Ga0307411_10102994 3300032005 Bacteria 2024
384 Ga0307415_100000487 3300032126 Bacteria 17179
385 Ga0307415_100179380 3300032126 Bacteria 1660
386 Ga0307507_10068637 3300033179 Bacteria 3233
387 Ga0373938_0004087 3300034957 Bacteria 2417
388 Ga0373949_0008685 3300035090 Bacteria 2224
389 Ga0373961_0010877 3300035241 Bacteria 2251
390 Ga0316574_0045733 3300035398 Bacteria 2712
391 Ga0373931_0047664 3300035691 Bacteria 2268
392 Ga0373947_0035382 3300035725 Bacteria 2957
393 Ga0316582_0123431 3300036647 Bacteria 1735
394 Ga0316584_0388287 3300036712 Bacteria 996
395 Ga0395900_0025018 3300037418 Bacteria 6110
396 Ga0395900_0040683 3300037418 Bacteria 4791
397 Ga0395900_0058317 3300037418 Bacteria 3974
398 Ga0395898_0066534 3300037466 Bacteria 3491
399 Ga0395898_0074245 3300037466 Bacteria 3285
400 Ga0395898_0087111 3300037466 Bacteria 3009
401 Ga0395898_0342731 3300037466 Bacteria 1425
402 Ga0395905_0014326 3300037471 Bacteria 7578
403 Ga0395901_0010640 3300038443 Bacteria 9322
404 Ga0395901_0042421 3300038443 Bacteria 4716
405 Ga0395901_0062134 3300038443 Bacteria 3887
406 Ga0395901_0340947 3300038443 Bacteria 1548
407 Ga0395901_0710202 3300038443 Bacteria 1002
408 Ga0436365_1832907 3300039437 Bacteria 1204
409 Ga0439448_0044944 3300042005 Bacteria 1437
410 Ga0439455_0014094 3300042012 Bacteria 1821
411 Ga0450920_021167 3300042122 Bacteria 1256
412 Ga0450918_032348 3300042531 Bacteria 926
413 Ga0451577_0088598 3300042876 Bacteria 2761
414 Ga0451577_0271988 3300042876 Bacteria 1535
415 Ga0466969_0020309 3300044656 Bacteria 3442
416 Ga0453683_0046228 3300044673 Bacteria 2729
417 Ga0453683_0208104 3300044673 Bacteria 1242
418 Ga0466965_0002659 3300044683 Bacteria 7644
419 Ga0466966_0064522 3300044684 Bacteria 2305
420 Ga0466961_0005395 3300044693 Bacteria 8050
421 Ga0466963_0010922 3300044694 Bacteria 5516
422 Ga0466963_0075809 3300044694 Bacteria 2270
423 Ga0466959_0095828 3300045049 Bacteria 2128
424 Ga0466959_0209948 3300045049 Bacteria 1353
425 Ga0466959_0333695 3300045049 Bacteria 1035
426 Ga0451576_0103516 3300045051 Bacteria 2961
427 Ga0451576_0561138 3300045051 Bacteria 1200
428 Ga0466967_0440987 3300045976 Bacteria 1272
429 Ga0495592_0007648 3300046454 Bacteria 8091
430 Ga0495603_0004312 3300046455 Bacteria 8479
431 Ga0495603_0057914 3300046455 Bacteria 2292
432 Ga0495629_0011012 3300046459 Bacteria 6568
433 Ga0495651_0255997 3300046462 Bacteria 1193
434 Ga0495584_0022941 3300046491 Bacteria 3167
435 Ga0495594_0109848 3300046499 Bacteria 1555
436 Ga0495628_0020570 3300046516 Bacteria 5441
437 Ga0495630_0101066 3300046517 Bacteria 2182
438 Ga0495630_0127627 3300046517 Bacteria 1930
439 Ga0495643_0003620 3300046522 Bacteria 11229
440 Ga0495652_0093947 3300046529 Bacteria 2447
441 Ga0495640_0014259 3300046533 Bacteria 6020
442 Ga0495586_0018676 3300046535 Bacteria 3691
443 Ga0495667_0060784 3300046559 Bacteria 2478
444 Ga0495656_0116562 3300046615 Bacteria 1256
445 Ga0495634_0029897 3300046642 Bacteria 3767
446 Ga0495657_0057653 3300046675 Bacteria 2581
447 Ga0495623_0126161 3300046679 Bacteria 1537
448 Ga0495658_0299497 3300046683 Bacteria 1017
449 Ga0495613_0006524 3300046689 Bacteria 8721
450 Ga0495600_0059870 3300046809 Bacteria 2487
451 Ga0495604_0154249 3300047317 Bacteria 1628
452 Ga0495672_0188579 3300047320 Bacteria 1039
453 Ga0495676_0012176 3300047321 Bacteria 7759
454 Ga0496100_0001681 3300048903 Bacteria 10989
455 Ga0496101_0009234 3300048904 Bacteria 6476
456 Ga0496101_0029115 3300048904 Bacteria 3862
457 Ga0496102_0000168 3300048905 Bacteria 88511
458 Ga0496102_0090308 3300048905 Bacteria 2835
459 Ga0496103_0001295 3300048906 Bacteria 17036
460 Ga0496103_0095755 3300048906 Bacteria 1876
461 Ga0496103_0131598 3300048906 Bacteria 1598
462 Ga0496103_0210115 3300048906 Bacteria 1252
463 Ga0496104_0063553 3300048907 Bacteria 3501
464 Ga0496104_0077602 3300048907 Bacteria 3165
465 Ga0496104_0090820 3300048907 Bacteria 2919
466 Ga0496104_0155297 3300048907 Bacteria 2196
467 Ga0496105_0094183 3300048908 Bacteria 2473
468 Ga0496105_0106538 3300048908 Bacteria 2314
469 Ga0496105_0129252 3300048908 Bacteria 2083
470 Ga0496105_0238056 3300048908 Bacteria 1478
471 Ga0496106_0311010 3300048909 Bacteria 1264
472 Ga0496107_0014371 3300048910 Bacteria 5544
473 Ga0496107_0084466 3300048910 Bacteria 2316
474 Ga0496107_0321292 3300048910 Bacteria 1152
475 Ga0496108_0024298 3300048911 Bacteria 4989
476 Ga0496108_0027080 3300048911 Bacteria 4729
477 Ga0496108_0052311 3300048911 Bacteria 3422
478 Ga0496109_0001959 3300048912 Bacteria 17072
479 Ga0496109_0007847 3300048912 Bacteria 9041
480 Ga0496109_0028942 3300048912 Bacteria 4960
481 Ga0496109_0084188 3300048912 Bacteria 2933
482 Ga0496109_0115461 3300048912 Bacteria 2498
483 Ga0496109_0164383 3300048912 Bacteria 2080
484 Ga0496109_0478895 3300048912 Bacteria 1175
485 Ga0496110_0044813 3300048913 Bacteria 3864
486 Ga0496110_0056645 3300048913 Bacteria 3449
487 Ga0496110_0066584 3300048913 Bacteria 3186
488 Ga0496110_0272659 3300048913 Bacteria 1540
489 Ga0496111_0001600 3300048914 Bacteria 13106
490 Ga0496111_0028101 3300048914 Bacteria 3984
491 Ga0496111_0085639 3300048914 Bacteria 2304
492 Ga0496112_0097395 3300048915 Bacteria 2912
493 Ga0496112_0147044 3300048915 Bacteria 2325
494 Ga0496113_0011873 3300048916 Bacteria 5837
495 Ga0496113_0048743 3300048916 Bacteria 3153
496 Ga0496113_0080650 3300048916 Bacteria 2493
497 Ga0496113_0100796 3300048916 Bacteria 2238
498 Ga0496114_0065968 3300048917 Bacteria 3034
499 Ga0496114_0113616 3300048917 Bacteria 2322
500 Ga0496114_0552400 3300048917 Bacteria 1017
501 Ga0496116_0004714 3300048919 Bacteria 12879
502 Ga0496117_0000869 3300048920 Bacteria 46596
503 Ga0496118_0000171 3300048921 Bacteria 117495
504 Ga0496119_0001640 3300048922 Bacteria 26356
505 Ga0496120_0009191 3300048923 Bacteria 7043
506 Ga0496121_0001811 3300048924 Bacteria 34525
507 Ga0496124_0005252 3300048927 Bacteria 14656
508 Ga0496125_0014526 3300048928 Bacteria 7665
509 Ga0496126_0003790 3300048929 Bacteria 18766
510 Ga0501031_0023815 3300049568 Bacteria 3991
511 Ga0501032_0057010 3300049569 Bacteria 2625
512 Ga0501033_0097073 3300049570 Bacteria 2153
513 Ga0501034_0208914 3300049571 Bacteria 1908
514 Ga0501034_0560503 3300049571 Bacteria 1051
515 Ga0501036_0028252 3300049572 Bacteria 4741
516 Ga0501036_0055385 3300049572 Bacteria 3359
517 Ga0501036_0227539 3300049572 Bacteria 1565
518 Ga0501038_0119428 3300049574 Bacteria 2176
519 Ga0501038_0150274 3300049574 Bacteria 1899
520 Ga0501039_0218091 3300049575 Bacteria 1500
521 Ga0501040_0007084 3300049576 Bacteria 7267
522 Ga0501040_0081660 3300049576 Bacteria 2240
523 Ga0501040_0082450 3300049576 Bacteria 2229
524 Ga0501040_0085161 3300049576 Bacteria 2194
525 Ga0501040_0093306 3300049576 Bacteria 2093
526 Ga0501041_0027133 3300049577 Bacteria 3450
527 Ga0501041_0086943 3300049577 Bacteria 1929
528 Ga0501041_0141572 3300049577 Bacteria 1500
529 Ga0501042_0044630 3300049578 Bacteria 3158
530 Ga0501042_0059244 3300049578 Bacteria 2734
531 Ga0501043_0510547 3300049579 Bacteria 897
532 Ga0501046_0043089 3300049580 Bacteria 3595
533 Ga0501046_0094225 3300049580 Bacteria 2301
534 Ga0501046_0295658 3300049580 Bacteria 1184
535 Ga0501048_0024987 3300049582 Bacteria 4357
536 Ga0501067_0039309 3300049583 Bacteria 2627
537 Ga0501068_0012158 3300049584 Bacteria 4867
538 Ga0501068_0035686 3300049584 Bacteria 2969
539 Ga0501068_0038196 3300049584 Bacteria 2876
540 Ga0501068_0054485 3300049584 Bacteria 2423
541 Ga0501068_0075736 3300049584 Bacteria 2059
542 Ga0501068_0165627 3300049584 Bacteria 1394
543 Ga0501068_0268031 3300049584 Bacteria 1090
544 Ga0501069_0007347 3300049585 Bacteria 5782
545 Ga0501069_0110857 3300049585 Bacteria 1562
546 Ga0501069_0122240 3300049585 Bacteria 1487
547 Ga0501069_0252584 3300049585 Bacteria 1029
548 Ga0501070_0015520 3300049586 Bacteria 6407
549 Ga0501070_0016065 3300049586 Bacteria 6292
550 Ga0501070_0117126 3300049586 Bacteria 2200
551 Ga0501070_0443104 3300049586 Bacteria 1047
552 Ga0501071_0000382 3300049587 Bacteria 21816
553 Ga0501071_0037209 3300049587 Bacteria 3473
554 Ga0501071_0249926 3300049587 Bacteria 1338
555 Ga0501071_0253879 3300049587 Bacteria 1327
556 Ga0501071_0310964 3300049587 Bacteria 1195
557 Ga0501072_0003202 3300049588 Bacteria 12296
558 Ga0501072_0026764 3300049588 Bacteria 4498
559 Ga0501072_0029611 3300049588 Bacteria 4278
560 Ga0501072_0052549 3300049588 Bacteria 3208
561 Ga0501072_0216728 3300049588 Bacteria 1525
562 Ga0501073_0108998 3300049589 Bacteria 1921
563 Ga0501074_0024505 3300049590 Bacteria 4385
564 Ga0501074_0123544 3300049590 Bacteria 1851
565 Ga0501075_0006696 3300049591 Bacteria 7947
566 Ga0501075_0091542 3300049591 Bacteria 2308
567 Ga0501075_0108299 3300049591 Bacteria 2112
568 Ga0501075_0120461 3300049591 Bacteria 1997
569 Ga0501075_0131269 3300049591 Bacteria 1908
570 Ga0501075_0350480 3300049591 Bacteria 1125
571 Ga0501076_0015794 3300049592 Bacteria 5710
572 Ga0501076_0017615 3300049592 Bacteria 5430
573 Ga0501076_0024973 3300049592 Bacteria 4622
574 Ga0501076_0066044 3300049592 Bacteria 2886
575 Ga0501076_0120032 3300049592 Bacteria 2129
576 Ga0501077_0000785 3300049593 Bacteria 19174
577 Ga0501077_0020741 3300049593 Bacteria 4160
578 Ga0501077_0033815 3300049593 Bacteria 3254
579 Ga0501077_0049799 3300049593 Bacteria 2662
580 Ga0501077_0105079 3300049593 Bacteria 1790
581 Ga0501077_0169532 3300049593 Bacteria 1387
582 Ga0501079_0003245 3300049741 Bacteria 11913
583 Ga0501079_0014221 3300049741 Bacteria 6067
584 Ga0501079_0018997 3300049741 Bacteria 5250
585 Ga0501079_0153420 3300049741 Bacteria 1795
586 Ga0501080_0014256 3300049742 Bacteria 7319
587 Ga0501080_0128837 3300049742 Bacteria 2343
588 Ga0501081_0019586 3300049743 Bacteria 4506
589 Ga0501081_0136815 3300049743 Bacteria 1754
590 Ga0501081_0263156 3300049743 Bacteria 1261
591 Ga0501083_0014569 3300049744 Bacteria 5496
592 Ga0501083_0073311 3300049744 Bacteria 2276
593 Ga0501035_0017729 3300049822 Bacteria 6567
594 Ga0501044_0174913 3300049823 Bacteria 2116
595 Ga0501045_0014671 3300049824 Bacteria 5555
596 Ga0501045_0089252 3300049824 Bacteria 2277
597 nmdc:mga00v17_10207_c1 3300050491 Bacteria 5119
598 nmdc:mga00v17_62400_c1 3300050491 Bacteria 2293
599 nmdc:mga00v17_8334_c1 3300050491 Bacteria 5577
600 nmdc:mga0yw44_12339_c1 3300050492 Bacteria 4449
601 nmdc:mga0yw44_136666_c1 3300050492 Bacteria 1591
602 nmdc:mga0yw44_262456_c1 3300050492 Bacteria 1151
603 nmdc:mga0yw44_270833_c1 3300050492 Bacteria 1133
604 nmdc:mga0yw44_377235_c1 3300050492 Bacteria 957
605 nmdc:mga0yw44_63635_c1 3300050492 Bacteria 2269
606 nmdc:mga05p37_104764_c1 3300050507 Bacteria 3480
607 nmdc:mga05p37_113374_c1 3300050507 Bacteria 3333
608 nmdc:mga05p37_17164_c1 3300050507 Bacteria 8733
609 nmdc:mga05p37_65845_c1 3300050507 Bacteria 4458
610 nmdc:mga09592_18175_c1 3300050508 Bacteria 5765
611 nmdc:mga09592_34185_c1 3300050508 Bacteria 4250
612 nmdc:mga0qj67_11555_c1 3300050509 Bacteria 6620
613 nmdc:mga0qj67_35662_c1 3300050509 Bacteria 3890
614 nmdc:mga0qj67_424500_c1 3300050509 Bacteria 1072
615 nmdc:mga06r32_19086_c1 3300050510 Bacteria 6289
616 nmdc:mga06r32_32232_c1 3300050510 Bacteria 4928
617 nmdc:mga08y16_128643_c1 3300050511 Bacteria 2634
618 nmdc:mga08y16_212283_c1 3300050511 Bacteria 2005
619 nmdc:mga08y16_219922_c1 3300050511 Bacteria 1966
620 nmdc:mga08y16_31676_c1 3300050511 Bacteria 5560
621 nmdc:mga08y16_36530_c1 3300050511 Bacteria 5160
622 nmdc:mga08y16_39510_c1 3300050511 Bacteria 4951
623 nmdc:mga08y16_399564_c1 3300050511 Bacteria 1407
624 nmdc:mga08y16_452758_c1 3300050511 Bacteria 1309
625 nmdc:mga08y16_497446_c1 3300050511 Bacteria 1239
626 nmdc:mga08y16_579239_c1 3300050511 Bacteria 1133
627 nmdc:mga08y16_63711_c1 3300050511 Bacteria 3850
628 nmdc:mga0n895_40407_c1 3300050512 Bacteria 4530
629 nmdc:mga0a205_41990_c1 3300050515 Bacteria 4406
630 nmdc:mga0a205_78412_c1 3300050515 Bacteria 3191
631 Ga0495601_0068332 3300053077 Bacteria 2265
632 Ga0495595_0109673 3300053084 Bacteria 1337
633 Ga0501084_0032323 3300054114 Bacteria 4377
634 Ga0501084_0052842 3300054114 Bacteria 3398
635 Ga0501084_0200221 3300054114 Bacteria 1685
636 Ga0501084_0475192 3300054114 Bacteria 1056
637 Ga0501082_0045179 3300060353 Bacteria 3799
638 Ga0501082_0076208 3300060353 Bacteria 2891
639 Ga0530510_0003518 3300061734 Bacteria 10774
640 Ga0530510_0009018 3300061734 Bacteria 6993
641 Ga0530510_0014205 3300061734 Bacteria 5613
642 Ga0530510_0015904 3300061734 Bacteria 5319
643 Ga0530510_0034974 3300061734 Bacteria 3620
644 Ga0530510_0319845 3300061734 Bacteria 1163
645 2643946801 2643221587 Bacteria 7586415
646 2644035091 2643221604 Bacteria 5014917
647 2644101233 2643221617 Bacteria 5139111
648 2644119361 2643221620 Bacteria 5134593
649 2644434982 2643221677 Bacteria 7584031
650 2738868839 2738541305 Bacteria 4910150
651 2812330384 2811994874 Bacteria 5367947
652 2990090877 2990088156 Bacteria 6657676
653 Ga0070696_100006955
654 Ga0006562J51391_1063616
655 Ga0006562J51391_1063617
656 Ga0070658_10388672
657 Ga0070658_10427670
658 Ga0070683_100012996
659 Ga0070683_100026737
660 Ga0070683_100319035
661 Ga0070690_100241382
662 Ga0070670_100003070
663 Ga0068869_100035504
664 Ga0068869_100368701
665 Ga0070680_100019045
666 Ga0070680_100039707
667 Ga0070680_100502055
668 Ga0070682_100007811
669 Ga0070682_100041855
670 Ga0070682_100112440
671 Ga0070682_100270811
672 Ga0068868_100105316
673 Ga0068868_100390239
674 Ga0070660_100100005
675 Ga0070660_100106823
676 Ga0070660_100129725
677 Ga0070660_100145730
678 Ga0070689_100029332
679 Ga0070689_100049291
680 Ga0070689_100246986
681 Ga0070691_10054668
682 Ga0070661_100066494
683 Ga0070661_100160859
684 Ga0070668_100314827
685 Ga0070669_100001465
686 Ga0070669_100383528
687 Ga0070675_100024824
688 Ga0070675_100113770
689 Ga0070674_100054242
690 Ga0070673_100401269
691 Ga0070688_100030225
692 Ga0070688_100046866
693 Ga0070659_100023753
694 Ga0070659_100048605
695 Ga0070667_100000073
696 Ga0070667_100254170
697 Ga0070703_10000005
698 Ga0070701_10019585
699 Ga0070701_10045173
700 Ga0070705_100002139
701 Ga0070705_100019005
702 Ga0070705_100036662
703 Ga0070705_100303794
704 Ga0070700_100032415
705 Ga0070708_100000794
706 Ga0070708_100001587
707 Ga0070708_100007817
708 Ga0070708_100087401
709 Ga0070663_100092621
710 Ga0070678_100385611
711 Ga0070678_100401397
712 Ga0070662_100025389
713 Ga0070662_100027410
714 Ga0070681_10029688
715 Ga0068867_100073133
716 Ga0070685_10045429
717 Ga0070685_10059075
718 Ga0070685_10154461
719 Ga0070706_100002481
720 Ga0070706_100003465
721 Ga0070706_100005224
722 Ga0070706_100044163
723 Ga0070706_100069240
724 Ga0070707_100000985
725 Ga0070707_100009666
726 Ga0070707_100014256
727 Ga0070707_100023767
728 Ga0070707_100044237
729 Ga0070707_100116058
730 Ga0070698_100004585
731 Ga0070698_100005445
732 Ga0070698_100070030
733 Ga0070698_100101429
734 Ga0070699_100005041
735 Ga0070699_100020854
736 Ga0070699_100062287
737 Ga0070699_100077922
738 Ga0070699_100237556
739 Ga0070679_100009090
740 Ga0070679_100108700
741 Ga0070679_100228232
742 Ga0070684_100007890
743 Ga0070684_100031032
744 Ga0070684_100153169
745 Ga0070697_100057613
746 Ga0070697_100161403
747 Ga0070697_100185770
748 Ga0068853_100014718
749 Ga0070686_100034595
750 Ga0070695_100059320
751 Ga0070695_100089441
752 Ga0070696_100076913
753 Ga0070696_100086327
754 Ga0070665_100011077
755 Ga0070665_100248305
756 Ga0070704_100016930
757 Ga0070704_100092243
758 Ga0068855_100432428
759 Ga0070664_100097256
760 Ga0070664_100202820
761 Ga0070664_100444618
762 Ga0068857_100019198
763 Ga0068857_100217515
764 Ga0068854_100074264
765 Ga0068854_100118671
766 Ga0068854_100181423
767 Ga0068854_100357695
768 Ga0070702_100129533
769 Ga0070702_100307198
770 Ga0068852_100506793
771 Ga0068859_100001171
772 Ga0068859_100257075
773 Ga0068864_100008550
774 Ga0068864_100058644
775 Ga0068866_10168150
776 Ga0068861_100272165
777 Ga0068861_100393077
778 Ga0068870_10004899
779 Ga0068870_10229108
780 Ga0068863_100000644
781 Ga0068863_100601947
782 Ga0068858_100074569
783 Ga0068860_100000127
784 Ga0068862_100000052
785 Ga0081455_10001178
786 Ga0081455_10018092
787 Ga0081455_10053793
788 Ga0081455_10313405
789 Ga0081538_10000466
790 Ga0081539_10000936
791 Ga0081539_10002707
792 Ga0081539_10002844
793 Ga0075365_10003559
794 Ga0075365_10008137
795 Ga0075365_10018960
796 Ga0075365_10067078
797 Ga0075365_10076333
798 Ga0075365_10103741
799 Ga0075365_10307526
800 Ga0075363_100012276
801 Ga0075364_10011464
802 Ga0075364_10089499
803 Ga0075432_10005941
804 Ga0075432_10017905
805 Ga0070712_100167542
806 Ga0075370_10156803
807 Ga0075428_100001830
808 Ga0075428_100082203
809 Ga0075428_100096829
810 Ga0075428_100417110
811 Ga0075428_100419204
812 Ga0075428_100422053
813 Ga0075430_100029156
814 Ga0075430_100034523
815 Ga0075430_100035869
816 Ga0075430_100065840
817 Ga0075431_100042147
818 Ga0075431_100080068
819 Ga0075431_100143475
820 Ga0075431_100300930
821 Ga0075433_10082713
822 Ga0075434_100146464
823 Ga0075429_100004464
824 Ga0075429_100096330
825 Ga0075429_100230966
826 Ga0075429_100281804
827 Ga0068865_100003111
828 Ga0068865_100009066
829 Ga0097620_100001171
830 Ga0097620_100257070
831 Ga0111539_10013826
832 Ga0111539_10043995
833 Ga0111539_10130526
834 Ga0111539_10165303
835 Ga0111539_10257867
836 Ga0111539_10521416
837 Ga0111539_10552783
838 Ga0105245_10032238
839 Ga0105247_10000066
840 Ga0114129_10002538
841 Ga0114129_10003660
842 Ga0114129_10034320
843 Ga0114129_10116895
844 Ga0114129_10152182
845 Ga0114129_10200089
846 Ga0114129_10289762
847 Ga0105243_10012002
848 Ga0105243_10033694
849 Ga0105243_10303397
850 Ga0105243_10314805
851 Ga0105243_10486377
852 Ga0105242_10030369
853 Ga0105242_10044490
854 Ga0105242_10167509
855 Ga0105248_10000144
856 Ga0105248_10050668
857 Ga0105248_10221935
858 Ga0105238_10168916
859 Ga0105249_10000093
860 Ga0105249_10479478
861 Ga0105249_10617341
862 Ga0105239_10068923
863 Ga0105239_10085718
864 Ga0105239_10447102
865 Ga0105239_10692172
866 Ga0105239_10890235
867 Ga0105246_10016159
868 Ga0105246_10230780
869 Ga0105246_10261754
870 Ga0105246_10422880
871 Ga0157338_1000639
872 Ga0157373_10110375
873 Ga0157371_10030479
874 Ga0157371_10079958
875 Ga0157370_10092661
876 Ga0157369_10005945
877 Ga0157369_10227643
878 Ga0157374_10360490
879 Ga0157378_10095222
880 Ga0157378_10177749
881 Ga0157378_10450411
882 Ga0163162_10190128
883 Ga0163162_10201907
884 Ga0163162_10395747
885 Ga0163162_10457537
886 Ga0157372_10030716
887 Ga0157372_10229527
888 Ga0157372_10286283
889 Ga0157372_10396066
890 Ga0157375_10190943
891 Ga0157375_10220032
892 Ga0157375_10534461
893 Ga0163163_10016520
894 Ga0163163_10022172
895 Ga0163163_10294508
896 Ga0157380_10020199
897 Ga0157380_10138950
898 Ga0157380_10219801
899 Ga0157377_10004605
900 Ga0157377_10011066
901 Ga0157377_10066468
902 Ga0157377_10110144
903 Ga0157379_10056521
904 Ga0157379_10402918
905 Ga0157376_10016665
906 Ga0157376_10143940
907 Ga0157376_10289412
908 Ga0163161_10026167
909 Ga0206353_10203068
910 Ga0207656_10045594
911 Ga0207653_10000002
912 Ga0207653_10011611
913 Ga0207682_10032941
914 Ga0207710_10000090
915 Ga0207688_10209045
916 Ga0207643_10002402
917 Ga0207643_10003044
918 Ga0207705_10082741
919 Ga0207684_10000123
920 Ga0207684_10000719
921 Ga0207684_10026250
922 Ga0207684_10242186
923 Ga0207707_10011292
924 Ga0207660_10089684
925 Ga0207660_10285518
926 Ga0207662_10086442
927 Ga0207657_10007888
928 Ga0207657_10291690
929 Ga0207657_10332133
930 Ga0207649_10133519
931 Ga0207652_10009179
932 Ga0207646_10001078
933 Ga0207646_10004643
934 Ga0207646_10013004
935 Ga0207646_10014304
936 Ga0207646_10067542
937 Ga0207646_10305384
938 Ga0207681_10004935
939 Ga0207694_10220037
940 Ga0207650_10051828
941 Ga0207650_10119563
942 Ga0207687_10126309
943 Ga0207690_10028434
944 Ga0207706_10006958
945 Ga0207706_10010330
946 Ga0207686_10096400
947 Ga0207686_10179187
948 Ga0207709_10219033
949 Ga0207670_10027221
950 Ga0207670_10034649
951 Ga0207669_10054532
952 Ga0207669_10159506
953 Ga0207669_10282445
954 Ga0207669_10304607
955 Ga0207704_10009446
956 Ga0207704_10016222
957 Ga0207704_10033386
958 Ga0207704_10076897
959 Ga0207691_10006210
960 Ga0207691_10027491
961 Ga0207711_10001782
962 Ga0207711_10120451
963 Ga0207711_10163729
964 Ga0207689_10021376
965 Ga0207661_10001125
966 Ga0207661_10021764
967 Ga0207661_10031093
968 Ga0207661_10040270
969 Ga0207661_10056243
970 Ga0207679_10057331
971 Ga0207679_10082257
972 Ga0207679_10441810
973 Ga0207712_10000073
974 Ga0207712_10028052
975 Ga0207668_10348017
976 Ga0207640_10176849
977 Ga0207640_10271156
978 Ga0207658_10000304
979 Ga0207677_10132556
980 Ga0207639_10021519
981 Ga0207639_10138363
982 Ga0207678_10131546
983 Ga0207678_10410105
984 Ga0207678_10416634
985 Ga0207708_10027162
986 Ga0207708_10055458
987 Ga0207708_10065768
988 Ga0207641_10002712
989 Ga0207648_10307536
990 Ga0207648_10383828
991 Ga0207676_10103957
992 Ga0207676_10239336
993 Ga0207676_10250290
994 Ga0207674_10017694
995 Ga0207674_10049206
996 Ga0207674_10225020
997 Ga0207675_100128542
998 Ga0207683_10036927
999 Ga0207683_10339380
1000 Ga0207428_10001384
1001 Ga0207428_10016322
1002 Ga0207428_10016704
1003 Ga0207428_10017721
1004 Ga0207428_10090111
1005 Ga0207428_10130311
1006 Ga0207428_10358519
1007 Ga0268266_10024295
1008 Ga0268266_10052955
1009 Ga0268266_10064582
1010 Ga0268265_10000063
1011 Ga0268264_10000007
1012 Ga0268264_10599788
1013 Ga0265318_10003903
1014 Ga0307517_10006154
1015 Ga0265340_10004866
1016 Ga0307408_100045751
1017 Ga0307408_100186694
1018 Ga0265313_10092278
1019 Ga0307516_10077158
1020 Ga0307405_10310394
1021 Ga0316577_10042739
1022 Ga0307413_10056970
1023 Ga0307410_10055555
1024 Ga0307407_10001467
1025 Ga0307407_10071687
1026 Ga0307409_100006706
1027 Ga0307409_100016273
1028 Ga0307409_100022433
1029 Ga0307416_100008877
1030 Ga0307416_100012858
1031 Ga0307416_100055962
1032 Ga0307416_100107946
1033 Ga0307416_100763774
1034 Ga0307411_10070137
1035 Ga0307411_10102994
1036 Ga0307415_100000487
1037 Ga0307415_100179380
1038 Ga0307507_10068637
1039 Ga0373938_0004087
1040 Ga0373949_0008685
1041 Ga0373961_0010877
1042 Ga0316574_0045733
1043 Ga0373931_0047664
1044 Ga0373947_0035382
1045 Ga0316582_0123431
1046 Ga0316584_0388287
1047 Ga0395900_0025018
1048 Ga0395900_0040683
1049 Ga0395900_0058317
1050 Ga0395898_0066534
1051 Ga0395898_0074245
1052 Ga0395898_0087111
1053 Ga0395898_0342731
1054 Ga0395905_0014326
1055 Ga0395901_0010640
1056 Ga0395901_0042421
1057 Ga0395901_0062134
1058 Ga0395901_0340947
1059 Ga0395901_0710202
1060 Ga0436365_1832907
1061 Ga0439448_0044944
1062 Ga0439455_0014094
1063 Ga0450920_021167
1064 Ga0450918_032348
1065 Ga0451577_0088598
1066 Ga0451577_0271988
1067 Ga0466969_0020309
1068 Ga0453683_0046228
1069 Ga0453683_0208104
1070 Ga0466965_0002659
1071 Ga0466966_0064522
1072 Ga0466961_0005395
1073 Ga0466963_0010922
1074 Ga0466963_0075809
1075 Ga0466959_0095828
1076 Ga0466959_0209948
1077 Ga0466959_0333695
1078 Ga0451576_0103516
1079 Ga0451576_0561138
1080 Ga0466967_0440987
1081 Ga0495592_0007648
1082 Ga0495603_0004312
1083 Ga0495603_0057914
1084 Ga0495629_0011012
1085 Ga0495651_0255997
1086 Ga0495584_0022941
1087 Ga0495594_0109848
1088 Ga0495628_0020570
1089 Ga0495630_0101066
1090 Ga0495630_0127627
1091 Ga0495643_0003620
1092 Ga0495652_0093947
1093 Ga0495640_0014259
1094 Ga0495586_0018676
1095 Ga0495667_0060784
1096 Ga0495656_0116562
1097 Ga0495634_0029897
1098 Ga0495657_0057653
1099 Ga0495623_0126161
1100 Ga0495658_0299497
1101 Ga0495613_0006524
1102 Ga0495600_0059870
1103 Ga0495604_0154249
1104 Ga0495672_0188579
1105 Ga0495676_0012176
1106 Ga0496100_0001681
1107 Ga0496101_0009234
1108 Ga0496101_0029115
1109 Ga0496102_0000168
1110 Ga0496102_0090308
1111 Ga0496103_0001295
1112 Ga0496103_0095755
1113 Ga0496103_0131598
1114 Ga0496103_0210115
1115 Ga0496104_0063553
1116 Ga0496104_0077602
1117 Ga0496104_0090820
1118 Ga0496104_0155297
1119 Ga0496105_0094183
1120 Ga0496105_0106538
1121 Ga0496105_0129252
1122 Ga0496105_0238056
1123 Ga0496106_0311010
1124 Ga0496107_0014371
1125 Ga0496107_0084466
1126 Ga0496107_0321292
1127 Ga0496108_0024298
1128 Ga0496108_0027080
1129 Ga0496108_0052311
1130 Ga0496109_0001959
1131 Ga0496109_0007847
1132 Ga0496109_0028942
1133 Ga0496109_0084188
1134 Ga0496109_0115461
1135 Ga0496109_0164383
1136 Ga0496109_0478895
1137 Ga0496110_0044813
1138 Ga0496110_0056645
1139 Ga0496110_0066584
1140 Ga0496110_0272659
1141 Ga0496111_0001600
1142 Ga0496111_0028101
1143 Ga0496111_0085639
1144 Ga0496112_0097395
1145 Ga0496112_0147044
1146 Ga0496113_0011873
1147 Ga0496113_0048743
1148 Ga0496113_0080650
1149 Ga0496113_0100796
1150 Ga0496114_0065968
1151 Ga0496114_0113616
1152 Ga0496114_0552400
1153 Ga0496116_0004714
1154 Ga0496117_0000869
1155 Ga0496118_0000171
1156 Ga0496119_0001640
1157 Ga0496120_0009191
1158 Ga0496121_0001811
1159 Ga0496124_0005252
1160 Ga0496125_0014526
1161 Ga0496126_0003790
1162 Ga0501031_0023815
1163 Ga0501032_0057010
1164 Ga0501033_0097073
1165 Ga0501034_0208914
1166 Ga0501034_0560503
1167 Ga0501036_0028252
1168 Ga0501036_0055385
1169 Ga0501036_0227539
1170 Ga0501038_0119428
1171 Ga0501038_0150274
1172 Ga0501039_0218091
1173 Ga0501040_0007084
1174 Ga0501040_0081660
1175 Ga0501040_0082450
1176 Ga0501040_0085161
1177 Ga0501040_0093306
1178 Ga0501041_0027133
1179 Ga0501041_0086943
1180 Ga0501041_0141572
1181 Ga0501042_0044630
1182 Ga0501042_0059244
1183 Ga0501043_0510547
1184 Ga0501046_0043089
1185 Ga0501046_0094225
1186 Ga0501046_0295658
1187 Ga0501048_0024987
1188 Ga0501067_0039309
1189 Ga0501068_0012158
1190 Ga0501068_0035686
1191 Ga0501068_0038196
1192 Ga0501068_0054485
1193 Ga0501068_0075736
1194 Ga0501068_0165627
1195 Ga0501068_0268031
1196 Ga0501069_0007347
1197 Ga0501069_0110857
1198 Ga0501069_0122240
1199 Ga0501069_0252584
1200 Ga0501070_0015520
1201 Ga0501070_0016065
1202 Ga0501070_0117126
1203 Ga0501070_0443104
1204 Ga0501071_0000382
1205 Ga0501071_0037209
1206 Ga0501071_0249926
1207 Ga0501071_0253879
1208 Ga0501071_0310964
1209 Ga0501072_0003202
1210 Ga0501072_0026764
1211 Ga0501072_0029611
1212 Ga0501072_0052549
1213 Ga0501072_0216728
1214 Ga0501073_0108998
1215 Ga0501074_0024505
1216 Ga0501074_0123544
1217 Ga0501075_0006696
1218 Ga0501075_0091542
1219 Ga0501075_0108299
1220 Ga0501075_0120461
1221 Ga0501075_0131269
1222 Ga0501075_0350480
1223 Ga0501076_0015794
1224 Ga0501076_0017615
1225 Ga0501076_0024973
1226 Ga0501076_0066044
1227 Ga0501076_0120032
1228 Ga0501077_0000785
1229 Ga0501077_0020741
1230 Ga0501077_0033815
1231 Ga0501077_0049799
1232 Ga0501077_0105079
1233 Ga0501077_0169532
1234 Ga0501079_0003245
1235 Ga0501079_0014221
1236 Ga0501079_0018997
1237 Ga0501079_0153420
1238 Ga0501080_0014256
1239 Ga0501080_0128837
1240 Ga0501081_0019586
1241 Ga0501081_0136815
1242 Ga0501081_0263156
1243 Ga0501083_0014569
1244 Ga0501083_0073311
1245 Ga0501035_0017729
1246 Ga0501044_0174913
1247 Ga0501045_0014671
1248 Ga0501045_0089252
1249 nmdc:mga00v17_10207_c1
1250 nmdc:mga00v17_62400_c1
1251 nmdc:mga00v17_8334_c1
1252 nmdc:mga0yw44_12339_c1
1253 nmdc:mga0yw44_136666_c1
1254 nmdc:mga0yw44_262456_c1
1255 nmdc:mga0yw44_270833_c1
1256 nmdc:mga0yw44_377235_c1
1257 nmdc:mga0yw44_63635_c1
1258 nmdc:mga05p37_104764_c1
1259 nmdc:mga05p37_113374_c1
1260 nmdc:mga05p37_17164_c1
1261 nmdc:mga05p37_65845_c1
1262 nmdc:mga09592_18175_c1
1263 nmdc:mga09592_34185_c1
1264 nmdc:mga0qj67_11555_c1
1265 nmdc:mga0qj67_35662_c1
1266 nmdc:mga0qj67_424500_c1
1267 nmdc:mga06r32_19086_c1
1268 nmdc:mga06r32_32232_c1
1269 nmdc:mga08y16_128643_c1
1270 nmdc:mga08y16_212283_c1
1271 nmdc:mga08y16_219922_c1
1272 nmdc:mga08y16_31676_c1
1273 nmdc:mga08y16_36530_c1
1274 nmdc:mga08y16_39510_c1
1275 nmdc:mga08y16_399564_c1
1276 nmdc:mga08y16_452758_c1
1277 nmdc:mga08y16_497446_c1
1278 nmdc:mga08y16_579239_c1
1279 nmdc:mga08y16_63711_c1
1280 nmdc:mga0n895_40407_c1
1281 nmdc:mga0a205_41990_c1
1282 nmdc:mga0a205_78412_c1
1283 Ga0495601_0068332
1284 Ga0495595_0109673
1285 Ga0501084_0032323
1286 Ga0501084_0052842
1287 Ga0501084_0200221
1288 Ga0501084_0475192
1289 Ga0501082_0045179
1290 Ga0501082_0076208
1291 Ga0530510_0003518
1292 Ga0530510_0009018
1293 Ga0530510_0014205
1294 Ga0530510_0015904
1295 Ga0530510_0034974
1296 Ga0530510_0319845
1297 2643946801
1298 2644035091
1299 2644101233
1300 2644119361
1301 2644434982
1302 2738868839
1303 2812330384
1304 2990090877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

124

313

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.7662 146 262
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.7388 105 267
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7351 146 274
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7217 119 267
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7201 146 267
ID Description Score Start End Superfamily
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7861 100 272 1.10.3720.10
af_P9WG07_21_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7685 142 271 1.10.3720.10
af_P0AGH8_17_311_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7513 146 271 1.10.3720.10
3d31C00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7388 105 267 1.10.3720.10
af_Q58763_3_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.732 124 274 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4R9PCG7-F1-model_v4 ABC transporter permease subunit 0.9337 147 238 GO:0005886
GO:0055085
AF-A0A833LG72-F1-model_v4 ABC transporter permease subunit 0.9067 157 277 GO:0005886
GO:0055085
AF-A0A6J6J4R6-F1-model_v4 Unannotated protein 0.8957 154 277 GO:0005886
GO:0055085
AF-A0A833LG72-F1-model_v4 ABC transporter permease subunit 0.893 157 277 GO:0005886
GO:0055085
AF-A0A4R9PCG7-F1-model_v4 ABC transporter permease subunit 0.8882 147 238 GO:0005886
GO:0055085

Map