F472668

General Info

Members Datasets Scaffolds Average Seq Length
652 272 1304 142

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100695105|Ga0070700_1006951051
Length 145
Sequence LGTLASELIPVAARGAAPRVYADANIPSGAVGFMRTRLGWDVLFVMEHEELRRARDIEHYRLARQLGRTLLTQDRDYEREEFPPAEGAGVIVFIAQDERRLCELLARADRELFRCAGALPIPLEGRKMRWHIGAAEIIGDTPAAR

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
173 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
176 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
179 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
180 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
183 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
210 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
237 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
238 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
239 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.91
Nodule 0
Rhizoplane 3.37
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 24.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100695105 3300005441 Unclassified 808
2 MBSR1b_contig_8678458 2162886012 Unclassified 851
3 JGI24749J21850_1050165 3300002076 Unclassified 621
4 Ga0065712_10000850 3300005290 Bacteria 14397
5 Ga0065712_10002427 3300005290 Bacteria 5419
6 Ga0065712_10301593 3300005290 Bacteria 853
7 Ga0065715_10109416 3300005293 Bacteria 2669
8 Ga0065715_10158802 3300005293 Bacteria 1649
9 Ga0070676_10038166 3300005328 Bacteria 2773
10 Ga0070676_10476179 3300005328 Bacteria 882
11 Ga0070683_100000395 3300005329 Bacteria 30161
12 Ga0070683_100187624 3300005329 Bacteria 1963
13 Ga0070683_100200115 3300005329 Bacteria 1897
14 Ga0070690_100017798 3300005330 Bacteria 4282
15 Ga0070670_100025698 3300005331 Bacteria 5066
16 Ga0070670_100049630 3300005331 Bacteria 3608
17 Ga0070670_100064683 3300005331 Unclassified 3138
18 Ga0070670_100511704 3300005331 Unclassified 1068
19 Ga0070677_10150943 3300005333 Bacteria 1081
20 Ga0070677_10474679 3300005333 Unclassified 673
21 Ga0068869_100269918 3300005334 Bacteria 1365
22 Ga0070666_10233394 3300005335 Unclassified 1300
23 Ga0070666_10399730 3300005335 Bacteria 988
24 Ga0070680_100986806 3300005336 Unclassified 727
25 Ga0070682_100419892 3300005337 Bacteria 1016
26 Ga0068868_100101392 3300005338 Bacteria 2330
27 Ga0068868_101469149 3300005338 Bacteria 637
28 Ga0070660_100163133 3300005339 Bacteria 1797
29 Ga0070689_100327144 3300005340 Bacteria 1281
30 Ga0070691_10056401 3300005341 Bacteria 1883
31 Ga0070687_100009934 3300005343 Bacteria 4093
32 Ga0070661_100109637 3300005344 Bacteria 2060
33 Ga0070661_100424526 3300005344 Unclassified 1054
34 Ga0070661_100674046 3300005344 Bacteria 841
35 Ga0070692_10083488 3300005345 Bacteria 1725
36 Ga0070668_100139320 3300005347 Bacteria 1954
37 Ga0070669_100002308 3300005353 Bacteria 13809
38 Ga0070669_100048542 3300005353 Bacteria 3098
39 Ga0070669_100276526 3300005353 Unclassified 1344
40 Ga0070669_101002201 3300005353 Unclassified 717
41 Ga0070675_100040752 3300005354 Bacteria 3793
42 Ga0070675_100092845 3300005354 Bacteria 2531
43 Ga0070671_100215352 3300005355 Bacteria 1629
44 Ga0070674_100281536 3300005356 Bacteria 1318
45 Ga0070674_100406250 3300005356 Unclassified 1114
46 Ga0070673_100001718 3300005364 Bacteria 13010
47 Ga0070673_100083161 3300005364 Unclassified 2600
48 Ga0070688_100112548 3300005365 Bacteria 1812
49 Ga0070659_100175908 3300005366 Bacteria 1755
50 Ga0070659_100208881 3300005366 Bacteria 1609
51 Ga0070667_100008849 3300005367 Bacteria 8334
52 Ga0070667_100187608 3300005367 Bacteria 1830
53 Ga0070701_10173801 3300005438 Unclassified 1256
54 Ga0070701_10454697 3300005438 Bacteria 823
55 Ga0070705_100064442 3300005440 Bacteria 2189
56 Ga0070700_100140688 3300005441 Bacteria 1640
57 Ga0070700_100161839 3300005441 Bacteria 1541
58 Ga0070694_100557579 3300005444 Unclassified 918
59 Ga0070708_101433016 3300005445 Bacteria 644
60 Ga0070663_100374374 3300005455 Bacteria 1158
61 Ga0070678_100347236 3300005456 Bacteria 1275
62 Ga0070678_100596475 3300005456 Bacteria 986
63 Ga0070662_100122858 3300005457 Bacteria 1992
64 Ga0070662_100452395 3300005457 Bacteria 1066
65 Ga0070662_100621395 3300005457 Bacteria 910
66 Ga0070681_10531356 3300005458 Bacteria 1090
67 Ga0068867_100042042 3300005459 Bacteria 3341
68 Ga0070685_10217191 3300005466 Bacteria 1251
69 Ga0070698_101583955 3300005471 Unclassified 607
70 Ga0070684_100000197 3300005535 Bacteria 42219
71 Ga0070684_100242148 3300005535 Bacteria 1648
72 Ga0070672_100050301 3300005543 Bacteria 3245
73 Ga0070672_100082637 3300005543 Bacteria 2577
74 Ga0070672_100310224 3300005543 Bacteria 1339
75 Ga0070672_100943447 3300005543 Unclassified 763
76 Ga0070686_100051399 3300005544 Bacteria 2623
77 Ga0070686_100104392 3300005544 Bacteria 1920
78 Ga0070695_100127331 3300005545 Bacteria 1750
79 Ga0070695_100518949 3300005545 Bacteria 924
80 Ga0070696_100096412 3300005546 Bacteria 2114
81 Ga0070696_100253982 3300005546 Bacteria 1330
82 Ga0070665_101463704 3300005548 Bacteria 692
83 Ga0070704_100082919 3300005549 Bacteria 2365
84 Ga0070704_100472202 3300005549 Unclassified 1084
85 Ga0068855_100071486 3300005563 Bacteria 4035
86 Ga0070664_100017763 3300005564 Bacteria 5843
87 Ga0070664_100367889 3300005564 Bacteria 1310
88 Ga0070664_100455435 3300005564 Bacteria 1175
89 Ga0070664_100686792 3300005564 Bacteria 953
90 Ga0068857_100020877 3300005577 Bacteria 5762
91 Ga0068857_100112910 3300005577 Bacteria 2443
92 Ga0068854_100081712 3300005578 Bacteria 2387
93 Ga0068856_100137306 3300005614 Bacteria 2451
94 Ga0070702_100221429 3300005615 Bacteria 1265
95 Ga0070702_100537688 3300005615 Bacteria 865
96 Ga0068852_100107388 3300005616 Bacteria 2532
97 Ga0068852_100333319 3300005616 Unclassified 1477
98 Ga0068852_100522131 3300005616 Bacteria 1185
99 Ga0068852_101380756 3300005616 Unclassified 726
100 Ga0068859_100722002 3300005617 Unclassified 1086
101 Ga0068864_100214972 3300005618 Bacteria 1772
102 Ga0068864_100445980 3300005618 Bacteria 1237
103 Ga0068864_100599062 3300005618 Unclassified 1069
104 Ga0068864_100621402 3300005618 Bacteria 1050
105 Ga0068866_10109935 3300005718 Bacteria 1536
106 Ga0068861_100330954 3300005719 Unclassified 1330
107 Ga0068861_100977198 3300005719 Bacteria 807
108 Ga0068863_100428793 3300005841 Bacteria 1296
109 Ga0068858_100097516 3300005842 Bacteria 2740
110 Ga0068858_100171162 3300005842 Bacteria 2048
111 Ga0068858_102221717 3300005842 Unclassified 542
112 Ga0068860_100293475 3300005843 Bacteria 1591
113 Ga0068860_101456112 3300005843 Unclassified 706
114 Ga0068862_100031034 3300005844 Bacteria 4507
115 Ga0068862_100308959 3300005844 Bacteria 1457
116 Ga0068862_100436266 3300005844 Unclassified 1232
117 Ga0075368_10013519 3300006042 Bacteria 2999
118 Ga0075368_10030284 3300006042 Unclassified 2095
119 Ga0075364_10015953 3300006051 Bacteria 4665
120 Ga0075364_10020090 3300006051 Bacteria 4200
121 Ga0075364_10116342 3300006051 Bacteria 1787
122 Ga0075364_10269092 3300006051 Bacteria 1159
123 Ga0075362_10003003 3300006177 Bacteria 5804
124 Ga0075367_10051603 3300006178 Bacteria 2431
125 Ga0075367_10055721 3300006178 Bacteria 2347
126 Ga0075367_10126858 3300006178 Bacteria 1575
127 Ga0075367_10392517 3300006178 Bacteria 877
128 Ga0075366_10012227 3300006195 Bacteria 4866
129 Ga0075366_10014422 3300006195 Bacteria 4513
130 Ga0075366_10019532 3300006195 Unclassified 3923
131 Ga0068871_100839605 3300006358 Bacteria 849
132 Ga0075428_100000086 3300006844 Bacteria 77110
133 Ga0075428_100000851 3300006844 Bacteria 32103
134 Ga0075428_100011531 3300006844 Bacteria 9830
135 Ga0075428_100072724 3300006844 Bacteria 3755
136 Ga0075428_100147909 3300006844 Unclassified 2553
137 Ga0075428_100385334 3300006844 Unclassified 1503
138 Ga0075430_100000028 3300006846 Bacteria 74712
139 Ga0075430_100003939 3300006846 Bacteria 12523
140 Ga0075430_100100977 3300006846 Bacteria 2409
141 Ga0075430_100215896 3300006846 Unclassified 1592
142 Ga0075430_100224506 3300006846 Unclassified 1558
143 Ga0075430_100788896 3300006846 Bacteria 783
144 Ga0075430_100982735 3300006846 Unclassified 695
145 Ga0075431_100003561 3300006847 Bacteria 15078
146 Ga0075431_100003906 3300006847 Bacteria 14507
147 Ga0075431_100008395 3300006847 Bacteria 10337
148 Ga0075431_100025573 3300006847 Bacteria 6052
149 Ga0075431_100028998 3300006847 Bacteria 5692
150 Ga0075433_10680608 3300006852 Unclassified 901
151 Ga0075433_10803368 3300006852 Bacteria 822
152 Ga0075434_100014747 3300006871 Bacteria 7476
153 Ga0075434_100057950 3300006871 Unclassified 3850
154 Ga0075434_100099105 3300006871 Bacteria 2919
155 Ga0075434_100124803 3300006871 Bacteria 2592
156 Ga0075434_100158798 3300006871 Bacteria 2281
157 Ga0075434_100541512 3300006871 Bacteria 1184
158 Ga0075429_100004161 3300006880 Bacteria 12378
159 Ga0075429_100009460 3300006880 Bacteria 8457
160 Ga0075429_100234594 3300006880 Archaea 1607
161 Ga0068865_100428939 3300006881 Bacteria 1089
162 Ga0097620_100721950 3300006931 Unclassified 1086
163 Ga0075435_100007712 3300007076 Bacteria 7694
164 Ga0075435_100181068 3300007076 Bacteria 1781
165 Ga0075435_100491609 3300007076 Unclassified 1060
166 Ga0111539_10000166 3300009094 Bacteria 76156
167 Ga0111539_10002921 3300009094 Bacteria 22662
168 Ga0111539_10030999 3300009094 Bacteria 6497
169 Ga0111539_10171564 3300009094 Bacteria 2534
170 Ga0111539_10204135 3300009094 Unclassified 2304
171 Ga0111539_10234879 3300009094 Unclassified 2134
172 Ga0111539_10369156 3300009094 Bacteria 1670
173 Ga0111539_10477545 3300009094 Bacteria 1452
174 Ga0111539_11603689 3300009094 Bacteria 755
175 Ga0105245_10031695 3300009098 Bacteria 4679
176 Ga0114129_10000148 3300009147 Bacteria 74039
177 Ga0114129_10009548 3300009147 Bacteria 13840
178 Ga0114129_10011187 3300009147 Bacteria 12792
179 Ga0114129_10023952 3300009147 Bacteria 8651
180 Ga0114129_10037536 3300009147 Bacteria 6839
181 Ga0114129_10105036 3300009147 Unclassified 3904
182 Ga0114129_11168944 3300009147 Unclassified 960
183 Ga0114129_11468637 3300009147 Bacteria 839
184 Ga0114129_12712461 3300009147 Unclassified 590
185 Ga0105243_10173550 3300009148 Bacteria 1869
186 Ga0105243_10264994 3300009148 Unclassified 1540
187 Ga0105242_10266809 3300009176 Bacteria 1549
188 Ga0105248_10078408 3300009177 Bacteria 3713
189 Ga0105248_10101547 3300009177 Bacteria 3242
190 Ga0105248_12114427 3300009177 Unclassified 640
191 Ga0105238_10975143 3300009551 Bacteria 868
192 Ga0105249_10001419 3300009553 Bacteria 20973
193 Ga0105249_10047348 3300009553 Bacteria 3917
194 Ga0105249_10153149 3300009553 Bacteria 2221
195 Ga0105249_10764869 3300009553 Bacteria 1029
196 Ga0105249_10977185 3300009553 Unclassified 915
197 Ga0105239_10954371 3300010375 Bacteria 985
198 Ga0105246_10031741 3300011119 Bacteria 3497
199 Ga0105246_10476444 3300011119 Unclassified 1055
200 Ga0105246_10650727 3300011119 Bacteria 917
201 Ga0157319_1012980 3300012497 Unclassified 711
202 Ga0157370_10085448 3300013104 Bacteria 2964
203 Ga0157378_10623033 3300013297 Bacteria 1092
204 Ga0163162_10540360 3300013306 Unclassified 1294
205 Ga0157372_10294861 3300013307 Bacteria 1886
206 Ga0157372_10733921 3300013307 Bacteria 1149
207 Ga0157375_10134489 3300013308 Unclassified 2594
208 Ga0157375_10798440 3300013308 Unclassified 1093
209 Ga0157375_11502014 3300013308 Bacteria 795
210 Ga0163163_10017401 3300014325 Bacteria 6703
211 Ga0163163_10021873 3300014325 Bacteria 6043
212 Ga0163163_10100057 3300014325 Bacteria 2921
213 Ga0163163_10777411 3300014325 Bacteria 1021
214 Ga0157380_10005238 3300014326 Bacteria 9059
215 Ga0157380_10155114 3300014326 Bacteria 1983
216 Ga0157380_10370809 3300014326 Bacteria 1347
217 Ga0157377_10081010 3300014745 Unclassified 1898
218 Ga0157377_10591846 3300014745 Bacteria 790
219 Ga0157379_11724492 3300014968 Bacteria 614
220 Ga0157379_12048041 3300014968 Unclassified 566
221 Ga0157376_10157966 3300014969 Bacteria 2052
222 Ga0207697_10001424 3300025315 Bacteria 13074
223 Ga0207697_10004300 3300025315 Bacteria 6826
224 Ga0207697_10228758 3300025315 Unclassified 821
225 Ga0207642_10038047 3300025899 Bacteria 2078
226 Ga0207688_10003623 3300025901 Bacteria 8432
227 Ga0207645_10056933 3300025907 Bacteria 2496
228 Ga0207645_10456550 3300025907 Bacteria 863
229 Ga0207707_10533317 3300025912 Bacteria 999
230 Ga0207663_10299103 3300025916 Bacteria 1202
231 Ga0207662_10002412 3300025918 Bacteria 9379
232 Ga0207657_10161323 3300025919 Bacteria 1821
233 Ga0207649_10004649 3300025920 Bacteria 7431
234 Ga0207649_10113277 3300025920 Unclassified 1816
235 Ga0207646_10736834 3300025922 Unclassified 880
236 Ga0207681_10022927 3300025923 Bacteria 3987
237 Ga0207681_10035486 3300025923 Bacteria 3286
238 Ga0207681_10182898 3300025923 Bacteria 1598
239 Ga0207681_10852723 3300025923 Unclassified 762
240 Ga0207694_10264722 3300025924 Bacteria 1409
241 Ga0207650_10018735 3300025925 Bacteria 4861
242 Ga0207650_10038902 3300025925 Bacteria 3476
243 Ga0207650_10039356 3300025925 Bacteria 3455
244 Ga0207650_10730006 3300025925 Unclassified 838
245 Ga0207659_10023246 3300025926 Bacteria 4134
246 Ga0207659_10059389 3300025926 Bacteria 2749
247 Ga0207659_10067332 3300025926 Unclassified 2601
248 Ga0207700_10064887 3300025928 Bacteria 2784
249 Ga0207644_10042387 3300025931 Bacteria 3225
250 Ga0207690_10094981 3300025932 Bacteria 2117
251 Ga0207690_10140402 3300025932 Bacteria 1779
252 Ga0207706_10053048 3300025933 Bacteria 3580
253 Ga0207706_10150760 3300025933 Bacteria 2045
254 Ga0207706_11718161 3300025933 Unclassified 505
255 Ga0207709_11022501 3300025935 Unclassified 676
256 Ga0207670_10033215 3300025936 Bacteria 3324
257 Ga0207670_11215914 3300025936 Bacteria 638
258 Ga0207669_10071225 3300025937 Bacteria 2183
259 Ga0207669_10294645 3300025937 Bacteria 1230
260 Ga0207669_10375297 3300025937 Unclassified 1106
261 Ga0207669_11377233 3300025937 Bacteria 600
262 Ga0207704_10260641 3300025938 Bacteria 1307
263 Ga0207691_10064592 3300025940 Bacteria 3315
264 Ga0207691_10094696 3300025940 Bacteria 2672
265 Ga0207691_10831306 3300025940 Bacteria 775
266 Ga0207711_10067984 3300025941 Bacteria 3085
267 Ga0207711_10115425 3300025941 Bacteria 2393
268 Ga0207689_10018996 3300025942 Bacteria 5797
269 Ga0207661_10001796 3300025944 Bacteria 14663
270 Ga0207661_10171087 3300025944 Bacteria 1891
271 Ga0207661_10307641 3300025944 Bacteria 1422
272 Ga0207679_10011845 3300025945 Bacteria 5669
273 Ga0207679_10245954 3300025945 Bacteria 1518
274 Ga0207679_10248092 3300025945 Bacteria 1512
275 Ga0207679_11080764 3300025945 Bacteria 736
276 Ga0207651_10010645 3300025960 Bacteria 5107
277 Ga0207651_10055721 3300025960 Unclassified 2717
278 Ga0207712_10003730 3300025961 Bacteria 9615
279 Ga0207712_10048697 3300025961 Bacteria 2949
280 Ga0207712_10286102 3300025961 Bacteria 1347
281 Ga0207712_10651550 3300025961 Unclassified 915
282 Ga0207668_10114916 3300025972 Bacteria 2027
283 Ga0207668_10622488 3300025972 Unclassified 942
284 Ga0207640_10033040 3300025981 Bacteria 3214
285 Ga0207658_10057684 3300025986 Bacteria 2887
286 Ga0207658_10239897 3300025986 Unclassified 1535
287 Ga0207677_10325750 3300026023 Bacteria 1278
288 Ga0207703_10821092 3300026035 Bacteria 888
289 Ga0207703_11050951 3300026035 Unclassified 782
290 Ga0207678_10045667 3300026067 Unclassified 3787
291 Ga0207678_10223046 3300026067 Bacteria 1614
292 Ga0207708_10003569 3300026075 Bacteria 11476
293 Ga0207702_10120575 3300026078 Bacteria 2347
294 Ga0207641_10047702 3300026088 Bacteria 3613
295 Ga0207641_10277063 3300026088 Bacteria 1576
296 Ga0207641_10309390 3300026088 Bacteria 1495
297 Ga0207641_11733279 3300026088 Bacteria 627
298 Ga0207648_10565149 3300026089 Bacteria 1046
299 Ga0207676_10506278 3300026095 Bacteria 1147
300 Ga0207676_10535334 3300026095 Bacteria 1117
301 Ga0207674_10028604 3300026116 Bacteria 5880
302 Ga0207674_10091727 3300026116 Bacteria 3028
303 Ga0207675_100013531 3300026118 Bacteria 7615
304 Ga0207683_10261903 3300026121 Unclassified 1579
305 Ga0207683_11159318 3300026121 Bacteria 716
306 Ga0207698_10030000 3300026142 Bacteria 3904
307 Ga0207698_10049477 3300026142 Bacteria 3199
308 Ga0207698_10308464 3300026142 Unclassified 1477
309 Ga0207698_11977124 3300026142 Unclassified 597
310 Ga0209813_10009426 3300027866 Bacteria 2497
311 Ga0209813_10043804 3300027866 Bacteria 1373
312 Ga0207428_10000251 3300027907 Bacteria 73186
313 Ga0207428_10070323 3300027907 Unclassified 2751
314 Ga0207428_10120662 3300027907 Bacteria 2010
315 Ga0207428_10384398 3300027907 Bacteria 1029
316 Ga0268266_10236576 3300028379 Bacteria 1684
317 Ga0268265_10009754 3300028380 Bacteria 6482
318 Ga0268265_10851041 3300028380 Bacteria 892
319 Ga0268265_11674037 3300028380 Unclassified 642
320 Ga0268264_10227696 3300028381 Bacteria 1719
321 Ga0307408_100005089 3300031548 Bacteria 8820
322 Ga0307408_100016094 3300031548 Bacteria 4987
323 Ga0307408_100029178 3300031548 Bacteria 3819
324 Ga0307408_100036391 3300031548 Bacteria 3460
325 Ga0307408_100068855 3300031548 Bacteria 2607
326 Ga0307408_100138421 3300031548 Bacteria 1908
327 Ga0307408_100464583 3300031548 Bacteria 1101
328 Ga0307405_10090805 3300031731 Unclassified 2022
329 Ga0307405_10245407 3300031731 Bacteria 1329
330 Ga0307405_10412455 3300031731 Bacteria 1060
331 Ga0307413_10052711 3300031824 Bacteria 2459
332 Ga0307413_10104991 3300031824 Bacteria 1877
333 Ga0307413_10146864 3300031824 Bacteria 1638
334 Ga0307413_10634527 3300031824 Unclassified 879
335 Ga0307410_10272264 3300031852 Unclassified 1325
336 Ga0307410_10576817 3300031852 Bacteria 935
337 Ga0307410_11035620 3300031852 Unclassified 709
338 Ga0307410_11356326 3300031852 Unclassified 623
339 Ga0307406_10279632 3300031901 Bacteria 1272
340 Ga0307406_11117381 3300031901 Bacteria 681
341 Ga0307406_11496141 3300031901 Unclassified 594
342 Ga0307407_10011022 3300031903 Bacteria 4286
343 Ga0307407_10169978 3300031903 Bacteria 1435
344 Ga0307407_10300048 3300031903 Bacteria 1120
345 Ga0307407_10524421 3300031903 Bacteria 872
346 Ga0307407_10897729 3300031903 Unclassified 680
347 Ga0307412_10114951 3300031911 Bacteria 1928
348 Ga0307412_10494204 3300031911 Unclassified 1017
349 Ga0307412_11144095 3300031911 Unclassified 694
350 Ga0307409_100010108 3300031995 Bacteria 5841
351 Ga0307409_100032168 3300031995 Bacteria 3799
352 Ga0307409_100409598 3300031995 Unclassified 1297
353 Ga0307409_100512078 3300031995 Bacteria 1171
354 Ga0307409_101740740 3300031995 Unclassified 652
355 Ga0307416_100020517 3300032002 Bacteria 4718
356 Ga0307416_100032467 3300032002 Bacteria 3945
357 Ga0307416_100053124 3300032002 Bacteria 3249
358 Ga0307416_100070020 3300032002 Unclassified 2906
359 Ga0307416_100123434 3300032002 Bacteria 2314
360 Ga0307416_100185610 3300032002 Unclassified 1954
361 Ga0307416_100213822 3300032002 Unclassified 1842
362 Ga0307416_100382228 3300032002 Bacteria 1439
363 Ga0307416_100385430 3300032002 Unclassified 1433
364 Ga0307416_101204798 3300032002 Bacteria 863
365 Ga0307416_101560941 3300032002 Unclassified 766
366 Ga0307414_10017875 3300032004 Bacteria 4350
367 Ga0307414_11065215 3300032004 Unclassified 746
368 Ga0307411_10012926 3300032005 Bacteria 4580
369 Ga0307411_10065564 3300032005 Bacteria 2436
370 Ga0307411_10078884 3300032005 Unclassified 2259
371 Ga0307411_10662786 3300032005 Bacteria 905
372 Ga0307411_10865871 3300032005 Bacteria 800
373 Ga0307411_11195149 3300032005 Bacteria 689
374 Ga0307411_11710835 3300032005 Bacteria 582
375 Ga0307415_100054385 3300032126 Bacteria 2732
376 Ga0307415_100555087 3300032126 Bacteria 1014
377 Ga0307415_100647941 3300032126 Unclassified 946
378 Ga0307415_101188334 3300032126 Unclassified 718
379 Ga0373930_0081277 3300034816 Bacteria 749
380 Ga0373945_0150086 3300035116 Unclassified 944
381 Ga0373960_0242855 3300035121 Bacteria 652
382 Ga0373946_0122626 3300035171 Unclassified 1188
383 Ga0373946_0391511 3300035171 Unclassified 700
384 Ga0373955_0641930 3300035172 Bacteria 651
385 Ga0373931_0271627 3300035691 Bacteria 1038
386 Ga0373931_0641169 3300035691 Unclassified 697
387 Ga0373935_0180870 3300035692 Unclassified 1448
388 Ga0373935_0624745 3300035692 Bacteria 789
389 Ga0373933_0025842 3300035724 Bacteria 3369
390 Ga0373947_0039181 3300035725 Unclassified 2819
391 Ga0373937_0000242 3300036401 Bacteria 53400
392 Ga0373925_0009079 3300037068 Bacteria 7239
393 Ga0439436_0123302 3300041404 Unclassified 725
394 Ga0439461_0026419 3300041410 Unclassified 1184
395 Ga0439461_0163496 3300041410 Bacteria 581
396 Ga0439431_0005547 3300041997 Bacteria 2784
397 Ga0439433_0017246 3300041999 Bacteria 1602
398 Ga0439441_052609 3300042001 Bacteria 842
399 Ga0439449_0072377 3300042007 Unclassified 1270
400 Ga0439449_0123663 3300042007 Bacteria 961
401 Ga0439450_000724 3300042008 Unclassified 4456
402 Ga0439450_191468 3300042008 Unclassified 545
403 Ga0439454_012336 3300042011 Bacteria 1158
404 Ga0439456_101450 3300042013 Unclassified 651
405 Ga0439462_0015879 3300042015 Unclassified 1944
406 Ga0439462_0022639 3300042015 Unclassified 1645
407 Ga0450923_011779 3300042125 Bacteria 1580
408 Ga0450898_017685 3300042134 Bacteria 1228
409 Ga0439446_0004581 3300042156 Bacteria 3506
410 Ga0439446_0010382 3300042156 Bacteria 2506
411 Ga0439446_0020101 3300042156 Bacteria 1879
412 Ga0439446_0025904 3300042156 Unclassified 1678
413 Ga0450908_025858 3300042184 Unclassified 1024
414 Ga0439434_0024486 3300042435 Unclassified 1821
415 Ga0439435_0008109 3300042436 Bacteria 2429
416 Ga0439435_0092645 3300042436 Bacteria 919
417 Ga0439435_0099563 3300042436 Unclassified 892
418 Ga0439444_0011271 3300042437 Unclassified 1445
419 Ga0439464_0013278 3300042439 Bacteria 2203
420 Ga0439464_0024583 3300042439 Bacteria 1666
421 Ga0439460_0011320 3300042461 Bacteria 2299
422 Ga0439460_0021589 3300042461 Bacteria 1761
423 Ga0439460_0030943 3300042461 Bacteria 1524
424 Ga0466964_0251764 3300044706 Bacteria 871
425 Ga0495634_0244988 3300046642 Bacteria 1098
426 Ga0495658_0720216 3300046683 Unclassified 639
427 Ga0495674_0244187 3300047319 Bacteria 1479
428 Ga0495676_0679357 3300047321 Unclassified 667
429 Ga0496100_0625906 3300048903 Bacteria 837
430 Ga0496100_0979558 3300048903 Unclassified 665
431 Ga0496102_0511055 3300048905 Unclassified 1124
432 Ga0496104_0002010 3300048907 Bacteria 17653
433 Ga0496105_0004105 3300048908 Bacteria 10917
434 Ga0496106_0185483 3300048909 Bacteria 1653
435 Ga0496107_1237631 3300048910 Unclassified 536
436 Ga0496108_0043652 3300048911 Unclassified 3744
437 Ga0496108_0053798 3300048911 Bacteria 3377
438 Ga0496108_0731671 3300048911 Unclassified 857
439 Ga0496109_0000421 3300048912 Bacteria 37279
440 Ga0496109_0052467 3300048912 Bacteria 3717
441 Ga0496109_1654454 3300048912 Unclassified 574
442 Ga0496110_0005760 3300048913 Bacteria 9733
443 Ga0496110_0554800 3300048913 Unclassified 1044
444 Ga0496111_0001922 3300048914 Bacteria 12282
445 Ga0496112_0000526 3300048915 Bacteria 26132
446 Ga0496112_0274783 3300048915 Bacteria 1633
447 Ga0496112_0524488 3300048915 Bacteria 1119
448 Ga0496113_0163806 3300048916 Bacteria 1759
449 Ga0496113_0330261 3300048916 Bacteria 1223
450 Ga0496114_0290341 3300048917 Bacteria 1443
451 Ga0501292_021341 3300049515 Bacteria 1048
452 Ga0501296_008107 3300049519 Bacteria 1213
453 Ga0501031_0015981 3300049568 Bacteria 4873
454 Ga0501031_0782461 3300049568 Unclassified 612
455 Ga0501032_0037955 3300049569 Bacteria 3282
456 Ga0501032_0125246 3300049569 Bacteria 1697
457 Ga0501033_0086612 3300049570 Bacteria 2293
458 Ga0501033_0695811 3300049570 Bacteria 692
459 Ga0501033_0719378 3300049570 Unclassified 678
460 Ga0501034_0003973 3300049571 Bacteria 16616
461 Ga0501034_0007758 3300049571 Bacteria 11412
462 Ga0501034_0027190 3300049571 Bacteria 5819
463 Ga0501034_0089858 3300049571 Bacteria 3069
464 Ga0501036_0019348 3300049572 Bacteria 5714
465 Ga0501036_0071746 3300049572 Unclassified 2928
466 Ga0501036_0094155 3300049572 Bacteria 2531
467 Ga0501036_0462197 3300049572 Bacteria 1057
468 Ga0501036_0640377 3300049572 Unclassified 880
469 Ga0501036_0792543 3300049572 Bacteria 780
470 Ga0501036_1481907 3300049572 Unclassified 549
471 Ga0501037_0027228 3300049573 Bacteria 4222
472 Ga0501037_0294841 3300049573 Unclassified 1127
473 Ga0501038_0010546 3300049574 Bacteria 8449
474 Ga0501038_0336769 3300049574 Bacteria 1177
475 Ga0501038_0548731 3300049574 Bacteria 879
476 Ga0501039_0015384 3300049575 Bacteria 5856
477 Ga0501039_0056096 3300049575 Bacteria 3051
478 Ga0501039_0319120 3300049575 Bacteria 1221
479 Ga0501039_0343120 3300049575 Bacteria 1174
480 Ga0501039_0660441 3300049575 Bacteria 818
481 Ga0501039_0880228 3300049575 Unclassified 697
482 Ga0501040_0088138 3300049576 Unclassified 2155
483 Ga0501040_0146253 3300049576 Bacteria 1666
484 Ga0501040_0173260 3300049576 Unclassified 1528
485 Ga0501040_0588956 3300049576 Unclassified 803
486 Ga0501041_0178631 3300049577 Bacteria 1329
487 Ga0501041_0506940 3300049577 Bacteria 768
488 Ga0501042_0026445 3300049578 Bacteria 4078
489 Ga0501042_0080722 3300049578 Bacteria 2330
490 Ga0501042_0187107 3300049578 Unclassified 1494
491 Ga0501042_0293279 3300049578 Bacteria 1175
492 Ga0501043_0039454 3300049579 Bacteria 3710
493 Ga0501043_0077663 3300049579 Bacteria 2608
494 Ga0501043_0135813 3300049579 Bacteria 1926
495 Ga0501043_0799159 3300049579 Bacteria 682
496 Ga0501046_0000738 3300049580 Bacteria 31646
497 Ga0501046_0009895 3300049580 Bacteria 8215
498 Ga0501046_0039127 3300049580 Bacteria 3800
499 Ga0501046_0094539 3300049580 Bacteria 2297
500 Ga0501047_0009902 3300049581 Bacteria 9011
501 Ga0501047_0043928 3300049581 Bacteria 4316
502 Ga0501047_0056165 3300049581 Bacteria 3806
503 Ga0501048_0005291 3300049582 Bacteria 9830
504 Ga0501048_0066914 3300049582 Bacteria 2540
505 Ga0501048_0075928 3300049582 Bacteria 2371
506 Ga0501048_0125692 3300049582 Bacteria 1813
507 Ga0501048_0195869 3300049582 Bacteria 1432
508 Ga0501048_0322917 3300049582 Bacteria 1100
509 Ga0501067_0013409 3300049583 Bacteria 4539
510 Ga0501067_0521278 3300049583 Unclassified 665
511 Ga0501068_0019964 3300049584 Bacteria 3899
512 Ga0501068_0068774 3300049584 Bacteria 2158
513 Ga0501068_0216552 3300049584 Bacteria 1217
514 Ga0501068_0320294 3300049584 Bacteria 994
515 Ga0501070_0097906 3300049586 Bacteria 2426
516 Ga0501070_0169171 3300049586 Bacteria 1800
517 Ga0501071_0024397 3300049587 Bacteria 4231
518 Ga0501071_0031943 3300049587 Unclassified 3736
519 Ga0501071_0735879 3300049587 Bacteria 760
520 Ga0501071_0893305 3300049587 Bacteria 685
521 Ga0501071_1126233 3300049587 Unclassified 606
522 Ga0501072_0019058 3300049588 Bacteria 5299
523 Ga0501072_0032146 3300049588 Unclassified 4109
524 Ga0501072_0079594 3300049588 Unclassified 2595
525 Ga0501072_0358164 3300049588 Bacteria 1158
526 Ga0501072_0855557 3300049588 Unclassified 711
527 Ga0501073_0017697 3300049589 Bacteria 5159
528 Ga0501073_0025576 3300049589 Bacteria 4230
529 Ga0501073_0162473 3300049589 Bacteria 1547
530 Ga0501073_0479023 3300049589 Unclassified 860
531 Ga0501074_0012025 3300049590 Bacteria 6290
532 Ga0501074_0015206 3300049590 Bacteria 5595
533 Ga0501074_0125869 3300049590 Bacteria 1833
534 Ga0501075_0083251 3300049591 Bacteria 2423
535 Ga0501075_0149670 3300049591 Bacteria 1779
536 Ga0501075_0343552 3300049591 Bacteria 1137
537 Ga0501076_0007846 3300049592 Bacteria 7779
538 Ga0501076_0040538 3300049592 Bacteria 3661
539 Ga0501076_0180632 3300049592 Bacteria 1720
540 Ga0501076_1596735 3300049592 Bacteria 535
541 Ga0501077_0060979 3300049593 Unclassified 2393
542 Ga0501077_0346862 3300049593 Bacteria 947
543 Ga0501198_021755 3300049649 Bacteria 1024
544 Ga0501217_173952 3300049661 Bacteria 657
545 Ga0501235_015454 3300049669 Bacteria 1683
546 Ga0501221_198641 3300049704 Bacteria 556
547 Ga0501079_0028835 3300049741 Unclassified 4261
548 Ga0501079_0089005 3300049741 Unclassified 2391
549 Ga0501079_0090366 3300049741 Bacteria 2372
550 Ga0501079_0101356 3300049741 Bacteria 2233
551 Ga0501079_0288894 3300049741 Bacteria 1282
552 Ga0501079_0613828 3300049741 Bacteria 856
553 Ga0501079_0622857 3300049741 Bacteria 849
554 Ga0501080_0005522 3300049742 Bacteria 11291
555 Ga0501080_0050711 3300049742 Bacteria 3862
556 Ga0501080_0051706 3300049742 Bacteria 3824
557 Ga0501080_0216539 3300049742 Bacteria 1754
558 Ga0501080_0427145 3300049742 Bacteria 1190
559 Ga0501080_0726120 3300049742 Bacteria 875
560 Ga0501080_0745407 3300049742 Bacteria 862
561 Ga0501080_0844192 3300049742 Unclassified 801
562 Ga0501081_0132621 3300049743 Unclassified 1781
563 Ga0501081_0187355 3300049743 Unclassified 1498
564 Ga0501081_0845014 3300049743 Bacteria 689
565 Ga0501083_0032821 3300049744 Bacteria 3557
566 Ga0501083_0082538 3300049744 Bacteria 2129
567 Ga0501035_0066994 3300049822 Bacteria 3186
568 Ga0501035_0193537 3300049822 Bacteria 1747
569 Ga0501035_0202538 3300049822 Bacteria 1701
570 Ga0501044_0024584 3300049823 Bacteria 6392
571 Ga0501045_0042313 3300049824 Bacteria 3316
572 Ga0501045_0107541 3300049824 Bacteria 2067
573 Ga0501045_0403982 3300049824 Bacteria 1016
574 nmdc:mga03683_279696_c1 3300050489 Bacteria 780
575 nmdc:mga03n38_319487_c1 3300050490 Bacteria 838
576 nmdc:mga00v17_158919_c1 3300050491 Bacteria 1454
577 nmdc:mga00v17_4431_c1 3300050491 Bacteria 7308
578 nmdc:mga00v17_4630_c1 3300050491 Bacteria 7176
579 nmdc:mga0yw44_79892_c1 3300050492 Bacteria 2047
580 nmdc:mga0k408_12736_c1 3300050493 Bacteria 4600
581 nmdc:mga0k408_4179_c1 3300050493 Bacteria 7664
582 nmdc:mga0k408_99939_c2 3300050493 Bacteria 1045
583 nmdc:mga06z11_334488_c1 3300050494 Bacteria 905
584 nmdc:mga06z11_49736_c1 3300050494 Bacteria 2140
585 nmdc:mga06z11_7040_c1 3300050494 Bacteria 3939
586 nmdc:mga04h51_22036_c1 3300050495 Bacteria 1923
587 nmdc:mga04h51_5760_c1 3300050495 Bacteria 3174
588 nmdc:mga07m45_17395_c1 3300050496 Bacteria 3861
589 nmdc:mga05p37_1298754_c1 3300050507 Bacteria 742
590 nmdc:mga05p37_221_c1 3300050507 Bacteria 57542
591 nmdc:mga05p37_2601_c2 3300050507 Unclassified 1273
592 nmdc:mga05p37_302244_c1 3300050507 Bacteria 1901
593 nmdc:mga05p37_33213_c1 3300050507 Bacteria 6319
594 nmdc:mga05p37_354057_c1 3300050507 Unclassified 1728
595 nmdc:mga05p37_57886_c1 3300050507 Bacteria 4773
596 nmdc:mga09592_155909_c1 3300050508 Bacteria 1971
597 nmdc:mga09592_25391_c1 3300050508 Bacteria 4904
598 nmdc:mga09592_28669_c1 3300050508 Bacteria 4627
599 nmdc:mga09592_83536_c1 3300050508 Bacteria 2722
600 nmdc:mga0qj67_1087_c1 3300050509 Bacteria 18814
601 nmdc:mga0qj67_213772_c1 3300050509 Unclassified 1566
602 nmdc:mga0qj67_236739_c1 3300050509 Unclassified 1481
603 nmdc:mga0qj67_260289_c1 3300050509 Unclassified 1407
604 nmdc:mga0qj67_9271_c1 3300050509 Bacteria 7319
605 nmdc:mga0qj67_937364_c1 3300050509 Bacteria 681
606 nmdc:mga06r32_17322_c1 3300050510 Bacteria 6578
607 nmdc:mga06r32_20184_c1 3300050510 Bacteria 6131
608 nmdc:mga06r32_39645_c1 3300050510 Bacteria 4470
609 nmdc:mga06r32_44538_c1 3300050510 Bacteria 4226
610 nmdc:mga06r32_94343_c1 3300050510 Bacteria 2928
611 nmdc:mga08y16_1126898_c1 3300050511 Bacteria 758
612 nmdc:mga08y16_29848_c1 3300050511 Bacteria 5743
613 nmdc:mga08y16_460113_c1 3300050511 Bacteria 1297
614 nmdc:mga08y16_464_c1 3300050511 Bacteria 37766
615 nmdc:mga08y16_515782_c1 3300050511 Bacteria 1213
616 nmdc:mga08y16_760910_c1 3300050511 Bacteria 964
617 nmdc:mga0n895_13401_c1 3300050512 Bacteria 7393
618 nmdc:mga0n895_170234_c1 3300050512 Bacteria 2210
619 nmdc:mga0n895_170973_c1 3300050512 Bacteria 2205
620 nmdc:mga0n895_41387_c1 3300050512 Unclassified 4479
621 nmdc:mga0n895_56331_c1 3300050512 Bacteria 3872
622 nmdc:mga0n895_690939_c1 3300050512 Unclassified 1017
623 nmdc:mga0rr50_167986_c1 3300050513 Unclassified 1785
624 nmdc:mga0rr50_181907_c1 3300050513 Bacteria 1719
625 nmdc:mga0rr50_24120_c1 3300050513 Bacteria 4209
626 nmdc:mga0a205_228666_c1 3300050515 Bacteria 1744
627 nmdc:mga0a205_39047_c1 3300050515 Bacteria 4569
628 nmdc:mga0a205_586481_c1 3300050515 Unclassified 968
629 nmdc:mga0sz30_87978_c1 3300050516 Bacteria 1349
630 Ga0495612_0394081 3300053078 Bacteria 629
631 Ga0495619_0306158 3300053085 Bacteria 1101
632 Ga0501084_0008125 3300054114 Bacteria 8645
633 Ga0501084_0054704 3300054114 Unclassified 3339
634 Ga0501084_0105133 3300054114 Bacteria 2371
635 Ga0501084_0256506 3300054114 Bacteria 1476
636 Ga0501084_0437054 3300054114 Bacteria 1106
637 Ga0501084_0452487 3300054114 Bacteria 1085
638 Ga0590071_000323 3300059421 Bacteria 14020
639 Ga0590071_096903 3300059421 Bacteria 741
640 Ga0590074_000501 3300059423 Bacteria 5804
641 Ga0590075_000746 3300059424 Bacteria 8614
642 Ga0590075_120704 3300059424 Bacteria 686
643 Ga0590075_142651 3300059424 Bacteria 630
644 Ga0590077_000781 3300059426 Bacteria 8307
645 Ga0501082_0015121 3300060353 Bacteria 6649
646 Ga0501082_0048338 3300060353 Bacteria 3666
647 Ga0501082_0330355 3300060353 Unclassified 1328
648 Ga0501082_0357866 3300060353 Unclassified 1273
649 Ga0501082_0429720 3300060353 Bacteria 1153
650 Ga0501082_0934749 3300060353 Unclassified 758
651 Ga0530510_0159727 3300061734 Bacteria 1667
652 Ga0530510_0321515 3300061734 Bacteria 1160
653 Ga0070700_100695105
654 MBSR1b_contig_8678458
655 JGI24749J21850_1050165
656 Ga0065712_10000850
657 Ga0065712_10002427
658 Ga0065712_10301593
659 Ga0065715_10109416
660 Ga0065715_10158802
661 Ga0070676_10038166
662 Ga0070676_10476179
663 Ga0070683_100000395
664 Ga0070683_100187624
665 Ga0070683_100200115
666 Ga0070690_100017798
667 Ga0070670_100025698
668 Ga0070670_100049630
669 Ga0070670_100064683
670 Ga0070670_100511704
671 Ga0070677_10150943
672 Ga0070677_10474679
673 Ga0068869_100269918
674 Ga0070666_10233394
675 Ga0070666_10399730
676 Ga0070680_100986806
677 Ga0070682_100419892
678 Ga0068868_100101392
679 Ga0068868_101469149
680 Ga0070660_100163133
681 Ga0070689_100327144
682 Ga0070691_10056401
683 Ga0070687_100009934
684 Ga0070661_100109637
685 Ga0070661_100424526
686 Ga0070661_100674046
687 Ga0070692_10083488
688 Ga0070668_100139320
689 Ga0070669_100002308
690 Ga0070669_100048542
691 Ga0070669_100276526
692 Ga0070669_101002201
693 Ga0070675_100040752
694 Ga0070675_100092845
695 Ga0070671_100215352
696 Ga0070674_100281536
697 Ga0070674_100406250
698 Ga0070673_100001718
699 Ga0070673_100083161
700 Ga0070688_100112548
701 Ga0070659_100175908
702 Ga0070659_100208881
703 Ga0070667_100008849
704 Ga0070667_100187608
705 Ga0070701_10173801
706 Ga0070701_10454697
707 Ga0070705_100064442
708 Ga0070700_100140688
709 Ga0070700_100161839
710 Ga0070694_100557579
711 Ga0070708_101433016
712 Ga0070663_100374374
713 Ga0070678_100347236
714 Ga0070678_100596475
715 Ga0070662_100122858
716 Ga0070662_100452395
717 Ga0070662_100621395
718 Ga0070681_10531356
719 Ga0068867_100042042
720 Ga0070685_10217191
721 Ga0070698_101583955
722 Ga0070684_100000197
723 Ga0070684_100242148
724 Ga0070672_100050301
725 Ga0070672_100082637
726 Ga0070672_100310224
727 Ga0070672_100943447
728 Ga0070686_100051399
729 Ga0070686_100104392
730 Ga0070695_100127331
731 Ga0070695_100518949
732 Ga0070696_100096412
733 Ga0070696_100253982
734 Ga0070665_101463704
735 Ga0070704_100082919
736 Ga0070704_100472202
737 Ga0068855_100071486
738 Ga0070664_100017763
739 Ga0070664_100367889
740 Ga0070664_100455435
741 Ga0070664_100686792
742 Ga0068857_100020877
743 Ga0068857_100112910
744 Ga0068854_100081712
745 Ga0068856_100137306
746 Ga0070702_100221429
747 Ga0070702_100537688
748 Ga0068852_100107388
749 Ga0068852_100333319
750 Ga0068852_100522131
751 Ga0068852_101380756
752 Ga0068859_100722002
753 Ga0068864_100214972
754 Ga0068864_100445980
755 Ga0068864_100599062
756 Ga0068864_100621402
757 Ga0068866_10109935
758 Ga0068861_100330954
759 Ga0068861_100977198
760 Ga0068863_100428793
761 Ga0068858_100097516
762 Ga0068858_100171162
763 Ga0068858_102221717
764 Ga0068860_100293475
765 Ga0068860_101456112
766 Ga0068862_100031034
767 Ga0068862_100308959
768 Ga0068862_100436266
769 Ga0075368_10013519
770 Ga0075368_10030284
771 Ga0075364_10015953
772 Ga0075364_10020090
773 Ga0075364_10116342
774 Ga0075364_10269092
775 Ga0075362_10003003
776 Ga0075367_10051603
777 Ga0075367_10055721
778 Ga0075367_10126858
779 Ga0075367_10392517
780 Ga0075366_10012227
781 Ga0075366_10014422
782 Ga0075366_10019532
783 Ga0068871_100839605
784 Ga0075428_100000086
785 Ga0075428_100000851
786 Ga0075428_100011531
787 Ga0075428_100072724
788 Ga0075428_100147909
789 Ga0075428_100385334
790 Ga0075430_100000028
791 Ga0075430_100003939
792 Ga0075430_100100977
793 Ga0075430_100215896
794 Ga0075430_100224506
795 Ga0075430_100788896
796 Ga0075430_100982735
797 Ga0075431_100003561
798 Ga0075431_100003906
799 Ga0075431_100008395
800 Ga0075431_100025573
801 Ga0075431_100028998
802 Ga0075433_10680608
803 Ga0075433_10803368
804 Ga0075434_100014747
805 Ga0075434_100057950
806 Ga0075434_100099105
807 Ga0075434_100124803
808 Ga0075434_100158798
809 Ga0075434_100541512
810 Ga0075429_100004161
811 Ga0075429_100009460
812 Ga0075429_100234594
813 Ga0068865_100428939
814 Ga0097620_100721950
815 Ga0075435_100007712
816 Ga0075435_100181068
817 Ga0075435_100491609
818 Ga0111539_10000166
819 Ga0111539_10002921
820 Ga0111539_10030999
821 Ga0111539_10171564
822 Ga0111539_10204135
823 Ga0111539_10234879
824 Ga0111539_10369156
825 Ga0111539_10477545
826 Ga0111539_11603689
827 Ga0105245_10031695
828 Ga0114129_10000148
829 Ga0114129_10009548
830 Ga0114129_10011187
831 Ga0114129_10023952
832 Ga0114129_10037536
833 Ga0114129_10105036
834 Ga0114129_11168944
835 Ga0114129_11468637
836 Ga0114129_12712461
837 Ga0105243_10173550
838 Ga0105243_10264994
839 Ga0105242_10266809
840 Ga0105248_10078408
841 Ga0105248_10101547
842 Ga0105248_12114427
843 Ga0105238_10975143
844 Ga0105249_10001419
845 Ga0105249_10047348
846 Ga0105249_10153149
847 Ga0105249_10764869
848 Ga0105249_10977185
849 Ga0105239_10954371
850 Ga0105246_10031741
851 Ga0105246_10476444
852 Ga0105246_10650727
853 Ga0157319_1012980
854 Ga0157370_10085448
855 Ga0157378_10623033
856 Ga0163162_10540360
857 Ga0157372_10294861
858 Ga0157372_10733921
859 Ga0157375_10134489
860 Ga0157375_10798440
861 Ga0157375_11502014
862 Ga0163163_10017401
863 Ga0163163_10021873
864 Ga0163163_10100057
865 Ga0163163_10777411
866 Ga0157380_10005238
867 Ga0157380_10155114
868 Ga0157380_10370809
869 Ga0157377_10081010
870 Ga0157377_10591846
871 Ga0157379_11724492
872 Ga0157379_12048041
873 Ga0157376_10157966
874 Ga0207697_10001424
875 Ga0207697_10004300
876 Ga0207697_10228758
877 Ga0207642_10038047
878 Ga0207688_10003623
879 Ga0207645_10056933
880 Ga0207645_10456550
881 Ga0207707_10533317
882 Ga0207663_10299103
883 Ga0207662_10002412
884 Ga0207657_10161323
885 Ga0207649_10004649
886 Ga0207649_10113277
887 Ga0207646_10736834
888 Ga0207681_10022927
889 Ga0207681_10035486
890 Ga0207681_10182898
891 Ga0207681_10852723
892 Ga0207694_10264722
893 Ga0207650_10018735
894 Ga0207650_10038902
895 Ga0207650_10039356
896 Ga0207650_10730006
897 Ga0207659_10023246
898 Ga0207659_10059389
899 Ga0207659_10067332
900 Ga0207700_10064887
901 Ga0207644_10042387
902 Ga0207690_10094981
903 Ga0207690_10140402
904 Ga0207706_10053048
905 Ga0207706_10150760
906 Ga0207706_11718161
907 Ga0207709_11022501
908 Ga0207670_10033215
909 Ga0207670_11215914
910 Ga0207669_10071225
911 Ga0207669_10294645
912 Ga0207669_10375297
913 Ga0207669_11377233
914 Ga0207704_10260641
915 Ga0207691_10064592
916 Ga0207691_10094696
917 Ga0207691_10831306
918 Ga0207711_10067984
919 Ga0207711_10115425
920 Ga0207689_10018996
921 Ga0207661_10001796
922 Ga0207661_10171087
923 Ga0207661_10307641
924 Ga0207679_10011845
925 Ga0207679_10245954
926 Ga0207679_10248092
927 Ga0207679_11080764
928 Ga0207651_10010645
929 Ga0207651_10055721
930 Ga0207712_10003730
931 Ga0207712_10048697
932 Ga0207712_10286102
933 Ga0207712_10651550
934 Ga0207668_10114916
935 Ga0207668_10622488
936 Ga0207640_10033040
937 Ga0207658_10057684
938 Ga0207658_10239897
939 Ga0207677_10325750
940 Ga0207703_10821092
941 Ga0207703_11050951
942 Ga0207678_10045667
943 Ga0207678_10223046
944 Ga0207708_10003569
945 Ga0207702_10120575
946 Ga0207641_10047702
947 Ga0207641_10277063
948 Ga0207641_10309390
949 Ga0207641_11733279
950 Ga0207648_10565149
951 Ga0207676_10506278
952 Ga0207676_10535334
953 Ga0207674_10028604
954 Ga0207674_10091727
955 Ga0207675_100013531
956 Ga0207683_10261903
957 Ga0207683_11159318
958 Ga0207698_10030000
959 Ga0207698_10049477
960 Ga0207698_10308464
961 Ga0207698_11977124
962 Ga0209813_10009426
963 Ga0209813_10043804
964 Ga0207428_10000251
965 Ga0207428_10070323
966 Ga0207428_10120662
967 Ga0207428_10384398
968 Ga0268266_10236576
969 Ga0268265_10009754
970 Ga0268265_10851041
971 Ga0268265_11674037
972 Ga0268264_10227696
973 Ga0307408_100005089
974 Ga0307408_100016094
975 Ga0307408_100029178
976 Ga0307408_100036391
977 Ga0307408_100068855
978 Ga0307408_100138421
979 Ga0307408_100464583
980 Ga0307405_10090805
981 Ga0307405_10245407
982 Ga0307405_10412455
983 Ga0307413_10052711
984 Ga0307413_10104991
985 Ga0307413_10146864
986 Ga0307413_10634527
987 Ga0307410_10272264
988 Ga0307410_10576817
989 Ga0307410_11035620
990 Ga0307410_11356326
991 Ga0307406_10279632
992 Ga0307406_11117381
993 Ga0307406_11496141
994 Ga0307407_10011022
995 Ga0307407_10169978
996 Ga0307407_10300048
997 Ga0307407_10524421
998 Ga0307407_10897729
999 Ga0307412_10114951
1000 Ga0307412_10494204
1001 Ga0307412_11144095
1002 Ga0307409_100010108
1003 Ga0307409_100032168
1004 Ga0307409_100409598
1005 Ga0307409_100512078
1006 Ga0307409_101740740
1007 Ga0307416_100020517
1008 Ga0307416_100032467
1009 Ga0307416_100053124
1010 Ga0307416_100070020
1011 Ga0307416_100123434
1012 Ga0307416_100185610
1013 Ga0307416_100213822
1014 Ga0307416_100382228
1015 Ga0307416_100385430
1016 Ga0307416_101204798
1017 Ga0307416_101560941
1018 Ga0307414_10017875
1019 Ga0307414_11065215
1020 Ga0307411_10012926
1021 Ga0307411_10065564
1022 Ga0307411_10078884
1023 Ga0307411_10662786
1024 Ga0307411_10865871
1025 Ga0307411_11195149
1026 Ga0307411_11710835
1027 Ga0307415_100054385
1028 Ga0307415_100555087
1029 Ga0307415_100647941
1030 Ga0307415_101188334
1031 Ga0373930_0081277
1032 Ga0373945_0150086
1033 Ga0373960_0242855
1034 Ga0373946_0122626
1035 Ga0373946_0391511
1036 Ga0373955_0641930
1037 Ga0373931_0271627
1038 Ga0373931_0641169
1039 Ga0373935_0180870
1040 Ga0373935_0624745
1041 Ga0373933_0025842
1042 Ga0373947_0039181
1043 Ga0373937_0000242
1044 Ga0373925_0009079
1045 Ga0439436_0123302
1046 Ga0439461_0026419
1047 Ga0439461_0163496
1048 Ga0439431_0005547
1049 Ga0439433_0017246
1050 Ga0439441_052609
1051 Ga0439449_0072377
1052 Ga0439449_0123663
1053 Ga0439450_000724
1054 Ga0439450_191468
1055 Ga0439454_012336
1056 Ga0439456_101450
1057 Ga0439462_0015879
1058 Ga0439462_0022639
1059 Ga0450923_011779
1060 Ga0450898_017685
1061 Ga0439446_0004581
1062 Ga0439446_0010382
1063 Ga0439446_0020101
1064 Ga0439446_0025904
1065 Ga0450908_025858
1066 Ga0439434_0024486
1067 Ga0439435_0008109
1068 Ga0439435_0092645
1069 Ga0439435_0099563
1070 Ga0439444_0011271
1071 Ga0439464_0013278
1072 Ga0439464_0024583
1073 Ga0439460_0011320
1074 Ga0439460_0021589
1075 Ga0439460_0030943
1076 Ga0466964_0251764
1077 Ga0495634_0244988
1078 Ga0495658_0720216
1079 Ga0495674_0244187
1080 Ga0495676_0679357
1081 Ga0496100_0625906
1082 Ga0496100_0979558
1083 Ga0496102_0511055
1084 Ga0496104_0002010
1085 Ga0496105_0004105
1086 Ga0496106_0185483
1087 Ga0496107_1237631
1088 Ga0496108_0043652
1089 Ga0496108_0053798
1090 Ga0496108_0731671
1091 Ga0496109_0000421
1092 Ga0496109_0052467
1093 Ga0496109_1654454
1094 Ga0496110_0005760
1095 Ga0496110_0554800
1096 Ga0496111_0001922
1097 Ga0496112_0000526
1098 Ga0496112_0274783
1099 Ga0496112_0524488
1100 Ga0496113_0163806
1101 Ga0496113_0330261
1102 Ga0496114_0290341
1103 Ga0501292_021341
1104 Ga0501296_008107
1105 Ga0501031_0015981
1106 Ga0501031_0782461
1107 Ga0501032_0037955
1108 Ga0501032_0125246
1109 Ga0501033_0086612
1110 Ga0501033_0695811
1111 Ga0501033_0719378
1112 Ga0501034_0003973
1113 Ga0501034_0007758
1114 Ga0501034_0027190
1115 Ga0501034_0089858
1116 Ga0501036_0019348
1117 Ga0501036_0071746
1118 Ga0501036_0094155
1119 Ga0501036_0462197
1120 Ga0501036_0640377
1121 Ga0501036_0792543
1122 Ga0501036_1481907
1123 Ga0501037_0027228
1124 Ga0501037_0294841
1125 Ga0501038_0010546
1126 Ga0501038_0336769
1127 Ga0501038_0548731
1128 Ga0501039_0015384
1129 Ga0501039_0056096
1130 Ga0501039_0319120
1131 Ga0501039_0343120
1132 Ga0501039_0660441
1133 Ga0501039_0880228
1134 Ga0501040_0088138
1135 Ga0501040_0146253
1136 Ga0501040_0173260
1137 Ga0501040_0588956
1138 Ga0501041_0178631
1139 Ga0501041_0506940
1140 Ga0501042_0026445
1141 Ga0501042_0080722
1142 Ga0501042_0187107
1143 Ga0501042_0293279
1144 Ga0501043_0039454
1145 Ga0501043_0077663
1146 Ga0501043_0135813
1147 Ga0501043_0799159
1148 Ga0501046_0000738
1149 Ga0501046_0009895
1150 Ga0501046_0039127
1151 Ga0501046_0094539
1152 Ga0501047_0009902
1153 Ga0501047_0043928
1154 Ga0501047_0056165
1155 Ga0501048_0005291
1156 Ga0501048_0066914
1157 Ga0501048_0075928
1158 Ga0501048_0125692
1159 Ga0501048_0195869
1160 Ga0501048_0322917
1161 Ga0501067_0013409
1162 Ga0501067_0521278
1163 Ga0501068_0019964
1164 Ga0501068_0068774
1165 Ga0501068_0216552
1166 Ga0501068_0320294
1167 Ga0501070_0097906
1168 Ga0501070_0169171
1169 Ga0501071_0024397
1170 Ga0501071_0031943
1171 Ga0501071_0735879
1172 Ga0501071_0893305
1173 Ga0501071_1126233
1174 Ga0501072_0019058
1175 Ga0501072_0032146
1176 Ga0501072_0079594
1177 Ga0501072_0358164
1178 Ga0501072_0855557
1179 Ga0501073_0017697
1180 Ga0501073_0025576
1181 Ga0501073_0162473
1182 Ga0501073_0479023
1183 Ga0501074_0012025
1184 Ga0501074_0015206
1185 Ga0501074_0125869
1186 Ga0501075_0083251
1187 Ga0501075_0149670
1188 Ga0501075_0343552
1189 Ga0501076_0007846
1190 Ga0501076_0040538
1191 Ga0501076_0180632
1192 Ga0501076_1596735
1193 Ga0501077_0060979
1194 Ga0501077_0346862
1195 Ga0501198_021755
1196 Ga0501217_173952
1197 Ga0501235_015454
1198 Ga0501221_198641
1199 Ga0501079_0028835
1200 Ga0501079_0089005
1201 Ga0501079_0090366
1202 Ga0501079_0101356
1203 Ga0501079_0288894
1204 Ga0501079_0613828
1205 Ga0501079_0622857
1206 Ga0501080_0005522
1207 Ga0501080_0050711
1208 Ga0501080_0051706
1209 Ga0501080_0216539
1210 Ga0501080_0427145
1211 Ga0501080_0726120
1212 Ga0501080_0745407
1213 Ga0501080_0844192
1214 Ga0501081_0132621
1215 Ga0501081_0187355
1216 Ga0501081_0845014
1217 Ga0501083_0032821
1218 Ga0501083_0082538
1219 Ga0501035_0066994
1220 Ga0501035_0193537
1221 Ga0501035_0202538
1222 Ga0501044_0024584
1223 Ga0501045_0042313
1224 Ga0501045_0107541
1225 Ga0501045_0403982
1226 nmdc:mga03683_279696_c1
1227 nmdc:mga03n38_319487_c1
1228 nmdc:mga00v17_158919_c1
1229 nmdc:mga00v17_4431_c1
1230 nmdc:mga00v17_4630_c1
1231 nmdc:mga0yw44_79892_c1
1232 nmdc:mga0k408_12736_c1
1233 nmdc:mga0k408_4179_c1
1234 nmdc:mga0k408_99939_c2
1235 nmdc:mga06z11_334488_c1
1236 nmdc:mga06z11_49736_c1
1237 nmdc:mga06z11_7040_c1
1238 nmdc:mga04h51_22036_c1
1239 nmdc:mga04h51_5760_c1
1240 nmdc:mga07m45_17395_c1
1241 nmdc:mga05p37_1298754_c1
1242 nmdc:mga05p37_221_c1
1243 nmdc:mga05p37_2601_c2
1244 nmdc:mga05p37_302244_c1
1245 nmdc:mga05p37_33213_c1
1246 nmdc:mga05p37_354057_c1
1247 nmdc:mga05p37_57886_c1
1248 nmdc:mga09592_155909_c1
1249 nmdc:mga09592_25391_c1
1250 nmdc:mga09592_28669_c1
1251 nmdc:mga09592_83536_c1
1252 nmdc:mga0qj67_1087_c1
1253 nmdc:mga0qj67_213772_c1
1254 nmdc:mga0qj67_236739_c1
1255 nmdc:mga0qj67_260289_c1
1256 nmdc:mga0qj67_9271_c1
1257 nmdc:mga0qj67_937364_c1
1258 nmdc:mga06r32_17322_c1
1259 nmdc:mga06r32_20184_c1
1260 nmdc:mga06r32_39645_c1
1261 nmdc:mga06r32_44538_c1
1262 nmdc:mga06r32_94343_c1
1263 nmdc:mga08y16_1126898_c1
1264 nmdc:mga08y16_29848_c1
1265 nmdc:mga08y16_460113_c1
1266 nmdc:mga08y16_464_c1
1267 nmdc:mga08y16_515782_c1
1268 nmdc:mga08y16_760910_c1
1269 nmdc:mga0n895_13401_c1
1270 nmdc:mga0n895_170234_c1
1271 nmdc:mga0n895_170973_c1
1272 nmdc:mga0n895_41387_c1
1273 nmdc:mga0n895_56331_c1
1274 nmdc:mga0n895_690939_c1
1275 nmdc:mga0rr50_167986_c1
1276 nmdc:mga0rr50_181907_c1
1277 nmdc:mga0rr50_24120_c1
1278 nmdc:mga0a205_228666_c1
1279 nmdc:mga0a205_39047_c1
1280 nmdc:mga0a205_586481_c1
1281 nmdc:mga0sz30_87978_c1
1282 Ga0495612_0394081
1283 Ga0495619_0306158
1284 Ga0501084_0008125
1285 Ga0501084_0054704
1286 Ga0501084_0105133
1287 Ga0501084_0256506
1288 Ga0501084_0437054
1289 Ga0501084_0452487
1290 Ga0590071_000323
1291 Ga0590071_096903
1292 Ga0590074_000501
1293 Ga0590075_000746
1294 Ga0590075_120704
1295 Ga0590075_142651
1296 Ga0590077_000781
1297 Ga0501082_0015121
1298 Ga0501082_0048338
1299 Ga0501082_0330355
1300 Ga0501082_0357866
1301 Ga0501082_0429720
1302 Ga0501082_0934749
1303 Ga0530510_0159727
1304 Ga0530510_0321515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18480

DUF5615

Domain of unknown function (DUF5615)

18

114

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fdb-assembly1.cif.gz_A-2 crystal structure of a putative plp-dependent beta-cystathionase (aecd, dip1736) from corynebacterium diphtheriae at 1.99 a resolution 0.6036 18 96
3f9t-assembly1.cif.gz_B crystal structure of l-tyrosine decarboxylase mfna (ec 4.1.1.25) (np_247014.1) from methanococcus jannaschii at 2.11 a resolution 0.5548 6 98
6jy1-assembly1.cif.gz_A-2 crystal structure of a group ii pyridoxal dependent decarboxylase, llp-bound form from methanocaldococcus jannaschii at 1.72 a 0.5515 6 98
6lds-assembly1.cif.gz_A structure of a k245a mutant of l-tyrosine decarboxylase from methanocaldococcus jannaschii complexed with l-tyr: external aldimine form 0.551 6 97
7x4l-assembly1.cif.gz_A crystal structure of bacteroides thetaiotaomicron glutamate decarboxylase mutant y303f-plp complex 0.5416 6 97
ID Description Score Start End Superfamily
af_O53465_13_96_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.714 21 83 3.40.50.1010
af_Q9VTZ4_328_449_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.7107 18 67 3.40.120.10
af_Q2G0U3_93_276_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.6224 16 67 3.40.190.290
3fdbA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.6057 18 96 3.40.640.10
af_A0A1D8PL85_69_320_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.58 17 96 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A7W0R7R1-F1-model_v4 DUF5615 family PIN-like protein 0.9959 15 134
AF-A0A2V8HT40-F1-model_v4 DUF5615 domain-containing protein 0.9947 17 136
AF-A0A2V8GD34-F1-model_v4 DUF5615 domain-containing protein 0.9914 14 135
AF-A0A1F2TZV0-F1-model_v4 DUF5615 domain-containing protein 0.99 16 133
AF-A0A7C7UU28-F1-model_v4 DUF5615 domain-containing protein 0.9324 20 118

Map