F472571

General Info

Members Datasets Scaffolds Average Seq Length
651 340 547 346

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10000548|Ga0065714_100005482
Length 391
Sequence MIVPTLCVGMQPGTLGVPKADAERPLMHSHAERGNDYQENNMRIGLVGYGHGGRFFHAPLISSLPAATFVGVVTRSPERRQLLAAEHPGVPAFDSIGQLVEAGIDVLVVSTPLKGRPALVLDGIEHGVAVVSDKPFAADAQQAQTLITMAERQGVQLSVYQNRRWDSDFLTVRKLIESGALGQVTRFESRIERYSPQAVNNGSGGGFLRDLGSHLVDQALLLFGPVTRVYAELDYLEKGQAFDNGFFMSLTHASGVTSHLGGSCLQNTPGPRFRVTGSQGCYSVDGLDGQEASALAGLSPKSEGERWGVEEHRRWGWFEQGEVRERVPSERGCWNQFYLQLQTALQSGGPLPVDARDALATTRVLDAARLSAERHQVVELSPFKSHGIKSE

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231014 Pseudomonas sp. GM48 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231019 Pseudomonas sp. GM67 Isolate Nodule
9 2511231021 Pseudomonas sp. GM78 Isolate Nodule
10 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
11 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
12 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
13 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
14 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
15 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
16 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
17 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
18 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
19 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
20 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
21 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
22 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
23 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
24 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
25 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
26 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
27 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
28 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
29 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
30 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
31 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
32 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
33 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
34 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
35 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
36 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
37 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
38 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
39 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
40 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
41 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
42 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
43 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
44 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
45 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
46 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
47 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
48 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
49 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
50 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
51 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
52 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
53 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
54 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
55 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
56 2773857670 Pseudomonas sp. 478 Isolate Unclassified
57 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
58 2784132072 Pseudomonas sp. 460 Isolate Unclassified
59 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
60 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
61 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
62 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
63 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
64 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
65 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
66 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
67 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
68 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
69 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
70 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
71 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
72 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
73 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
74 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
75 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
76 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
77 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
78 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
79 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
80 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
81 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
82 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
83 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
84 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
85 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
86 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
87 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
88 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
89 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
90 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
91 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
92 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
93 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
94 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
95 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
96 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
97 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
98 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
99 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
100 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
101 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
102 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
103 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
104 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
105 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
106 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
107 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
108 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
109 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
110 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
111 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
112 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
113 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
114 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
115 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
116 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
117 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
118 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
119 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
120 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
121 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
122 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
123 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
124 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
127 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
130 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
133 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
145 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
146 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
151 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
152 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
162 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
210 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
211 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
212 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
213 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
214 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
215 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
216 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
217 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
218 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
219 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
220 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
221 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
222 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
223 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
224 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
225 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
226 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
227 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
228 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
229 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
234 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
235 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
236 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
237 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
238 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
295 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
296 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
297 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
298 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
299 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
320 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
325 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
332 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
333 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
334 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
336 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
337 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
338 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
339 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
340 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.02
Metatranscriptomes 0
Isolates 15.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.45
Nodule 1.54
Rhizoplane 8.91
Rhizosphere 73.89
Stem 0
Stem Tuber 0
Unclassified 9.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_11 2124908027 Bacteria 54720
2 SwRhRL2b_contig_1122291 2162886007 Bacteria 5502
3 JGI25162J39368_1000060 3300002737 Bacteria 137745
4 JGI25163J39215_1000792 3300002771 Bacteria 7675
5 JGI25164J39214_1000037 3300002772 Bacteria 137530
6 JGI25165J46597_1000118 3300003214 Bacteria 137530
7 Ga0055538_1000158 3300003751 Bacteria 45679
8 Ga0055539_1000208 3300003752 Bacteria 45679
9 Ga0055533_1000209 3300003756 Bacteria 45679
10 Ga0055532_1000214 3300003758 Bacteria 45671
11 Ga0055525_1000287 3300003759 Bacteria 45679
12 Ga0055536_1000046 3300003781 Bacteria 118284
13 Ga0055530_10000133 3300003791 Bacteria 65211
14 Ga0055530_10000373 3300003791 Bacteria 40491
15 Ga0055540_1000070 3300003792 Bacteria 118483
16 Ga0055540_1000168 3300003792 Bacteria 65211
17 Ga0055541_1000067 3300003841 Bacteria 99013
18 Ga0065714_10000548 3300005288 Bacteria 4168
19 Ga0065714_10014210 3300005288 Bacteria 3017
20 Ga0065714_10064673 3300005288 Bacteria 24513
21 Ga0065714_10138475 3300005288 Bacteria 1190
22 Ga0065704_10002589 3300005289 Bacteria 8396
23 Ga0070670_100101802 3300005331 Bacteria 2473
24 Ga0070677_10002370 3300005333 Bacteria 6019
25 Ga0070666_10056923 3300005335 Bacteria 2641
26 Ga0070668_100232101 3300005347 Bacteria 1526
27 Ga0070669_100043365 3300005353 Bacteria 3276
28 Ga0070675_100009872 3300005354 Bacteria 7441
29 Ga0070667_100011368 3300005367 Bacteria 7360
30 Ga0070678_100230010 3300005456 Bacteria 1545
31 Ga0070662_100094493 3300005457 Bacteria 2251
32 Ga0070698_100184684 3300005471 Bacteria 2023
33 Ga0070664_100002081 3300005564 Bacteria 15990
34 Ga0075364_10120357 3300006051 Bacteria 1757
35 Ga0079104_1000823 3300006946 Bacteria 25811
36 Ga0099826_10006487 3300006948 Bacteria 8530
37 Ga0105251_10003948 3300009011 Bacteria 10517
38 Ga0105251_10027263 3300009011 Bacteria 2899
39 Ga0105251_10064332 3300009011 Bacteria 1720
40 Ga0105244_10002493 3300009036 Bacteria 13859
41 Ga0105244_10004498 3300009036 Bacteria 9575
42 Ga0105244_10010865 3300009036 Bacteria 5496
43 Ga0105244_10088853 3300009036 Bacteria 1521
44 Ga0105250_10001079 3300009092 Bacteria 15444
45 Ga0105250_10020997 3300009092 Bacteria 2637
46 Ga0105245_10029428 3300009098 Bacteria 4852
47 Ga0105245_10129308 3300009098 Bacteria 2367
48 Ga0105243_10000045 3300009148 Bacteria 156620
49 Ga0105242_10058672 3300009176 Bacteria 3156
50 Ga0105246_10006450 3300011119 Bacteria 7168
51 Ga0105246_10042493 3300011119 Bacteria 3079
52 Ga0105246_10160175 3300011119 Bacteria 1713
53 Ga0157373_10000819 3300013100 Bacteria 24092
54 Ga0157371_10012245 3300013102 Bacteria 6567
55 Ga0157370_10166047 3300013104 Bacteria 2053
56 Ga0163162_10233883 3300013306 Bacteria 1968
57 Ga0163162_10348567 3300013306 Bacteria 1613
58 Ga0157375_10356087 3300013308 Bacteria 1630
59 Ga0182008_10024943 3300014497 Bacteria 3041
60 Ga0182008_10035139 3300014497 Bacteria 2512
61 Ga0182006_1004220 3300015261 Bacteria 7123
62 Ga0182006_1008963 3300015261 Bacteria 4512
63 Ga0182006_1040659 3300015261 Bacteria 1829
64 Ga0182007_10000177 3300015262 Bacteria 43427
65 Ga0182007_10021277 3300015262 Bacteria 2306
66 Ga0182005_1003224 3300015265 Bacteria 5579
67 Ga0182005_1008785 3300015265 Bacteria 2966
68 Ga0163161_10075624 3300017792 Bacteria 2472
69 Ga0163161_10279784 3300017792 Bacteria 1308
70 Ga0213874_10054497 3300021377 Bacteria 1236
71 Ga0213876_10014059 3300021384 Bacteria 4245
72 Ga0213875_10095134 3300021388 Bacteria 1389
73 Ga0209435_101168 3300025206 Bacteria 3590
74 Ga0209760_100023 3300025207 Bacteria 159144
75 Ga0209784_100058 3300025224 Bacteria 167327
76 Ga0209566_100045 3300025225 Bacteria 258557
77 Ga0209674_100096 3300025226 Bacteria 167418
78 Ga0209147_100056 3300025229 Bacteria 258557
79 Ga0209563_100064 3300025230 Bacteria 258557
80 Ga0207427_100018 3300025231 Bacteria 530735
81 Ga0209437_100031 3300025233 Bacteria 530871
82 Ga0209258_100446 3300025242 Bacteria 45941
83 Ga0209646_1000147 3300025246 Bacteria 103287
84 Ga0209677_100053 3300025253 Bacteria 167537
85 Ga0209233_1000012 3300025261 Bacteria 1019519
86 Ga0209676_1000055 3300025292 Bacteria 361565
87 Ga0209676_1001524 3300025292 Bacteria 21049
88 Ga0209050_1000043 3300025298 Bacteria 398654
89 Ga0209050_1000231 3300025298 Bacteria 122373
90 Ga0209051_1000030 3300025303 Bacteria 398654
91 Ga0209051_1000165 3300025303 Bacteria 122373
92 Ga0209051_1003240 3300025303 Bacteria 10826
93 Ga0209257_1000767 3300025304 Bacteria 47879
94 Ga0209257_1007776 3300025304 Bacteria 6362
95 Ga0207697_10008336 3300025315 Bacteria 4544
96 Ga0207696_1000041 3300025711 Bacteria 311695
97 Ga0207696_1000628 3300025711 Bacteria 25903
98 Ga0207655_1000085 3300025728 Bacteria 206425
99 Ga0207655_1000141 3300025728 Bacteria 138956
100 Ga0207655_1019266 3300025728 Bacteria 3576
101 Ga0207655_1030383 3300025728 Bacteria 2513
102 Ga0207655_1033394 3300025728 Bacteria 2333
103 Ga0207713_1001279 3300025735 Bacteria 20735
104 Ga0207713_1029754 3300025735 Bacteria 2441
105 Ga0207682_10002517 3300025893 Bacteria 8190
106 Ga0207680_10042627 3300025903 Bacteria 2656
107 Ga0207645_10004346 3300025907 Bacteria 10495
108 Ga0207681_10007454 3300025923 Bacteria 6705
109 Ga0207650_10102897 3300025925 Bacteria 2201
110 Ga0207706_10031488 3300025933 Bacteria 4725
111 Ga0207686_10126289 3300025934 Bacteria 1748
112 Ga0207709_10000011 3300025935 Bacteria 552881
113 Ga0207709_10207178 3300025935 Bacteria 1405
114 Ga0207691_10002435 3300025940 Bacteria 18208
115 Ga0207679_10031184 3300025945 Bacteria 3730
116 Ga0207651_10263124 3300025960 Bacteria 1417
117 Ga0207683_10009799 3300026121 Bacteria 8171
118 Ga0209281_1000009 3300027111 Bacteria 771717
119 Ga0207428_10001057 3300027907 Bacteria 30209
120 Ga0207428_10078079 3300027907 Bacteria 2591
121 Ga0207428_10089847 3300027907 Bacteria 2387
122 Ga0316181_1147544 3300030744 Bacteria 2598
123 Ga0265340_10000078 3300031247 Bacteria 46872
124 Ga0307513_10000671 3300031456 Bacteria 49068
125 Ga0307408_100000480 3300031548 Bacteria 34947
126 Ga0307408_100003833 3300031548 Bacteria 10233
127 Ga0307408_100009042 3300031548 Bacteria 6579
128 Ga0307408_100023893 3300031548 Bacteria 4167
129 Ga0307408_100032366 3300031548 Bacteria 3645
130 Ga0307408_100088722 3300031548 Bacteria 2330
131 Ga0307408_100140620 3300031548 Bacteria 1894
132 Ga0307408_100163890 3300031548 Bacteria 1768
133 Ga0307408_100186627 3300031548 Bacteria 1667
134 Ga0307408_100196543 3300031548 Bacteria 1629
135 Ga0307408_100198859 3300031548 Bacteria 1620
136 Ga0307405_10002090 3300031731 Bacteria 8705
137 Ga0307405_10003259 3300031731 Bacteria 7407
138 Ga0307405_10058184 3300031731 Bacteria 2431
139 Ga0307405_10069907 3300031731 Bacteria 2252
140 Ga0307413_10016367 3300031824 Bacteria 3828
141 Ga0307413_10022403 3300031824 Bacteria 3404
142 Ga0307413_10033700 3300031824 Bacteria 2919
143 Ga0307413_10061829 3300031824 Bacteria 2313
144 Ga0307413_10292412 3300031824 Bacteria 1231
145 Ga0307410_10045466 3300031852 Bacteria 2923
146 Ga0307410_10094229 3300031852 Bacteria 2132
147 Ga0307410_10231487 3300031852 Bacteria 1427
148 Ga0307406_10049754 3300031901 Bacteria 2653
149 Ga0307406_10061025 3300031901 Bacteria 2433
150 Ga0307406_10096580 3300031901 Bacteria 2002
151 Ga0307406_10097583 3300031901 Bacteria 1993
152 Ga0307407_10012207 3300031903 Bacteria 4122
153 Ga0307407_10031947 3300031903 Bacteria 2856
154 Ga0307407_10032742 3300031903 Bacteria 2830
155 Ga0307407_10089561 3300031903 Bacteria 1882
156 Ga0307407_10142664 3300031903 Bacteria 1547
157 Ga0307412_10000254 3300031911 Bacteria 34625
158 Ga0307412_10001950 3300031911 Bacteria 11412
159 Ga0307412_10014413 3300031911 Bacteria 4661
160 Ga0307412_10030830 3300031911 Bacteria 3381
161 Ga0307412_10031452 3300031911 Bacteria 3352
162 Ga0307412_10033748 3300031911 Bacteria 3255
163 Ga0307412_10075179 3300031911 Bacteria 2316
164 Ga0307412_10189035 3300031911 Bacteria 1555
165 Ga0307409_100041255 3300031995 Bacteria 3445
166 Ga0307409_100056642 3300031995 Bacteria 3032
167 Ga0307409_100103847 3300031995 Bacteria 2365
168 Ga0307416_100035724 3300032002 Bacteria 3800
169 Ga0307416_100058272 3300032002 Bacteria 3130
170 Ga0307416_100172350 3300032002 Bacteria 2016
171 Ga0307416_100351194 3300032002 Bacteria 1492
172 Ga0307416_100403265 3300032002 Bacteria 1405
173 Ga0307416_100512785 3300032002 Bacteria 1266
174 Ga0307414_10036060 3300032004 Bacteria 3297
175 Ga0307414_10069042 3300032004 Bacteria 2539
176 Ga0307414_10349286 3300032004 Bacteria 1269
177 Ga0307411_10026491 3300032005 Bacteria 3492
178 Ga0307411_10028873 3300032005 Bacteria 3378
179 Ga0307411_10125050 3300032005 Bacteria 1868
180 Ga0307415_100107380 3300032126 Bacteria 2062
181 Ga0307415_100421685 3300032126 Bacteria 1145
182 Ga0373956_0000852 3300035119 Bacteria 12692
183 Ga0395899_0020869 3300037312 Bacteria 4968
184 Ga0395900_0144017 3300037418 Bacteria 2438
185 Ga0395898_0064475 3300037466 Bacteria 3553
186 Ga0436364_0277731 3300037853 Bacteria 7014
187 Ga0436364_0510689 3300037853 Bacteria 9633
188 Ga0395901_0031846 3300038443 Bacteria 5437
189 Ga0395901_0041041 3300038443 Bacteria 4794
190 Ga0395901_0086408 3300038443 Bacteria 3279
191 Ga0436365_0623832 3300039437 Bacteria 4245
192 Ga0436365_1685261 3300039437 Bacteria 3556
193 Ga0436360_0229073 3300039438 Bacteria 1759
194 Ga0439438_005931 3300041405 Bacteria 4409
195 Ga0439438_010402 3300041405 Bacteria 2942
196 Ga0439438_012718 3300041405 Bacteria 2568
197 Ga0439438_014038 3300041405 Bacteria 2394
198 Ga0439447_008800 3300041407 Bacteria 3103
199 Ga0439447_010615 3300041407 Bacteria 2725
200 Ga0439447_019574 3300041407 Bacteria 1803
201 Ga0439466_0040439 3300041411 Bacteria 1559
202 Ga0439433_0022638 3300041999 Bacteria 1411
203 Ga0439442_000424 3300042002 Bacteria 9735
204 Ga0439445_0042466 3300042004 Bacteria 1211
205 Ga0439432_025694 3300042006 Bacteria 1930
206 Ga0439451_002893 3300042009 Bacteria 3490
207 Ga0439451_005181 3300042009 Bacteria 2651
208 Ga0439451_014668 3300042009 Bacteria 1580
209 Ga0439452_025118 3300042010 Bacteria 1515
210 Ga0439452_025541 3300042010 Bacteria 1498
211 Ga0439456_006139 3300042013 Bacteria 2445
212 Ga0439456_008694 3300042013 Bacteria 2097
213 Ga0439456_009932 3300042013 Bacteria 1964
214 Ga0439463_000317 3300042016 Bacteria 13525
215 Ga0439463_022499 3300042016 Bacteria 1577
216 Ga0450911_002130 3300042115 Bacteria 4043
217 Ga0450919_002357 3300042121 Bacteria 2447
218 Ga0450919_004630 3300042121 Bacteria 1676
219 Ga0450920_000141 3300042122 Bacteria 10055
220 Ga0450902_013843 3300042137 Bacteria 1301
221 Ga0450903_005504 3300042138 Bacteria 2118
222 Ga0450906_003237 3300042145 Bacteria 3514
223 Ga0450907_000010 3300042146 Bacteria 95376
224 Ga0450907_000256 3300042146 Bacteria 18128
225 Ga0450907_002430 3300042146 Bacteria 3553
226 Ga0450907_011097 3300042146 Bacteria 1496
227 Ga0450910_003445 3300042147 Bacteria 2102
228 Ga0439446_0002445 3300042156 Bacteria 4455
229 Ga0450909_001023 3300042185 Bacteria 3844
230 Ga0450909_006155 3300042185 Bacteria 1731
231 Ga0439434_0000301 3300042435 Bacteria 14180
232 Ga0439434_0000947 3300042435 Bacteria 8356
233 Ga0439434_0023749 3300042435 Bacteria 1847
234 Ga0439464_0008430 3300042439 Bacteria 2700
235 Ga0439460_0005166 3300042461 Bacteria 3198
236 Ga0439460_0020839 3300042461 Bacteria 1785
237 Ga0450918_002140 3300042531 Bacteria 3771
238 Ga0450918_003225 3300042531 Bacteria 3042
239 Ga0439440_0005108 3300042993 Bacteria 2593
240 Ga0495617_000054 3300046452 Bacteria 102256
241 Ga0495617_000144 3300046452 Bacteria 46606
242 Ga0495617_008090 3300046452 Bacteria 3634
243 Ga0495617_012000 3300046452 Bacteria 2955
244 Ga0495617_021113 3300046452 Bacteria 2200
245 Ga0495617_054518 3300046452 Bacteria 1327
246 Ga0495627_000195 3300046453 Bacteria 66451
247 Ga0495627_000308 3300046453 Bacteria 48367
248 Ga0495590_0001206 3300046457 Bacteria 11305
249 Ga0495590_0004191 3300046457 Bacteria 5835
250 Ga0495590_0022988 3300046457 Bacteria 2203
251 Ga0495590_0040867 3300046457 Bacteria 1616
252 Ga0495591_000184 3300046458 Bacteria 64774
253 Ga0495591_000315 3300046458 Bacteria 43798
254 Ga0495591_008305 3300046458 Bacteria 4273
255 Ga0495629_0144367 3300046459 Bacteria 1656
256 Ga0495638_0054510 3300046460 Bacteria 2485
257 Ga0495638_0100229 3300046460 Bacteria 1733
258 Ga0495653_0037631 3300046463 Bacteria 3799
259 Ga0495650_0000881 3300046471 Bacteria 35559
260 Ga0495650_0005496 3300046471 Bacteria 8193
261 Ga0495650_0006867 3300046471 Bacteria 7001
262 Ga0495650_0011574 3300046471 Bacteria 4821
263 Ga0495650_0018023 3300046471 Bacteria 3521
264 Ga0495580_0018269 3300046472 Bacteria 5223
265 Ga0495605_0000045 3300046474 Bacteria 176155
266 Ga0495605_0000191 3300046474 Bacteria 76513
267 Ga0495605_0000563 3300046474 Bacteria 30312
268 Ga0495605_0000794 3300046474 Bacteria 22656
269 Ga0495605_0001618 3300046474 Bacteria 14583
270 Ga0495605_0003671 3300046474 Bacteria 9114
271 Ga0495605_0010840 3300046474 Bacteria 5090
272 Ga0495605_0039013 3300046474 Bacteria 2380
273 Ga0495605_0045075 3300046474 Bacteria 2175
274 Ga0495605_0074486 3300046474 Bacteria 1597
275 Ga0495639_0000032 3300046475 Bacteria 64548
276 Ga0495584_0000409 3300046491 Bacteria 29687
277 Ga0495584_0000547 3300046491 Bacteria 25497
278 Ga0495584_0001764 3300046491 Bacteria 12598
279 Ga0495584_0004919 3300046491 Bacteria 7128
280 Ga0495585_0014976 3300046492 Bacteria 4509
281 Ga0495585_0029734 3300046492 Bacteria 3109
282 Ga0495594_0005294 3300046499 Bacteria 6624
283 Ga0495594_0014081 3300046499 Bacteria 4187
284 Ga0495596_0045500 3300046500 Bacteria 1725
285 Ga0495607_0000058 3300046501 Bacteria 109864
286 Ga0495607_0000172 3300046501 Bacteria 68720
287 Ga0495607_0000179 3300046501 Bacteria 67285
288 Ga0495607_0000185 3300046501 Bacteria 66759
289 Ga0495607_0000290 3300046501 Bacteria 53251
290 Ga0495607_0000617 3300046501 Bacteria 34500
291 Ga0495607_0006225 3300046501 Bacteria 8415
292 Ga0495607_0015398 3300046501 Bacteria 4957
293 Ga0495607_0018916 3300046501 Bacteria 4381
294 Ga0495607_0026196 3300046501 Bacteria 3619
295 Ga0495607_0036726 3300046501 Bacteria 2949
296 Ga0495607_0037319 3300046501 Bacteria 2920
297 Ga0495607_0043695 3300046501 Bacteria 2647
298 Ga0495607_0124378 3300046501 Bacteria 1350
299 Ga0495583_0000101 3300046506 Bacteria 144916
300 Ga0495583_0000483 3300046506 Bacteria 58302
301 Ga0495583_0010856 3300046506 Bacteria 5271
302 Ga0495583_0018184 3300046506 Bacteria 3707
303 Ga0495583_0030833 3300046506 Bacteria 2606
304 Ga0495583_0034050 3300046506 Bacteria 2444
305 Ga0495606_0023383 3300046507 Bacteria 4478
306 Ga0495610_0016642 3300046512 Bacteria 4223
307 Ga0495610_0080746 3300046512 Bacteria 1494
308 Ga0495616_0000226 3300046513 Bacteria 46396
309 Ga0495616_0000661 3300046513 Bacteria 25616
310 Ga0495620_0000001 3300046515 Bacteria 386508
311 Ga0495620_0000166 3300046515 Bacteria 52419
312 Ga0495620_0004341 3300046515 Bacteria 8013
313 Ga0495620_0021166 3300046515 Bacteria 3162
314 Ga0495628_0214004 3300046516 Bacteria 1449
315 Ga0495631_0004644 3300046518 Bacteria 7265
316 Ga0495632_0000754 3300046519 Bacteria 29135
317 Ga0495632_0001740 3300046519 Bacteria 17652
318 Ga0495632_0005660 3300046519 Bacteria 8215
319 Ga0495632_0012766 3300046519 Bacteria 4823
320 Ga0495632_0075121 3300046519 Bacteria 1618
321 Ga0495637_0000037 3300046520 Bacteria 120732
322 Ga0495637_0001374 3300046520 Bacteria 14567
323 Ga0495637_0005663 3300046520 Bacteria 6339
324 Ga0495637_0007143 3300046520 Bacteria 5560
325 Ga0495637_0007481 3300046520 Bacteria 5410
326 Ga0495637_0022921 3300046520 Bacteria 2842
327 Ga0495637_0035457 3300046520 Bacteria 2178
328 Ga0495637_0089276 3300046520 Bacteria 1218
329 Ga0495637_0100027 3300046520 Bacteria 1134
330 Ga0495643_0054830 3300046522 Bacteria 2133
331 Ga0495643_0063085 3300046522 Bacteria 1960
332 Ga0495644_0001264 3300046523 Bacteria 10378
333 Ga0495644_0039961 3300046523 Bacteria 1768
334 Ga0495648_0000377 3300046524 Bacteria 48820
335 Ga0495648_0001506 3300046524 Bacteria 22801
336 Ga0495648_0003808 3300046524 Bacteria 13105
337 Ga0495648_0035448 3300046524 Bacteria 3234
338 Ga0495648_0044645 3300046524 Bacteria 2765
339 Ga0495666_0025173 3300046526 Bacteria 2940
340 Ga0495642_0000316 3300046528 Bacteria 26656
341 Ga0495642_0004676 3300046528 Bacteria 5303
342 Ga0495654_0000211 3300046530 Bacteria 55188
343 Ga0495654_0000288 3300046530 Bacteria 45799
344 Ga0495654_0000306 3300046530 Bacteria 43427
345 Ga0495654_0034876 3300046530 Bacteria 2536
346 Ga0495654_0045858 3300046530 Bacteria 2155
347 Ga0495654_0106925 3300046530 Bacteria 1280
348 Ga0495587_0004867 3300046536 Bacteria 8808
349 Ga0495609_0000012 3300046538 Bacteria 333994
350 Ga0495609_0000075 3300046538 Bacteria 121584
351 Ga0495609_0001135 3300046538 Bacteria 18421
352 Ga0495609_0007500 3300046538 Bacteria 5440
353 Ga0495609_0008213 3300046538 Bacteria 5123
354 Ga0495609_0021359 3300046538 Bacteria 2986
355 Ga0495609_0083086 3300046538 Bacteria 1398
356 Ga0495597_0000037 3300046542 Bacteria 113832
357 Ga0495597_0002922 3300046542 Bacteria 10378
358 Ga0495597_0012793 3300046542 Bacteria 4039
359 Ga0495597_0081160 3300046542 Bacteria 1387
360 Ga0495597_0085407 3300046542 Bacteria 1345
361 Ga0495645_0043191 3300046543 Bacteria 3288
362 Ga0495622_0000590 3300046557 Bacteria 21268
363 Ga0495622_0007970 3300046557 Bacteria 4911
364 Ga0495622_0011228 3300046557 Bacteria 4136
365 Ga0495633_0000016 3300046558 Bacteria 250457
366 Ga0495633_0027993 3300046558 Bacteria 2749
367 Ga0495668_0045796 3300046616 Bacteria 2431
368 Ga0495668_0066283 3300046616 Bacteria 1987
369 Ga0495634_0000025 3300046642 Bacteria 115964
370 Ga0495611_0002012 3300046648 Bacteria 9612
371 Ga0495611_0010268 3300046648 Bacteria 3961
372 Ga0495611_0013449 3300046648 Bacteria 3485
373 Ga0495625_0000089 3300046660 Bacteria 147075
374 Ga0495625_0000847 3300046660 Bacteria 41784
375 Ga0495625_0041066 3300046660 Bacteria 3368
376 Ga0495625_0067950 3300046660 Bacteria 2506
377 Ga0495625_0221259 3300046660 Bacteria 1240
378 Ga0495635_0034169 3300046663 Bacteria 3527
379 Ga0495659_0003525 3300046664 Bacteria 4987
380 Ga0495661_0000004 3300046665 Bacteria 555340
381 Ga0495661_0000018 3300046665 Bacteria 200787
382 Ga0495661_0000101 3300046665 Bacteria 104928
383 Ga0495661_0004052 3300046665 Bacteria 10673
384 Ga0495661_0015996 3300046665 Bacteria 4987
385 Ga0495588_0032710 3300046674 Bacteria 2622
386 Ga0495588_0040469 3300046674 Bacteria 2377
387 Ga0495588_0108909 3300046674 Bacteria 1458
388 Ga0495623_0030482 3300046679 Bacteria 3469
389 Ga0495669_0001097 3300046684 Bacteria 11202
390 Ga0495613_0273456 3300046689 Bacteria 1174
391 Ga0495670_0005615 3300046691 Bacteria 6153
392 Ga0495670_0013939 3300046691 Bacteria 3954
393 Ga0495670_0053980 3300046691 Bacteria 2012
394 Ga0495671_0000295 3300046692 Bacteria 41756
395 Ga0495671_0001060 3300046692 Bacteria 19054
396 Ga0495671_0004032 3300046692 Bacteria 8872
397 Ga0495671_0018255 3300046692 Bacteria 3724
398 Ga0495671_0019721 3300046692 Bacteria 3559
399 Ga0495671_0065191 3300046692 Bacteria 1792
400 Ga0495649_0000013 3300046694 Bacteria 316013
401 Ga0495649_0000909 3300046694 Bacteria 23449
402 Ga0495649_0048419 3300046694 Bacteria 2309
403 Ga0495649_0069656 3300046694 Bacteria 1886
404 Ga0495649_0081914 3300046694 Bacteria 1725
405 Ga0495589_0000141 3300046794 Bacteria 66457
406 Ga0495589_0000422 3300046794 Bacteria 31472
407 Ga0495589_0025067 3300046794 Bacteria 3027
408 Ga0495589_0059160 3300046794 Bacteria 1883
409 Ga0495660_0000638 3300046810 Bacteria 27219
410 Ga0495660_0003263 3300046810 Bacteria 10066
411 Ga0495660_0009554 3300046810 Bacteria 5654
412 Ga0495660_0014526 3300046810 Bacteria 4554
413 Ga0495660_0022659 3300046810 Bacteria 3584
414 Ga0495660_0041165 3300046810 Bacteria 2559
415 Ga0495660_0050079 3300046810 Bacteria 2277
416 Ga0495660_0058798 3300046810 Bacteria 2069
417 Ga0495660_0124783 3300046810 Bacteria 1298
418 Ga0495581_0001774 3300047315 Bacteria 12047
419 Ga0495581_0020492 3300047315 Bacteria 3836
420 Ga0495581_0031915 3300047315 Bacteria 3051
421 Ga0495604_0002087 3300047317 Bacteria 16085
422 Ga0495672_0001978 3300047320 Bacteria 19360
423 Ga0495672_0004789 3300047320 Bacteria 10912
424 Ga0495672_0006656 3300047320 Bacteria 8875
425 Ga0495672_0023786 3300047320 Bacteria 3958
426 Ga0495672_0028056 3300047320 Bacteria 3568
427 Ga0495672_0028983 3300047320 Bacteria 3493
428 Ga0495672_0054995 3300047320 Bacteria 2323
429 Ga0495672_0070543 3300047320 Bacteria 1979
430 Ga0495672_0071995 3300047320 Bacteria 1954
431 Ga0495676_0000020 3300047321 Bacteria 166813
432 Ga0495676_0049626 3300047321 Bacteria 3372
433 Ga0495680_0003983 3300047322 Bacteria 14264
434 Ga0495683_0000063 3300047323 Bacteria 113542
435 Ga0495683_0000765 3300047323 Bacteria 23107
436 Ga0495683_0006189 3300047323 Bacteria 6552
437 Ga0495683_0023975 3300047323 Bacteria 3134
438 Ga0495683_0024980 3300047323 Bacteria 3063
439 Ga0495683_0035032 3300047323 Bacteria 2551
440 Ga0495683_0051312 3300047323 Bacteria 2062
441 Ga0495687_000715 3300047443 Bacteria 36786
442 Ga0495687_004143 3300047443 Bacteria 9986
443 Ga0495687_008394 3300047443 Bacteria 5915
444 Ga0495687_012721 3300047443 Bacteria 4435
445 Ga0495687_048786 3300047443 Bacteria 1814
446 Ga0495677_0005322 3300047445 Bacteria 4881
447 Ga0495679_000079 3300047446 Bacteria 90806
448 Ga0495679_000165 3300047446 Bacteria 59805
449 Ga0495679_000711 3300047446 Bacteria 21533
450 Ga0495679_005912 3300047446 Bacteria 5361
451 Ga0495679_014366 3300047446 Bacteria 2937
452 Ga0495685_047414 3300047447 Bacteria 1461
453 Ga0495673_0000190 3300047469 Bacteria 97539
454 Ga0495673_0000421 3300047469 Bacteria 48148
455 Ga0495673_0000833 3300047469 Bacteria 28784
456 Ga0495673_0002046 3300047469 Bacteria 14767
457 Ga0495673_0005618 3300047469 Bacteria 7540
458 Ga0495673_0007797 3300047469 Bacteria 6097
459 Ga0495673_0026305 3300047469 Bacteria 2783
460 Ga0495673_0028696 3300047469 Bacteria 2633
461 Ga0495673_0034809 3300047469 Bacteria 2326
462 Ga0495673_0072115 3300047469 Bacteria 1450
463 Ga0495681_0000027 3300047470 Bacteria 141884
464 Ga0495681_0000237 3300047470 Bacteria 45823
465 Ga0495681_0004824 3300047470 Bacteria 9129
466 Ga0495681_0004871 3300047470 Bacteria 9074
467 Ga0495681_0016054 3300047470 Bacteria 4217
468 Ga0495686_0049913 3300047472 Bacteria 2630
469 Ga0495593_0034064 3300047673 Bacteria 2771
470 Ga0495614_0067331 3300048089 Bacteria 1541
471 Ga0495626_0000041 3300048091 Bacteria 172663
472 Ga0495626_0000352 3300048091 Bacteria 48007
473 Ga0495626_0005473 3300048091 Bacteria 7412
474 Ga0495626_0011493 3300048091 Bacteria 4681
475 Ga0495626_0015886 3300048091 Bacteria 3841
476 Ga0496102_0000038 3300048905 Bacteria 198844
477 Ga0496102_0015377 3300048905 Bacteria 6665
478 Ga0496102_0028870 3300048905 Bacteria 4958
479 Ga0496103_0010330 3300048906 Bacteria 5524
480 Ga0496103_0033182 3300048906 Bacteria 3153
481 Ga0496103_0148053 3300048906 Bacteria 1503
482 Ga0496104_0173998 3300048907 Bacteria 2063
483 Ga0496104_0197962 3300048907 Bacteria 1921
484 Ga0496105_0069085 3300048908 Bacteria 2919
485 Ga0496105_0087722 3300048908 Bacteria 2570
486 Ga0496105_0127667 3300048908 Bacteria 2096
487 Ga0496106_0057923 3300048909 Bacteria 2931
488 Ga0496106_0113790 3300048909 Bacteria 2109
489 Ga0496109_0085516 3300048912 Bacteria 2911
490 Ga0496109_0457397 3300048912 Bacteria 1205
491 Ga0496110_0028956 3300048913 Bacteria 4761
492 Ga0496110_0273962 3300048913 Bacteria 1536
493 Ga0496110_0332514 3300048913 Bacteria 1384
494 Ga0496110_0395721 3300048913 Bacteria 1259
495 Ga0496111_0173469 3300048914 Bacteria 1602
496 Ga0496114_0141449 3300048917 Bacteria 2083
497 Ga0496115_0095672 3300048918 Bacteria 2431
498 Ga0496115_0382929 3300048918 Bacteria 1144
499 Ga0496116_0000984 3300048919 Bacteria 34981
500 Ga0496116_0034820 3300048919 Bacteria 3545
501 Ga0496116_0137549 3300048919 Bacteria 1380
502 Ga0496117_0032512 3300048920 Bacteria 3962
503 Ga0496117_0036374 3300048920 Bacteria 3684
504 Ga0496117_0067105 3300048920 Bacteria 2429
505 Ga0496118_0024337 3300048921 Bacteria 5228
506 Ga0496118_0038172 3300048921 Bacteria 3853
507 Ga0496118_0066079 3300048921 Bacteria 2641
508 Ga0496118_0098853 3300048921 Bacteria 1980
509 Ga0496119_0012321 3300048922 Bacteria 6959
510 Ga0496121_0004753 3300048924 Bacteria 17930
511 Ga0496121_0007545 3300048924 Bacteria 13107
512 Ga0496122_0025572 3300048925 Bacteria 5122
513 Ga0496122_0185679 3300048925 Bacteria 1233
514 Ga0496123_0038678 3300048926 Bacteria 3349
515 Ga0496123_0060944 3300048926 Bacteria 2429
516 Ga0496124_0000280 3300048927 Bacteria 97221
517 Ga0496124_0003909 3300048927 Bacteria 17810
518 Ga0496124_0098283 3300048927 Bacteria 2376
519 Ga0496124_0100235 3300048927 Bacteria 2348
520 Ga0496124_0129309 3300048927 Bacteria 2008
521 Ga0496125_0048546 3300048928 Bacteria 3538
522 Ga0496126_0057901 3300048929 Bacteria 3495
523 Ga0496126_0060509 3300048929 Bacteria 3405
524 Ga0495678_000036 3300049459 Bacteria 198018
525 Ga0495678_000724 3300049459 Bacteria 29966
526 Ga0495678_001110 3300049459 Bacteria 22429
527 Ga0495678_002190 3300049459 Bacteria 13698
528 Ga0495678_007868 3300049459 Bacteria 5475
529 Ga0495678_011307 3300049459 Bacteria 4278
530 Ga0495678_046306 3300049459 Bacteria 1710
531 Ga0495682_0000020 3300049460 Bacteria 210849
532 Ga0495682_0000065 3300049460 Bacteria 98530
533 Ga0495682_0001677 3300049460 Bacteria 11299
534 Ga0495682_0009847 3300049460 Bacteria 3719
535 Ga0495682_0024863 3300049460 Bacteria 2230
536 Ga0495682_0038743 3300049460 Bacteria 1751
537 Ga0501032_0023484 3300049569 Bacteria 4259
538 Ga0501034_0000480 3300049571 Bacteria 65697
539 Ga0501037_0080952 3300049573 Bacteria 2355
540 Ga0501222_006611 3300049662 Bacteria 1556
541 nmdc:mga00v17_65991_c1 3300050491 Bacteria 2234
542 Ga0500618_008253 3300053125 Bacteria 2921
543 Ga0500618_008300 3300053125 Bacteria 2906
544 Ga0500573_0117685 3300053140 Bacteria 1482
545 Ga0500616_0001659 3300053153 Bacteria 20584
546 Ga0500634_0047057 3300053161 Bacteria 2329
547 Ga0530510_0180133 3300061734 Bacteria 1567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061734 Ga0530510_0180133 Ga0530510_0180133_64_930 277
2 3300042121 Ga0450919_002357 Ga0450919_002357_550_1428 282
3 3300031548 Ga0307408_100032366 Ga0307408_1000323664 306
4 3300031903 Ga0307407_10142664 Ga0307407_101426642 306
5 3300031911 Ga0307412_10189035 Ga0307412_101890351 306
6 3300031824 Ga0307413_10292412 Ga0307413_102924121 308
7 3300039438 Ga0436360_0229073 Ga0436360_0229073_414_1400 317
8 3300046452 Ga0495617_054518 Ga0495617_054518_16_969 317
9 3300048905 Ga0496102_0015377 Ga0496102_0015377_4922_5965 318
10 3300048906 Ga0496103_0010330 Ga0496103_0010330_2826_3869 318
11 3300048912 Ga0496109_0085516 Ga0496109_0085516_535_1578 318
12 3300046471 Ga0495650_0011574 Ga0495650_0011574_24_986 320
13 3300046520 Ga0495637_0089276 Ga0495637_0089276_24_986 320
14 3300031903 Ga0307407_10032742 Ga0307407_100327422 322
15 3300032002 Ga0307416_100172350 Ga0307416_1001723502 322
16 3300032004 Ga0307414_10349286 Ga0307414_103492862 322
17 3300037312 Ga0395899_0020869 Ga0395899_0020869_705_1748 322
18 3300038443 Ga0395901_0041041 Ga0395901_0041041_3690_4733 322
19 3300031548 Ga0307408_100023893 Ga0307408_1000238932 323
20 3300032002 Ga0307416_100351194 Ga0307416_1003511941 323
21 3300031731 Ga0307405_10058184 Ga0307405_100581842 325
22 3300031852 Ga0307410_10094229 Ga0307410_100942292 325
23 3300032126 Ga0307415_100421685 Ga0307415_1004216851 325
24 3300042016 Ga0439463_000317 Ga0439463_000317_11684_12703 329
25 3300014497 Ga0182008_10035139 Ga0182008_100351391 332
26 3300015262 Ga0182007_10021277 Ga0182007_100212771 332
27 2162886007 SwRhRL2b_contig_1122291 SwRhRL2b_0419.00000100 333
28 3300021384 Ga0213876_10014059 Ga0213876_100140595 333
29 3300031548 Ga0307408_100003833 Ga0307408_1000038338 333
30 3300031731 Ga0307405_10069907 Ga0307405_100699072 333
31 3300031824 Ga0307413_10033700 Ga0307413_100337003 333
32 3300031901 Ga0307406_10096580 Ga0307406_100965802 333
33 3300031911 Ga0307412_10014413 Ga0307412_100144133 333
34 3300031911 Ga0307412_10075179 Ga0307412_100751793 333
35 3300032005 Ga0307411_10028873 Ga0307411_100288733 333
36 3300039437 Ga0436365_0623832 Ga0436365_0623832_2779_3813 333
37 iso_pu_bacteria 2775506735 2775657010 333
38 iso_pu_bacteria 2808606357 2808829251 333
39 iso_pu_bacteria 2808606371 2808898445 333
40 iso_pu_bacteria 2811994871 2812319003 333
41 iso_pu_bacteria 2904497146 2904497668 333
42 iso_pu_bacteria 2904776348 2904780690 333
43 iso_pu_bacteria 2910809715 2910812221 333
44 iso_pu_bacteria 2919034639 2919038686 333
45 iso_pu_bacteria 2919059106 2919062494 333
46 iso_pu_bacteria 2919538618 2919539682 333
47 iso_pu_bacteria 2939647034 2939647410 333
48 iso_pu_bacteria 2945956166 2945956447 333
49 iso_pu_bacteria 2946037020 2946041218 333
50 iso_pu_bacteria 2953998280 2953998342 333
51 3300021377 Ga0213874_10054497 Ga0213874_100544971 335
52 3300042016 Ga0439463_022499 Ga0439463_022499_496_1533 335
53 3300047323 Ga0495683_0000765 Ga0495683_0000765_5538_6575 335
54 iso_pu_bacteria 2599185307 2599973749 335
55 iso_pu_bacteria 2738541271 2738690745 335
56 iso_pu_bacteria 2738543016 2739266519 335
57 3300005471 Ga0070698_100184684 Ga0070698_1001846842 336
58 3300031911 Ga0307412_10033748 Ga0307412_100337482 336
59 3300046472 Ga0495580_0018269 Ga0495580_0018269_1984_3024 336
60 3300053153 Ga0500616_0001659 Ga0500616_0001659_14905_15990 336
61 3300009036 Ga0105244_10002493 Ga0105244_100024933 337
62 3300009036 Ga0105244_10088853 Ga0105244_100888532 337
63 3300011119 Ga0105246_10006450 Ga0105246_100064503 337
64 3300011119 Ga0105246_10042493 Ga0105246_100424932 337
65 3300017792 Ga0163161_10279784 Ga0163161_102797841 337
66 3300025303 Ga0209051_1003240 Ga0209051_10032403 337
67 3300025728 Ga0207655_1033394 Ga0207655_10333942 337
68 3300031548 Ga0307408_100000480 Ga0307408_10000048020 337
69 3300031548 Ga0307408_100140620 Ga0307408_1001406202 337
70 3300031548 Ga0307408_100163890 Ga0307408_1001638902 337
71 3300031548 Ga0307408_100196543 Ga0307408_1001965432 337
72 3300031731 Ga0307405_10003259 Ga0307405_100032596 337
73 3300031824 Ga0307413_10061829 Ga0307413_100618292 337
74 3300031852 Ga0307410_10045466 Ga0307410_100454663 337
75 3300031852 Ga0307410_10231487 Ga0307410_102314871 337
76 3300031901 Ga0307406_10061025 Ga0307406_100610252 337
77 3300031901 Ga0307406_10097583 Ga0307406_100975832 337
78 3300031903 Ga0307407_10089561 Ga0307407_100895612 337
79 3300031911 Ga0307412_10000254 Ga0307412_1000025423 337
80 3300031911 Ga0307412_10030830 Ga0307412_100308302 337
81 3300031995 Ga0307409_100056642 Ga0307409_1000566423 337
82 3300032002 Ga0307416_100035724 Ga0307416_1000357242 337
83 3300032002 Ga0307416_100058272 Ga0307416_1000582722 337
84 3300032002 Ga0307416_100403265 Ga0307416_1004032651 337
85 3300032002 Ga0307416_100512785 Ga0307416_1005127852 337
86 3300032005 Ga0307411_10026491 Ga0307411_100264912 337
87 3300032005 Ga0307411_10125050 Ga0307411_101250502 337
88 3300032126 Ga0307415_100107380 Ga0307415_1001073802 337
89 3300037418 Ga0395900_0144017 Ga0395900_0144017_438_1481 337
90 3300037466 Ga0395898_0064475 Ga0395898_0064475_499_1542 337
91 3300038443 Ga0395901_0031846 Ga0395901_0031846_201_1244 337
92 3300041999 Ga0439433_0022638 Ga0439433_0022638_122_1165 337
93 3300042002 Ga0439442_000424 Ga0439442_000424_6087_7130 337
94 3300042122 Ga0450920_000141 Ga0450920_000141_2919_3962 337
95 3300042146 Ga0450907_000256 Ga0450907_000256_5305_6348 337
96 3300042435 Ga0439434_0000947 Ga0439434_0000947_2654_3697 337
97 3300042531 Ga0450918_002140 Ga0450918_002140_775_1818 337
98 3300049569 Ga0501032_0023484 Ga0501032_0023484_1338_2381 337
99 3300049571 Ga0501034_0000480 Ga0501034_0000480_19786_20829 337
100 3300049573 Ga0501037_0080952 Ga0501037_0080952_434_1477 337
101 iso_pu_bacteria 2946059875 2946060525 337
102 3300003791 Ga0055530_10000133 Ga0055530_1000013325 338
103 3300003792 Ga0055540_1000168 Ga0055540_100016825 338
104 3300005288 Ga0065714_10064673 Ga0065714_100646737 338
105 3300005289 Ga0065704_10002589 Ga0065704_100025894 338
106 3300025292 Ga0209676_1001524 Ga0209676_100152417 338
107 3300025298 Ga0209050_1000043 Ga0209050_1000043262 338
108 3300025303 Ga0209051_1000030 Ga0209051_100003088 338
109 3300025304 Ga0209257_1007776 Ga0209257_10077762 338
110 3300031548 Ga0307408_100009042 Ga0307408_1000090422 338
111 3300031548 Ga0307408_100186627 Ga0307408_1001866273 338
112 3300031548 Ga0307408_100198859 Ga0307408_1001988593 338
113 3300031731 Ga0307405_10002090 Ga0307405_100020905 338
114 3300031824 Ga0307413_10016367 Ga0307413_100163674 338
115 3300031901 Ga0307406_10049754 Ga0307406_100497543 338
116 3300031903 Ga0307407_10031947 Ga0307407_100319473 338
117 3300031911 Ga0307412_10001950 Ga0307412_100019506 338
118 3300032004 Ga0307414_10036060 Ga0307414_100360603 338
119 3300037853 Ga0436364_0277731 Ga0436364_0277731_5924_6973 338
120 3300037853 Ga0436364_0510689 Ga0436364_0510689_207_1256 338
121 3300039437 Ga0436365_1685261 Ga0436365_1685261_1851_2900 338
122 3300049662 Ga0501222_006611 Ga0501222_006611_118_1170 338
123 iso_pu_bacteria 2599185288 2599881043 338
124 iso_pu_bacteria 2599185303 2599949675 338
125 iso_pu_bacteria 2600255296 2601690403 338
126 iso_pu_bacteria 2738541294 2738810538 338
127 iso_pu_bacteria 2738541309 2738897898 338
128 iso_pu_bacteria 2808606385 2808978541 338
129 iso_pu_bacteria 2808606388 2808993932 338
130 iso_pu_bacteria 2852612431 2852617429 338
131 iso_pu_bacteria 2852667396 2852672452 338
132 iso_pu_bacteria 2945928738 2945933875 338
133 iso_pu_bacteria 8054503363 8054505803 338
134 iso_pu_bacteria 8056161164 8056166484 338
135 3300046453 Ga0495627_000195 Ga0495627_000195_7894_8913 339
136 3300046458 Ga0495591_000184 Ga0495591_000184_7959_8978 339
137 3300046471 Ga0495650_0006867 Ga0495650_0006867_3195_4214 339
138 3300046474 Ga0495605_0000045 Ga0495605_0000045_91286_92305 339
139 3300046474 Ga0495605_0000563 Ga0495605_0000563_25192_26211 339
140 3300046474 Ga0495605_0003671 Ga0495605_0003671_6972_7991 339
141 3300046499 Ga0495594_0005294 Ga0495594_0005294_1882_2901 339
142 3300046501 Ga0495607_0000058 Ga0495607_0000058_54910_55929 339
143 3300046501 Ga0495607_0000172 Ga0495607_0000172_60224_61243 339
144 3300046501 Ga0495607_0000179 Ga0495607_0000179_29154_30173 339
145 3300046501 Ga0495607_0006225 Ga0495607_0006225_3319_4338 339
146 3300046501 Ga0495607_0015398 Ga0495607_0015398_262_1281 339
147 3300046501 Ga0495607_0026196 Ga0495607_0026196_1971_2990 339
148 3300046501 Ga0495607_0124378 Ga0495607_0124378_196_1215 339
149 3300046506 Ga0495583_0000101 Ga0495583_0000101_69640_70659 339
150 3300046506 Ga0495583_0030833 Ga0495583_0030833_1534_2553 339
151 3300046507 Ga0495606_0023383 Ga0495606_0023383_1932_2951 339
152 3300046515 Ga0495620_0000001 Ga0495620_0000001_212326_213345 339
153 3300046515 Ga0495620_0000166 Ga0495620_0000166_9680_10699 339
154 3300046515 Ga0495620_0004341 Ga0495620_0004341_4946_5965 339
155 3300046518 Ga0495631_0004644 Ga0495631_0004644_3345_4364 339
156 3300046520 Ga0495637_0001374 Ga0495637_0001374_4542_5561 339
157 3300046520 Ga0495637_0005663 Ga0495637_0005663_4112_5131 339
158 3300046520 Ga0495637_0022921 Ga0495637_0022921_556_1575 339
159 3300046520 Ga0495637_0100027 Ga0495637_0100027_74_1093 339
160 3300046522 Ga0495643_0054830 Ga0495643_0054830_85_1104 339
161 3300046524 Ga0495648_0000377 Ga0495648_0000377_646_1665 339
162 3300046524 Ga0495648_0003808 Ga0495648_0003808_11929_12948 339
163 3300046530 Ga0495654_0034876 Ga0495654_0034876_646_1665 339
164 3300046530 Ga0495654_0045858 Ga0495654_0045858_848_1867 339
165 3300046538 Ga0495609_0000012 Ga0495609_0000012_250196_251215 339
166 3300046538 Ga0495609_0021359 Ga0495609_0021359_1841_2860 339
167 3300046542 Ga0495597_0000037 Ga0495597_0000037_104976_105995 339
168 3300046542 Ga0495597_0002922 Ga0495597_0002922_266_1285 339
169 3300046542 Ga0495597_0081160 Ga0495597_0081160_119_1138 339
170 3300046542 Ga0495597_0085407 Ga0495597_0085407_214_1233 339
171 3300046543 Ga0495645_0043191 Ga0495645_0043191_1441_2460 339
172 3300046558 Ga0495633_0000016 Ga0495633_0000016_70135_71154 339
173 3300046648 Ga0495611_0013449 Ga0495611_0013449_2205_3224 339
174 3300046665 Ga0495661_0000004 Ga0495661_0000004_299567_300586 339
175 3300046665 Ga0495661_0000018 Ga0495661_0000018_72032_73051 339
176 3300046665 Ga0495661_0015996 Ga0495661_0015996_1616_2635 339
177 3300046691 Ga0495670_0053980 Ga0495670_0053980_575_1594 339
178 3300046692 Ga0495671_0004032 Ga0495671_0004032_5596_6615 339
179 3300046692 Ga0495671_0019721 Ga0495671_0019721_2398_3417 339
180 3300046794 Ga0495589_0000422 Ga0495589_0000422_14174_15193 339
181 3300046810 Ga0495660_0000638 Ga0495660_0000638_7659_8678 339
182 3300046810 Ga0495660_0003263 Ga0495660_0003263_1648_2667 339
183 3300046810 Ga0495660_0009554 Ga0495660_0009554_2424_3443 339
184 3300046810 Ga0495660_0014526 Ga0495660_0014526_1793_2812 339
185 3300047315 Ga0495581_0020492 Ga0495581_0020492_1961_3013 339
186 3300047320 Ga0495672_0023786 Ga0495672_0023786_2496_3515 339
187 3300047320 Ga0495672_0028056 Ga0495672_0028056_525_1544 339
188 3300047320 Ga0495672_0070543 Ga0495672_0070543_535_1554 339
189 3300047323 Ga0495683_0000063 Ga0495683_0000063_40148_41167 339
190 3300047446 Ga0495679_000165 Ga0495679_000165_266_1285 339
191 3300047469 Ga0495673_0000421 Ga0495673_0000421_8229_9248 339
192 3300047469 Ga0495673_0002046 Ga0495673_0002046_6041_7060 339
193 3300047469 Ga0495673_0005618 Ga0495673_0005618_2010_3029 339
194 3300047469 Ga0495673_0007797 Ga0495673_0007797_3042_4061 339
195 3300047470 Ga0495681_0004871 Ga0495681_0004871_2044_3063 339
196 3300048927 Ga0496124_0000280 Ga0496124_0000280_33784_34803 339
197 3300049459 Ga0495678_000036 Ga0495678_000036_105855_106874 339
198 3300049459 Ga0495678_001110 Ga0495678_001110_12392_13411 339
199 3300049459 Ga0495678_046306 Ga0495678_046306_628_1647 339
200 3300049460 Ga0495682_0000065 Ga0495682_0000065_49959_50978 339
201 3300053125 Ga0500618_008300 Ga0500618_008300_296_1315 339
202 3300053140 Ga0500573_0117685 Ga0500573_0117685_336_1355 339
203 iso_pu_bacteria 2857740372 2857744457 339
204 iso_pu_bacteria 2933418574 2933422093 339
205 3300003781 Ga0055536_1000046 Ga0055536_100004697 340
206 3300003792 Ga0055540_1000070 Ga0055540_100007097 340
207 3300005331 Ga0070670_100101802 Ga0070670_1001018022 340
208 3300005333 Ga0070677_10002370 Ga0070677_100023702 340
209 3300005335 Ga0070666_10056923 Ga0070666_100569233 340
210 3300005347 Ga0070668_100232101 Ga0070668_1002321012 340
211 3300005353 Ga0070669_100043365 Ga0070669_1000433653 340
212 3300005354 Ga0070675_100009872 Ga0070675_1000098722 340
213 3300005367 Ga0070667_100011368 Ga0070667_1000113683 340
214 3300005456 Ga0070678_100230010 Ga0070678_1002300102 340
215 3300009011 Ga0105251_10027263 Ga0105251_100272632 340
216 3300009011 Ga0105251_10064332 Ga0105251_100643321 340
217 3300009092 Ga0105250_10001079 Ga0105250_100010799 340
218 3300009098 Ga0105245_10029428 Ga0105245_100294284 340
219 3300011119 Ga0105246_10160175 Ga0105246_101601752 340
220 3300013100 Ga0157373_10000819 Ga0157373_1000081918 340
221 3300013306 Ga0163162_10233883 Ga0163162_102338832 340
222 3300013308 Ga0157375_10356087 Ga0157375_103560872 340
223 3300015261 Ga0182006_1004220 Ga0182006_10042207 340
224 3300021388 Ga0213875_10095134 Ga0213875_100951341 340
225 3300025292 Ga0209676_1000055 Ga0209676_1000055208 340
226 3300025298 Ga0209050_1000231 Ga0209050_100023116 340
227 3300025303 Ga0209051_1000165 Ga0209051_100016516 340
228 3300025304 Ga0209257_1000767 Ga0209257_100076716 340
229 3300025315 Ga0207697_10008336 Ga0207697_100083363 340
230 3300025711 Ga0207696_1000628 Ga0207696_100062821 340
231 3300025728 Ga0207655_1030383 Ga0207655_10303832 340
232 3300025735 Ga0207713_1029754 Ga0207713_10297542 340
233 3300025893 Ga0207682_10002517 Ga0207682_100025175 340
234 3300025903 Ga0207680_10042627 Ga0207680_100426272 340
235 3300025907 Ga0207645_10004346 Ga0207645_100043469 340
236 3300025923 Ga0207681_10007454 Ga0207681_100074546 340
237 3300025925 Ga0207650_10102897 Ga0207650_101028972 340
238 3300025934 Ga0207686_10126289 Ga0207686_101262892 340
239 3300025935 Ga0207709_10207178 Ga0207709_102071782 340
240 3300025940 Ga0207691_10002435 Ga0207691_100024352 340
241 3300025960 Ga0207651_10263124 Ga0207651_102631242 340
242 3300026121 Ga0207683_10009799 Ga0207683_100097993 340
243 3300031548 Ga0307408_100088722 Ga0307408_1000887222 340
244 3300031911 Ga0307412_10031452 Ga0307412_100314523 340
245 3300035119 Ga0373956_0000852 Ga0373956_0000852_1196_2218 340
246 3300038443 Ga0395901_0086408 Ga0395901_0086408_1564_2625 340
247 3300046452 Ga0495617_012000 Ga0495617_012000_1432_2481 340
248 3300046457 Ga0495590_0001206 Ga0495590_0001206_8794_9846 340
249 3300046457 Ga0495590_0040867 Ga0495590_0040867_400_1449 340
250 3300046471 Ga0495650_0000881 Ga0495650_0000881_12592_13644 340
251 3300046491 Ga0495584_0000547 Ga0495584_0000547_21091_22143 340
252 3300046501 Ga0495607_0000185 Ga0495607_0000185_51917_52969 340
253 3300046506 Ga0495583_0018184 Ga0495583_0018184_1912_2964 340
254 3300046513 Ga0495616_0000661 Ga0495616_0000661_11891_12943 340
255 3300046616 Ga0495668_0066283 Ga0495668_0066283_711_1766 340
256 3300046674 Ga0495588_0032710 Ga0495588_0032710_341_1396 340
257 3300046674 Ga0495588_0040469 Ga0495588_0040469_850_1905 340
258 3300046692 Ga0495671_0018255 Ga0495671_0018255_2119_3171 340
259 3300046810 Ga0495660_0050079 Ga0495660_0050079_119_1171 340
260 3300047315 Ga0495581_0001774 Ga0495581_0001774_1229_2284 340
261 3300047470 Ga0495681_0000237 Ga0495681_0000237_28059_29111 340
262 3300048905 Ga0496102_0028870 Ga0496102_0028870_2913_3968 340
263 3300048906 Ga0496103_0148053 Ga0496103_0148053_25_1080 340
264 3300048907 Ga0496104_0173998 Ga0496104_0173998_728_1783 340
265 3300048908 Ga0496105_0069085 Ga0496105_0069085_1579_2634 340
266 3300048908 Ga0496105_0087722 Ga0496105_0087722_615_1670 340
267 3300048909 Ga0496106_0113790 Ga0496106_0113790_908_1963 340
268 3300048912 Ga0496109_0457397 Ga0496109_0457397_77_1132 340
269 3300048913 Ga0496110_0028956 Ga0496110_0028956_582_1631 340
270 3300048913 Ga0496110_0273962 Ga0496110_0273962_161_1216 340
271 3300048913 Ga0496110_0395721 Ga0496110_0395721_128_1183 340
272 3300048914 Ga0496111_0173469 Ga0496111_0173469_279_1334 340
273 3300048917 Ga0496114_0141449 Ga0496114_0141449_32_1087 340
274 3300048918 Ga0496115_0095672 Ga0496115_0095672_1126_2181 340
275 3300048919 Ga0496116_0034820 Ga0496116_0034820_1712_2761 340
276 3300048920 Ga0496117_0032512 Ga0496117_0032512_1570_2619 340
277 3300048921 Ga0496118_0024337 Ga0496118_0024337_2836_3885 340
278 3300048922 Ga0496119_0012321 Ga0496119_0012321_4043_5092 340
279 3300048924 Ga0496121_0007545 Ga0496121_0007545_4451_5500 340
280 3300048927 Ga0496124_0003909 Ga0496124_0003909_11975_13024 340
281 3300049460 Ga0495682_0001677 Ga0495682_0001677_8770_9822 340
282 3300002737 JGI25162J39368_1000060 JGI25162J39368_1000060101 341
283 3300002771 JGI25163J39215_1000792 JGI25163J39215_10007924 341
284 3300002772 JGI25164J39214_1000037 JGI25164J39214_100003727 341
285 3300003214 JGI25165J46597_1000118 JGI25165J46597_100011828 341
286 3300009036 Ga0105244_10004498 Ga0105244_100044988 341
287 3300009148 Ga0105243_10000045 Ga0105243_100000451 341
288 3300025207 Ga0209760_100023 Ga0209760_100023130 341
289 3300025231 Ga0207427_100018 Ga0207427_100018129 341
290 3300025233 Ga0209437_100031 Ga0209437_100031129 341
291 3300025261 Ga0209233_1000012 Ga0209233_1000012128 341
292 3300025728 Ga0207655_1000085 Ga0207655_100008563 341
293 3300025935 Ga0207709_10000011 Ga0207709_10000011334 341
294 3300031247 Ga0265340_10000078 Ga0265340_1000007812 341
295 3300003751 Ga0055538_1000158 Ga0055538_100015818 342
296 3300003752 Ga0055539_1000208 Ga0055539_100020818 342
297 3300003756 Ga0055533_1000209 Ga0055533_100020918 342
298 3300003758 Ga0055532_1000214 Ga0055532_100021424 342
299 3300003759 Ga0055525_1000287 Ga0055525_100028718 342
300 3300003841 Ga0055541_1000067 Ga0055541_100006718 342
301 3300005457 Ga0070662_100094493 Ga0070662_1000944932 342
302 3300005564 Ga0070664_100002081 Ga0070664_10000208113 342
303 3300009011 Ga0105251_10003948 Ga0105251_100039486 342
304 3300009098 Ga0105245_10129308 Ga0105245_101293082 342
305 3300013306 Ga0163162_10348567 Ga0163162_103485671 342
306 3300025206 Ga0209435_101168 Ga0209435_1011682 342
307 3300025224 Ga0209784_100058 Ga0209784_100058119 342
308 3300025225 Ga0209566_100045 Ga0209566_100045119 342
309 3300025226 Ga0209674_100096 Ga0209674_100096119 342
310 3300025229 Ga0209147_100056 Ga0209147_100056119 342
311 3300025230 Ga0209563_100064 Ga0209563_100064119 342
312 3300025242 Ga0209258_100446 Ga0209258_10044625 342
313 3300025246 Ga0209646_1000147 Ga0209646_100014763 342
314 3300025253 Ga0209677_100053 Ga0209677_100053119 342
315 3300025711 Ga0207696_1000041 Ga0207696_1000041209 342
316 3300025735 Ga0207713_1001279 Ga0207713_100127913 342
317 3300025933 Ga0207706_10031488 Ga0207706_100314886 342
318 3300025945 Ga0207679_10031184 Ga0207679_100311843 342
319 3300042439 Ga0439464_0008430 Ga0439464_0008430_1489_2520 342
320 3300046501 Ga0495607_0000290 Ga0495607_0000290_14270_15298 342
321 3300046512 Ga0495610_0080746 Ga0495610_0080746_12_1040 342
322 3300046665 Ga0495661_0004052 Ga0495661_0004052_7713_8741 342
323 3300047446 Ga0495679_005912 Ga0495679_005912_1611_2639 342
324 3300048927 Ga0496124_0098283 Ga0496124_0098283_1322_2350 342
325 3300053161 Ga0500634_0047057 Ga0500634_0047057_947_1975 342
326 3300006946 Ga0079104_1000823 Ga0079104_100082312 343
327 3300006948 Ga0099826_10006487 Ga0099826_100064877 343
328 3300015261 Ga0182006_1040659 Ga0182006_10406592 343
329 3300027111 Ga0209281_1000009 Ga0209281_1000009630 343
330 3300041405 Ga0439438_005931 Ga0439438_005931_415_1467 343
331 3300041405 Ga0439438_010402 Ga0439438_010402_1204_2256 343
332 3300041411 Ga0439466_0040439 Ga0439466_0040439_393_1445 343
333 3300042004 Ga0439445_0042466 Ga0439445_0042466_58_1110 343
334 3300042006 Ga0439432_025694 Ga0439432_025694_528_1580 343
335 3300042010 Ga0439452_025541 Ga0439452_025541_11_1063 343
336 3300046474 Ga0495605_0000191 Ga0495605_0000191_8532_9569 343
337 3300046474 Ga0495605_0001618 Ga0495605_0001618_4322_5356 343
338 3300046491 Ga0495584_0004919 Ga0495584_0004919_4294_5328 343
339 3300046500 Ga0495596_0045500 Ga0495596_0045500_108_1142 343
340 3300046506 Ga0495583_0000483 Ga0495583_0000483_4705_5739 343
341 3300046506 Ga0495583_0010856 Ga0495583_0010856_1953_2990 343
342 3300046512 Ga0495610_0016642 Ga0495610_0016642_2322_3356 343
343 3300046519 Ga0495632_0005660 Ga0495632_0005660_4617_5651 343
344 3300046519 Ga0495632_0075121 Ga0495632_0075121_445_1482 343
345 3300046520 Ga0495637_0000037 Ga0495637_0000037_78440_79474 343
346 3300046523 Ga0495644_0001264 Ga0495644_0001264_2105_3139 343
347 3300046530 Ga0495654_0000211 Ga0495654_0000211_7646_8680 343
348 3300046538 Ga0495609_0000075 Ga0495609_0000075_72913_73947 343
349 3300046557 Ga0495622_0000590 Ga0495622_0000590_18118_19152 343
350 3300046616 Ga0495668_0045796 Ga0495668_0045796_1152_2186 343
351 3300046648 Ga0495611_0002012 Ga0495611_0002012_7929_8963 343
352 3300046660 Ga0495625_0000089 Ga0495625_0000089_90534_91568 343
353 3300046665 Ga0495661_0000101 Ga0495661_0000101_12150_13184 343
354 3300046692 Ga0495671_0065191 Ga0495671_0065191_129_1163 343
355 3300046694 Ga0495649_0069656 Ga0495649_0069656_72_1106 343
356 3300046810 Ga0495660_0022659 Ga0495660_0022659_2029_3063 343
357 3300047320 Ga0495672_0028983 Ga0495672_0028983_1574_2608 343
358 3300047321 Ga0495676_0000020 Ga0495676_0000020_85597_86631 343
359 3300047323 Ga0495683_0023975 Ga0495683_0023975_2046_3080 343
360 3300047446 Ga0495679_000079 Ga0495679_000079_10959_11993 343
361 3300047469 Ga0495673_0026305 Ga0495673_0026305_304_1338 343
362 3300047470 Ga0495681_0004824 Ga0495681_0004824_6453_7487 343
363 3300047472 Ga0495686_0049913 Ga0495686_0049913_1518_2552 343
364 3300048091 Ga0495626_0000041 Ga0495626_0000041_80912_81946 343
365 3300017792 Ga0163161_10075624 Ga0163161_100756242 345
366 3300031456 Ga0307513_10000671 Ga0307513_1000067131 345
367 iso_pu_bacteria 2511231010 2511290774 345
368 iso_pu_bacteria 2923586266 2923586582 345
369 iso_pu_bacteria 2511231004 2511258480 346
370 iso_pu_bacteria 2511231007 2511272544 346
371 iso_pu_bacteria 2511231014 2511313849 346
372 iso_pu_bacteria 2511231016 2511327777 346
373 iso_pu_bacteria 2511231019 2511343834 346
374 iso_pu_bacteria 2511231021 2511358632 346
375 iso_pu_bacteria 2599185188 2599502203 346
376 iso_pu_bacteria 2599185212 2599616068 346
377 iso_pu_bacteria 2599185248 2599772657 346
378 iso_pu_bacteria 2599185289 2599885067 346
379 iso_pu_bacteria 2599185291 2599899792 346
380 iso_pu_bacteria 2599185300 2599932737 346
381 iso_pu_bacteria 2599185302 2599945253 346
382 iso_pu_bacteria 2599185304 2599955395 346
383 iso_pu_bacteria 2599185305 2599960883 346
384 iso_pu_bacteria 2599185306 2599965488 346
385 iso_pu_bacteria 2599185308 2599976603 346
386 iso_pu_bacteria 2599185309 2599984428 346
387 iso_pu_bacteria 2599185310 2599990401 346
388 iso_pu_bacteria 2599185311 2599992828 346
389 iso_pu_bacteria 2599185312 2600001657 346
390 iso_pu_bacteria 2599185313 2600008911 346
391 iso_pu_bacteria 2599185314 2600010652 346
392 iso_pu_bacteria 2599185315 2600018377 346
393 iso_pu_bacteria 2599185316 2600023307 346
394 iso_pu_bacteria 2599185317 2600028220 346
395 iso_pu_bacteria 2599185318 2600034157 346
396 iso_pu_bacteria 2599185319 2600040330 346
397 iso_pu_bacteria 2599185320 2600049237 346
398 iso_pu_bacteria 2599185321 2600052897 346
399 iso_pu_bacteria 2599185322 2600056978 346
400 iso_pu_bacteria 2599185323 2600066805 346
401 iso_pu_bacteria 2599185324 2600074057 346
402 iso_pu_bacteria 2599185325 2600077536 346
403 iso_pu_bacteria 2600254930 2600357331 346
404 iso_pu_bacteria 2623620446 2624491490 346
405 iso_pu_bacteria 2643221633 2644190363 346
406 iso_pu_bacteria 2643221650 2644284919 346
407 iso_pu_bacteria 2651869719 2652547172 346
408 iso_pu_bacteria 2667528170 2671094655 346
409 iso_pu_bacteria 2667528176 2671124823 346
410 iso_pu_bacteria 2675903515 2678263883 346
411 iso_pu_bacteria 2738543015 2739257985 346
412 iso_pu_bacteria 2744054620 2745004336 346
413 iso_pu_bacteria 2773857670 2774123124 346
414 iso_pu_bacteria 2784132072 2784315470 346
415 iso_pu_bacteria 2791355520 2794594728 346
416 iso_pu_bacteria 2808606361 2808854894 346
417 iso_pu_bacteria 2808606376 2808926324 346
418 iso_pu_bacteria 2808606377 2808932737 346
419 iso_pu_bacteria 2808606378 2808934911 346
420 iso_pu_bacteria 2808606380 2808948425 346
421 iso_pu_bacteria 2808606381 2808954873 346
422 iso_pu_bacteria 2808606383 2808963308 346
423 iso_pu_bacteria 2808606389 2808998287 346
424 iso_pu_bacteria 2825651385 2825657330 346
425 iso_pu_bacteria 2842854478 2842858383 346
426 iso_pu_bacteria 2860339153 2860342509 346
427 iso_pu_bacteria 2913036834 2913039291 346
428 iso_pu_bacteria 2919456309 2919456639 346
429 iso_pu_bacteria 2919481497 2919485291 346
430 iso_pu_bacteria 2919697872 2919700951 346
431 iso_pu_bacteria 2929144301 2929147882 346
432 iso_pu_bacteria 2931369376 2931369746 346
433 iso_pu_bacteria 2931396565 2931402593 346
434 iso_pu_bacteria 2988728565 2988729464 346
435 iso_pu_bacteria 3007866637 3007869744 346
436 iso_pu_bacteria 8019775933 8019778383 346
437 iso_pu_bacteria 8056143049 8056145536 346
438 iso_pu_bacteria 8056155041 8056156913 346
439 3300047321 Ga0495676_0049626 Ga0495676_0049626_936_1982 347
440 3300053125 Ga0500618_008253 Ga0500618_008253_92_1138 347
441 3300027907 Ga0207428_10089847 Ga0207428_100898472 349
442 3300047443 Ga0495687_048786 Ga0495687_048786_357_1454 349
443 3300048920 Ga0496117_0036374 Ga0496117_0036374_1293_2342 349
444 3300048921 Ga0496118_0038172 Ga0496118_0038172_1343_2392 349
445 3300048926 Ga0496123_0060944 Ga0496123_0060944_928_1977 349
446 3300049460 Ga0495682_0000020 Ga0495682_0000020_194715_195791 349
447 3300050491 nmdc:mga00v17_65991_c1 nmdc:mga00v17_65991_c1_372_1421 349
448 3300005288 Ga0065714_10014210 Ga0065714_100142103 350
449 3300005288 Ga0065714_10138475 Ga0065714_101384751 350
450 3300006051 Ga0075364_10120357 Ga0075364_101203571 350
451 3300009036 Ga0105244_10010865 Ga0105244_100108652 350
452 3300009092 Ga0105250_10020997 Ga0105250_100209972 350
453 3300009176 Ga0105242_10058672 Ga0105242_100586722 350
454 3300013102 Ga0157371_10012245 Ga0157371_100122453 350
455 3300013104 Ga0157370_10166047 Ga0157370_101660472 350
456 3300014497 Ga0182008_10024943 Ga0182008_100249432 350
457 3300015261 Ga0182006_1008963 Ga0182006_10089635 350
458 3300015262 Ga0182007_10000177 Ga0182007_100001774 350
459 3300015265 Ga0182005_1003224 Ga0182005_10032245 350
460 3300015265 Ga0182005_1008785 Ga0182005_10087852 350
461 3300025728 Ga0207655_1000141 Ga0207655_100014162 350
462 3300025728 Ga0207655_1019266 Ga0207655_10192662 350
463 3300027907 Ga0207428_10001057 Ga0207428_100010577 350
464 3300027907 Ga0207428_10078079 Ga0207428_100780791 350
465 3300030744 Ga0316181_1147544 Ga0316181_11475442 350
466 3300041405 Ga0439438_012718 Ga0439438_012718_1006_2058 350
467 3300041407 Ga0439447_008800 Ga0439447_008800_1541_2593 350
468 3300041407 Ga0439447_010615 Ga0439447_010615_655_1707 350
469 3300041407 Ga0439447_019574 Ga0439447_019574_165_1217 350
470 3300042009 Ga0439451_002893 Ga0439451_002893_572_1624 350
471 3300042009 Ga0439451_014668 Ga0439451_014668_261_1313 350
472 3300042010 Ga0439452_025118 Ga0439452_025118_436_1488 350
473 3300042013 Ga0439456_006139 Ga0439456_006139_1229_2281 350
474 3300042013 Ga0439456_008694 Ga0439456_008694_946_1998 350
475 3300042013 Ga0439456_009932 Ga0439456_009932_639_1691 350
476 3300042115 Ga0450911_002130 Ga0450911_002130_1114_2166 350
477 3300042121 Ga0450919_004630 Ga0450919_004630_110_1162 350
478 3300042137 Ga0450902_013843 Ga0450902_013843_48_1100 350
479 3300042138 Ga0450903_005504 Ga0450903_005504_495_1547 350
480 3300042145 Ga0450906_003237 Ga0450906_003237_1952_3004 350
481 3300042146 Ga0450907_002430 Ga0450907_002430_687_1739 350
482 3300042146 Ga0450907_011097 Ga0450907_011097_357_1409 350
483 3300042147 Ga0450910_003445 Ga0450910_003445_23_1075 350
484 3300042156 Ga0439446_0002445 Ga0439446_0002445_1932_2984 350
485 3300042185 Ga0450909_001023 Ga0450909_001023_2597_3649 350
486 3300042435 Ga0439434_0023749 Ga0439434_0023749_572_1624 350
487 3300042461 Ga0439460_0020839 Ga0439460_0020839_73_1125 350
488 3300042531 Ga0450918_003225 Ga0450918_003225_1029_2081 350
489 3300042993 Ga0439440_0005108 Ga0439440_0005108_548_1600 350
490 3300046452 Ga0495617_000054 Ga0495617_000054_39542_40594 350
491 3300046452 Ga0495617_000144 Ga0495617_000144_10325_11377 350
492 3300046452 Ga0495617_008090 Ga0495617_008090_580_1632 350
493 3300046452 Ga0495617_021113 Ga0495617_021113_231_1283 350
494 3300046453 Ga0495627_000308 Ga0495627_000308_35190_36242 350
495 3300046457 Ga0495590_0004191 Ga0495590_0004191_2176_3228 350
496 3300046458 Ga0495591_000315 Ga0495591_000315_16568_17620 350
497 3300046458 Ga0495591_008305 Ga0495591_008305_3133_4185 350
498 3300046459 Ga0495629_0144367 Ga0495629_0144367_509_1561 350
499 3300046460 Ga0495638_0054510 Ga0495638_0054510_510_1562 350
500 3300046460 Ga0495638_0100229 Ga0495638_0100229_602_1672 350
501 3300046463 Ga0495653_0037631 Ga0495653_0037631_2649_3701 350
502 3300046471 Ga0495650_0005496 Ga0495650_0005496_977_2029 350
503 3300046474 Ga0495605_0000794 Ga0495605_0000794_12416_13468 350
504 3300046474 Ga0495605_0010840 Ga0495605_0010840_2451_3503 350
505 3300046474 Ga0495605_0039013 Ga0495605_0039013_235_1287 350
506 3300046474 Ga0495605_0045075 Ga0495605_0045075_289_1341 350
507 3300046475 Ga0495639_0000032 Ga0495639_0000032_4412_5464 350
508 3300046491 Ga0495584_0001764 Ga0495584_0001764_9223_10275 350
509 3300046492 Ga0495585_0014976 Ga0495585_0014976_1655_2707 350
510 3300046492 Ga0495585_0029734 Ga0495585_0029734_849_1901 350
511 3300046499 Ga0495594_0014081 Ga0495594_0014081_1879_2931 350
512 3300046501 Ga0495607_0000617 Ga0495607_0000617_28573_29625 350
513 3300046501 Ga0495607_0036726 Ga0495607_0036726_47_1099 350
514 3300046501 Ga0495607_0037319 Ga0495607_0037319_327_1379 350
515 3300046501 Ga0495607_0043695 Ga0495607_0043695_1484_2536 350
516 3300046506 Ga0495583_0034050 Ga0495583_0034050_85_1137 350
517 3300046513 Ga0495616_0000226 Ga0495616_0000226_16566_17618 350
518 3300046515 Ga0495620_0021166 Ga0495620_0021166_212_1264 350
519 3300046516 Ga0495628_0214004 Ga0495628_0214004_263_1315 350
520 3300046519 Ga0495632_0001740 Ga0495632_0001740_4557_5609 350
521 3300046519 Ga0495632_0012766 Ga0495632_0012766_2223_3275 350
522 3300046520 Ga0495637_0007143 Ga0495637_0007143_2638_3690 350
523 3300046520 Ga0495637_0035457 Ga0495637_0035457_767_1819 350
524 3300046522 Ga0495643_0063085 Ga0495643_0063085_864_1916 350
525 3300046524 Ga0495648_0001506 Ga0495648_0001506_2182_3234 350
526 3300046524 Ga0495648_0035448 Ga0495648_0035448_2115_3167 350
527 3300046526 Ga0495666_0025173 Ga0495666_0025173_453_1505 350
528 3300046528 Ga0495642_0004676 Ga0495642_0004676_2486_3538 350
529 3300046530 Ga0495654_0000288 Ga0495654_0000288_2203_3255 350
530 3300046530 Ga0495654_0000306 Ga0495654_0000306_25812_26864 350
531 3300046536 Ga0495587_0004867 Ga0495587_0004867_4670_5722 350
532 3300046538 Ga0495609_0001135 Ga0495609_0001135_17199_18251 350
533 3300046538 Ga0495609_0008213 Ga0495609_0008213_2474_3526 350
534 3300046538 Ga0495609_0083086 Ga0495609_0083086_38_1090 350
535 3300046542 Ga0495597_0012793 Ga0495597_0012793_478_1530 350
536 3300046557 Ga0495622_0011228 Ga0495622_0011228_2165_3217 350
537 3300046558 Ga0495633_0027993 Ga0495633_0027993_654_1724 350
538 3300046642 Ga0495634_0000025 Ga0495634_0000025_100557_101609 350
539 3300046648 Ga0495611_0010268 Ga0495611_0010268_1655_2707 350
540 3300046660 Ga0495625_0000847 Ga0495625_0000847_24177_25229 350
541 3300046660 Ga0495625_0067950 Ga0495625_0067950_903_1955 350
542 3300046660 Ga0495625_0221259 Ga0495625_0221259_92_1144 350
543 3300046663 Ga0495635_0034169 Ga0495635_0034169_920_1972 350
544 3300046664 Ga0495659_0003525 Ga0495659_0003525_2454_3506 350
545 3300046679 Ga0495623_0030482 Ga0495623_0030482_1927_2979 350
546 3300046689 Ga0495613_0273456 Ga0495613_0273456_83_1135 350
547 3300046691 Ga0495670_0005615 Ga0495670_0005615_3204_4256 350
548 3300046691 Ga0495670_0013939 Ga0495670_0013939_2300_3352 350
549 3300046692 Ga0495671_0001060 Ga0495671_0001060_12117_13169 350
550 3300046694 Ga0495649_0000013 Ga0495649_0000013_144357_145409 350
551 3300046694 Ga0495649_0000909 Ga0495649_0000909_11063_12115 350
552 3300046694 Ga0495649_0048419 Ga0495649_0048419_290_1342 350
553 3300046794 Ga0495589_0000141 Ga0495589_0000141_3256_4308 350
554 3300046794 Ga0495589_0025067 Ga0495589_0025067_969_2021 350
555 3300046810 Ga0495660_0058798 Ga0495660_0058798_497_1549 350
556 3300046810 Ga0495660_0124783 Ga0495660_0124783_154_1206 350
557 3300047315 Ga0495581_0031915 Ga0495581_0031915_91_1143 350
558 3300047317 Ga0495604_0002087 Ga0495604_0002087_1242_2294 350
559 3300047320 Ga0495672_0001978 Ga0495672_0001978_6283_7335 350
560 3300047320 Ga0495672_0004789 Ga0495672_0004789_8240_9292 350
561 3300047320 Ga0495672_0006656 Ga0495672_0006656_5660_6712 350
562 3300047320 Ga0495672_0071995 Ga0495672_0071995_32_1084 350
563 3300047322 Ga0495680_0003983 Ga0495680_0003983_12691_13743 350
564 3300047323 Ga0495683_0006189 Ga0495683_0006189_1178_2230 350
565 3300047323 Ga0495683_0024980 Ga0495683_0024980_1166_2218 350
566 3300047323 Ga0495683_0051312 Ga0495683_0051312_91_1143 350
567 3300047443 Ga0495687_000715 Ga0495687_000715_22153_23205 350
568 3300047443 Ga0495687_004143 Ga0495687_004143_6779_7831 350
569 3300047443 Ga0495687_008394 Ga0495687_008394_2321_3373 350
570 3300047443 Ga0495687_012721 Ga0495687_012721_180_1232 350
571 3300047446 Ga0495679_000711 Ga0495679_000711_9137_10189 350
572 3300047447 Ga0495685_047414 Ga0495685_047414_380_1432 350
573 3300047469 Ga0495673_0000190 Ga0495673_0000190_53018_54070 350
574 3300047469 Ga0495673_0000833 Ga0495673_0000833_10208_11260 350
575 3300047469 Ga0495673_0028696 Ga0495673_0028696_1376_2428 350
576 3300047469 Ga0495673_0034809 Ga0495673_0034809_799_1851 350
577 3300047469 Ga0495673_0072115 Ga0495673_0072115_259_1311 350
578 3300047470 Ga0495681_0000027 Ga0495681_0000027_81995_83047 350
579 3300047470 Ga0495681_0016054 Ga0495681_0016054_1509_2561 350
580 3300047673 Ga0495593_0034064 Ga0495593_0034064_1155_2207 350
581 3300048091 Ga0495626_0000352 Ga0495626_0000352_15870_16922 350
582 3300048091 Ga0495626_0005473 Ga0495626_0005473_2197_3249 350
583 3300048091 Ga0495626_0011493 Ga0495626_0011493_1862_2914 350
584 3300048905 Ga0496102_0000038 Ga0496102_0000038_171113_172165 350
585 3300048906 Ga0496103_0033182 Ga0496103_0033182_602_1654 350
586 3300048907 Ga0496104_0197962 Ga0496104_0197962_801_1853 350
587 3300048908 Ga0496105_0127667 Ga0496105_0127667_14_1066 350
588 3300048909 Ga0496106_0057923 Ga0496106_0057923_1024_2076 350
589 3300048913 Ga0496110_0332514 Ga0496110_0332514_134_1186 350
590 3300048918 Ga0496115_0382929 Ga0496115_0382929_35_1087 350
591 3300048919 Ga0496116_0000984 Ga0496116_0000984_11697_12749 350
592 3300048919 Ga0496116_0137549 Ga0496116_0137549_218_1270 350
593 3300048920 Ga0496117_0067105 Ga0496117_0067105_825_1877 350
594 3300048921 Ga0496118_0066079 Ga0496118_0066079_1084_2136 350
595 3300048921 Ga0496118_0098853 Ga0496118_0098853_878_1930 350
596 3300048924 Ga0496121_0004753 Ga0496121_0004753_2167_3219 350
597 3300048925 Ga0496122_0025572 Ga0496122_0025572_1834_2886 350
598 3300048925 Ga0496122_0185679 Ga0496122_0185679_79_1137 350
599 3300048926 Ga0496123_0038678 Ga0496123_0038678_785_1837 350
600 3300048927 Ga0496124_0100235 Ga0496124_0100235_679_1731 350
601 3300048929 Ga0496126_0057901 Ga0496126_0057901_28_1086 350
602 3300048929 Ga0496126_0060509 Ga0496126_0060509_2295_3347 350
603 3300049459 Ga0495678_000724 Ga0495678_000724_12365_13417 350
604 3300049459 Ga0495678_002190 Ga0495678_002190_10335_11387 350
605 3300049459 Ga0495678_007868 Ga0495678_007868_1751_2803 350
606 3300049459 Ga0495678_011307 Ga0495678_011307_1028_2092 350
607 3300049460 Ga0495682_0024863 Ga0495682_0024863_164_1216 350
608 3300049460 Ga0495682_0038743 Ga0495682_0038743_474_1526 350
609 3300031824 Ga0307413_10022403 Ga0307413_100224031 351
610 3300031903 Ga0307407_10012207 Ga0307407_100122073 351
611 3300031995 Ga0307409_100041255 Ga0307409_1000412553 351
612 3300031995 Ga0307409_100103847 Ga0307409_1001038472 351
613 3300032004 Ga0307414_10069042 Ga0307414_100690423 351
614 3300046491 Ga0495584_0000409 Ga0495584_0000409_24773_25828 351
615 3300046524 Ga0495648_0044645 Ga0495648_0044645_1069_2124 351
616 3300046692 Ga0495671_0000295 Ga0495671_0000295_24787_25842 351
617 3300048091 Ga0495626_0015886 Ga0495626_0015886_1768_2823 351
618 3300003791 Ga0055530_10000373 Ga0055530_1000037330 354
619 3300041405 Ga0439438_014038 Ga0439438_014038_1169_2266 354
620 3300042009 Ga0439451_005181 Ga0439451_005181_263_1360 354
621 3300042146 Ga0450907_000010 Ga0450907_000010_20967_22064 354
622 3300042185 Ga0450909_006155 Ga0450909_006155_318_1415 354
623 3300042435 Ga0439434_0000301 Ga0439434_0000301_12549_13646 354
624 3300042461 Ga0439460_0005166 Ga0439460_0005166_1563_2660 354
625 3300046528 Ga0495642_0000316 Ga0495642_0000316_4301_5452 364
626 3300046694 Ga0495649_0081914 Ga0495649_0081914_266_1408 364
627 3300047446 Ga0495679_014366 Ga0495679_014366_1151_2293 364
628 2124908027 MRS2a_Contig_11 MRS2a_00011880 365
629 3300005288 Ga0065714_10000548 Ga0065714_100005482 365
630 3300046457 Ga0495590_0022988 Ga0495590_0022988_499_1596 365
631 3300046471 Ga0495650_0018023 Ga0495650_0018023_418_1515 365
632 3300046474 Ga0495605_0074486 Ga0495605_0074486_44_1141 365
633 3300046501 Ga0495607_0018916 Ga0495607_0018916_2683_3780 365
634 3300046519 Ga0495632_0000754 Ga0495632_0000754_21298_22395 365
635 3300046520 Ga0495637_0007481 Ga0495637_0007481_2363_3460 365
636 3300046523 Ga0495644_0039961 Ga0495644_0039961_177_1322 365
637 3300046530 Ga0495654_0106925 Ga0495654_0106925_66_1163 365
638 3300046538 Ga0495609_0007500 Ga0495609_0007500_1624_2721 365
639 3300046557 Ga0495622_0007970 Ga0495622_0007970_2659_3756 365
640 3300046660 Ga0495625_0041066 Ga0495625_0041066_833_1978 365
641 3300046674 Ga0495588_0108909 Ga0495588_0108909_351_1448 365
642 3300046684 Ga0495669_0001097 Ga0495669_0001097_6672_7769 365
643 3300046794 Ga0495589_0059160 Ga0495589_0059160_399_1496 365
644 3300046810 Ga0495660_0041165 Ga0495660_0041165_1315_2460 365
645 3300047320 Ga0495672_0054995 Ga0495672_0054995_798_1943 365
646 3300047323 Ga0495683_0035032 Ga0495683_0035032_956_2053 365
647 3300047445 Ga0495677_0005322 Ga0495677_0005322_462_1559 365
648 3300048089 Ga0495614_0067331 Ga0495614_0067331_214_1311 365
649 3300048927 Ga0496124_0129309 Ga0496124_0129309_307_1482 365
650 3300048928 Ga0496125_0048546 Ga0496125_0048546_1990_3165 365
651 3300049460 Ga0495682_0009847 Ga0495682_0009847_259_1356 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

42

161

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

169

283

0.96

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

173

380

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gfg-assembly6.cif.gz_L structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form 0.9284 15 352
3e82-assembly2.cif.gz_E crystal structure of a putative oxidoreductase from klebsiella pneumoniae 0.9273 14 353
3gfg-assembly3.cif.gz_F structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form 0.9266 14 352
3gfg-assembly6.cif.gz_L structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form 0.9257 15 352
3gfg-assembly5.cif.gz_I structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form 0.9251 15 352
ID Description Score Start End Superfamily
1xeaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9222 15 132 3.40.50.720
af_P77376_2_121_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9136 14 133 3.90.1150.10
af_P75931_1_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9118 15 132 3.40.50.720
3e82E02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9107 139 353 3.30.360.10
af_O42896_134_368_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9081 143 351 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y8VD34-F1-model_v4 deleted 0.9839 15 125
AF-F3GH84-F1-model_v4 Oxidoreductase 0.9704 200 351
AF-W6VDA6-F1-model_v4 Oxidoreductase domain protein 0.9671 1 362 GO:0000166
GO:0016491
AF-W6VDA6-F1-model_v4 Oxidoreductase domain protein 0.9644 1 362 GO:0000166
GO:0016491
AF-F3GH84-F1-model_v4 Oxidoreductase 0.9581 200 351

Feature Viewer

pLDDT pTM Quality
92.61 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map