metagRoot

F472560

General Info

Members	Datasets	Scaffolds	Average Seq Length
650	230	650	222

Family's Representative Sequence

Representative Sequence	3300054114\|Ga0501084_0161977\|Ga0501084_0161977_22_705
Length	220
Sequence	MPYDPLLRWETDGGAIPPTNGAIPRDLVVPRQIEPEDWLRFQASLAEILSAFGMNLETPGTERTPERFLEALYDATAGYDGDHKLLTAFPTECSCDGACLVSQIVEGPISFHSLCEHHALPFHGVAHVGYGISKLTRLVRLFARRFTVQERLGEQIADALVELMEPHGVAVHLQAVHLCTQMRGVREEHSKTVTTFWRGRYSDDPDLRREFLAELGNRNP

Samples

	Sample ID	Description	Type	Environment
1	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
2	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
3	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
4	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
5	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
6	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
7	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
8	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
9	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
10	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
11	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
12	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
13	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
14	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
15	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
16	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
17	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
18	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
19	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
20	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
21	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
22	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
23	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
24	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
25	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
26	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
27	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
28	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
29	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
30	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
31	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
32	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
33	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
34	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
35	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
36	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
37	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
38	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
39	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
40	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
41	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
42	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
43	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
44	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
45	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
46	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
47	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
48	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
49	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
50	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
51	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
52	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
53	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
54	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
55	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
56	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
57	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
58	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
59	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
60	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
61	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
62	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
63	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
64	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
65	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
66	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
67	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
68	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
69	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
70	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
71	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
72	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
73	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
74	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
75	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
105	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
106	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
107	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
108	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
109	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
110	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
111	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
112	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
113	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
114	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
115	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
116	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
117	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
118	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
119	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
120	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
121	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
122	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
123	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
124	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
125	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
126	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
127	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
128	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
129	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
130	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
131	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
132	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
133	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
134	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
135	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
136	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
137	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
138	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
139	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
140	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
141	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
142	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
143	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
144	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
145	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
146	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
147	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
148	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
149	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
150	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
151	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
152	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
153	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
154	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
155	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
156	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
157	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
158	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
159	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
160	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
161	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
162	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
163	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
164	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
165	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
166	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
167	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
168	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
169	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
170	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
171	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
172	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
173	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
174	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
175	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
176	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
177	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
178	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
179	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
180	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
181	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
182	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
183	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
184	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
185	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
186	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
187	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
188	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
189	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
190	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
191	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
192	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
193	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
194	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
195	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
196	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
197	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
198	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
199	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
200	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
201	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
202	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
203	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
204	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
205	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
206	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
207	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
208	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
209	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
210	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
211	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
212	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
216	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
217	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
218	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
219	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
220	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
221	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
222	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
223	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
224	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
225	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
226	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
227	3300059625	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
228	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
229	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
230	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.92
Metatranscriptomes	3.08
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	5.85
Rhizosphere	94.15
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25405J52794_10050818	3300003911	Unclassified	888
2	Ga0070658_10009214	3300005327	Bacteria	7936
3	Ga0070658_10166482	3300005327	Bacteria	1851
4	Ga0070658_10350020	3300005327	Bacteria	1264
5	Ga0070683_100001335	3300005329	Bacteria	18799
6	Ga0070683_100002449	3300005329	Bacteria	14768
7	Ga0070683_100181936	3300005329	Bacteria	1995
8	Ga0070683_100258196	3300005329	Bacteria	1657
9	Ga0070683_100303097	3300005329	Bacteria	1520
10	Ga0070680_100003057	3300005336	Bacteria	12412
11	Ga0070680_100218939	3300005336	Bacteria	1607
12	Ga0070680_100264434	3300005336	Bacteria	1456
13	Ga0070680_100865054	3300005336	Bacteria	779
14	Ga0070682_100006784	3300005337	Bacteria	6424
15	Ga0070682_100017079	3300005337	Bacteria	4227
16	Ga0070660_100005149	3300005339	Bacteria	9038
17	Ga0070660_100036931	3300005339	Bacteria	3702
18	Ga0070660_100041966	3300005339	Bacteria	3489
19	Ga0070660_100135208	3300005339	Bacteria	1975
20	Ga0070660_100211499	3300005339	Bacteria	1575
21	Ga0070660_100519918	3300005339	Bacteria	991
22	Ga0070661_100075731	3300005344	Bacteria	2480
23	Ga0070661_100150483	3300005344	Unclassified	1759
24	Ga0070674_100007813	3300005356	Bacteria	6324
25	Ga0070674_100278261	3300005356	Bacteria	1325
26	Ga0070703_10005870	3300005406	Bacteria	3440
27	Ga0070714_100000004	3300005435	Bacteria	310983
28	Ga0070714_100009829	3300005435	Bacteria	7540
29	Ga0070714_100035252	3300005435	Bacteria	4193
30	Ga0070714_100074256	3300005435	Unclassified	2948
31	Ga0070714_100184210	3300005435	Bacteria	1902
32	Ga0070714_100349497	3300005435	Unclassified	1388
33	Ga0070714_100870694	3300005435	Bacteria	874
34	Ga0070714_100913400	3300005435	Bacteria	853
35	Ga0070713_100067052	3300005436	Bacteria	3020
36	Ga0070713_100130587	3300005436	Bacteria	2215
37	Ga0070713_100598062	3300005436	Unclassified	1048
38	Ga0070705_100000445	3300005440	Bacteria	23767
39	Ga0070705_100382968	3300005440	Unclassified	1036
40	Ga0070694_100065826	3300005444	Bacteria	2484
41	Ga0070708_100000018	3300005445	Bacteria	119022
42	Ga0070708_100002296	3300005445	Bacteria	14799
43	Ga0070708_100057774	3300005445	Bacteria	3455
44	Ga0070708_100181094	3300005445	Bacteria	1970
45	Ga0070708_100228616	3300005445	Bacteria	1745
46	Ga0070708_100255227	3300005445	Bacteria	1647
47	Ga0070708_100361816	3300005445	Bacteria	1367
48	Ga0070708_100643969	3300005445	Bacteria	999
49	Ga0070681_10039323	3300005458	Bacteria	4742
50	Ga0070681_10066301	3300005458	Bacteria	3579
51	Ga0070681_10134082	3300005458	Bacteria	2407
52	Ga0070681_10202806	3300005458	Bacteria	1901
53	Ga0070681_10347045	3300005458	Bacteria	1394
54	Ga0070706_100000026	3300005467	Bacteria	156154
55	Ga0070706_100000157	3300005467	Bacteria	86485
56	Ga0070706_100000354	3300005467	Bacteria	55290
57	Ga0070706_100000566	3300005467	Bacteria	43155
58	Ga0070706_100011315	3300005467	Bacteria	8290
59	Ga0070706_100228880	3300005467	Bacteria	1735
60	Ga0070706_100371148	3300005467	Bacteria	1333
61	Ga0070706_100374738	3300005467	Bacteria	1326
62	Ga0070706_100381052	3300005467	Bacteria	1313
63	Ga0070707_100000004	3300005468	Bacteria	265003
64	Ga0070707_100000396	3300005468	Bacteria	42988
65	Ga0070707_100005818	3300005468	Bacteria	11500
66	Ga0070707_100015636	3300005468	Bacteria	7122
67	Ga0070707_100020341	3300005468	Bacteria	6260
68	Ga0070707_100108894	3300005468	Bacteria	2687
69	Ga0070707_100262393	3300005468	Unclassified	1680
70	Ga0070707_100276902	3300005468	Bacteria	1631
71	Ga0070707_100333251	3300005468	Unclassified	1474
72	Ga0070707_100368694	3300005468	Bacteria	1395
73	Ga0070707_100667298	3300005468	Bacteria	1002
74	Ga0070698_100004617	3300005471	Bacteria	15131
75	Ga0070698_100093391	3300005471	Bacteria	2988
76	Ga0070698_100287711	3300005471	Bacteria	1574
77	Ga0070698_100316983	3300005471	Bacteria	1490
78	Ga0070698_100355512	3300005471	Unclassified	1397
79	Ga0070698_100608593	3300005471	Bacteria	1033
80	Ga0070698_100655050	3300005471	Unclassified	991
81	Ga0070699_100000042	3300005518	Bacteria	127464
82	Ga0070699_100000118	3300005518	Bacteria	72787
83	Ga0070699_100000307	3300005518	Bacteria	47591
84	Ga0070699_100007721	3300005518	Bacteria	9351
85	Ga0070699_100035121	3300005518	Bacteria	4333
86	Ga0070699_100045888	3300005518	Bacteria	3781
87	Ga0070699_100076319	3300005518	Bacteria	2917
88	Ga0070699_100090862	3300005518	Unclassified	2669
89	Ga0070699_100121650	3300005518	Bacteria	2295
90	Ga0070679_100004333	3300005530	Bacteria	13107
91	Ga0070679_100022648	3300005530	Bacteria	6142
92	Ga0070679_100027195	3300005530	Bacteria	5627
93	Ga0070679_100044614	3300005530	Bacteria	4417
94	Ga0070679_100059995	3300005530	Bacteria	3791
95	Ga0070679_100087031	3300005530	Bacteria	3111
96	Ga0070679_100157344	3300005530	Unclassified	2247
97	Ga0070679_100490370	3300005530	Bacteria	1173
98	Ga0070679_100746477	3300005530	Bacteria	921
99	Ga0070684_100000721	3300005535	Bacteria	22898
100	Ga0070684_100023856	3300005535	Bacteria	5124
101	Ga0070684_100150405	3300005535	Bacteria	2109
102	Ga0070684_100301061	3300005535	Bacteria	1471
103	Ga0070684_100478949	3300005535	Bacteria	1152
104	Ga0070697_100000025	3300005536	Bacteria	128895
105	Ga0070697_100007893	3300005536	Bacteria	8292
106	Ga0070697_100036686	3300005536	Bacteria	3959
107	Ga0070697_100041487	3300005536	Bacteria	3724
108	Ga0070697_100048918	3300005536	Bacteria	3429
109	Ga0070697_100050288	3300005536	Bacteria	3382
110	Ga0070697_100057062	3300005536	Unclassified	3177
111	Ga0070697_100086412	3300005536	Bacteria	2588
112	Ga0068853_100224417	3300005539	Bacteria	1717
113	Ga0068853_100276752	3300005539	Bacteria	1547
114	Ga0070695_100000016	3300005545	Bacteria	66345
115	Ga0070695_100010014	3300005545	Bacteria	5653
116	Ga0070695_100178099	3300005545	Bacteria	1504
117	Ga0070695_100387722	3300005545	Bacteria	1056
118	Ga0070693_100035179	3300005547	Bacteria	2776
119	Ga0070704_100183117	3300005549	Unclassified	1677
120	Ga0068855_100015497	3300005563	Bacteria	9178
121	Ga0068855_100045858	3300005563	Bacteria	5168
122	Ga0068855_100727698	3300005563	Bacteria	1060
123	Ga0070664_100017637	3300005564	Bacteria	5863
124	Ga0068856_100008596	3300005614	Bacteria	9929
125	Ga0068856_100224442	3300005614	Bacteria	1894
126	Ga0068852_101019466	3300005616	Bacteria	847
127	Ga0068866_10086778	3300005718	Bacteria	1694
128	Ga0068870_10261957	3300005840	Bacteria	1076
129	Ga0081455_10009379	3300005937	Bacteria	10068
130	Ga0081455_10022642	3300005937	Bacteria	5866
131	Ga0081455_10024163	3300005937	Bacteria	5636
132	Ga0081455_10184044	3300005937	Bacteria	1579
133	Ga0081538_10045839	3300005981	Bacteria	2705
134	Ga0081538_10106617	3300005981	Bacteria	1390
135	Ga0081539_10094495	3300005985	Bacteria	1538
136	Ga0070717_10000225	3300006028	Bacteria	39264
137	Ga0070717_10003774	3300006028	Bacteria	10884
138	Ga0070717_10012634	3300006028	Bacteria	6443
139	Ga0070717_10016222	3300006028	Bacteria	5772
140	Ga0070712_100286889	3300006175	Bacteria	1328
141	Ga0070712_100557518	3300006175	Bacteria	966
142	Ga0097621_100886543	3300006237	Bacteria	830
143	Ga0075428_100024964	3300006844	Bacteria	6613
144	Ga0075428_100062368	3300006844	Bacteria	4082
145	Ga0075428_100087942	3300006844	Bacteria	3389
146	Ga0075428_100106874	3300006844	Bacteria	3050
147	Ga0075428_100172904	3300006844	Bacteria	2341
148	Ga0075430_100004656	3300006846	Bacteria	11534
149	Ga0075430_100343843	3300006846	Bacteria	1232
150	Ga0075431_100032156	3300006847	Bacteria	5407
151	Ga0075431_100334420	3300006847	Bacteria	1525
152	Ga0075431_100418551	3300006847	Bacteria	1339
153	Ga0075433_10004294	3300006852	Bacteria	11071
154	Ga0075434_100089967	3300006871	Bacteria	3071
155	Ga0075434_100129880	3300006871	Bacteria	2538
156	Ga0075434_100893751	3300006871	Unclassified	903
157	Ga0075429_100007893	3300006880	Bacteria	9246
158	Ga0075429_100221048	3300006880	Bacteria	1659
159	Ga0068865_100098458	3300006881	Bacteria	2137
160	Ga0075436_100041786	3300006914	Unclassified	3163
161	Ga0075436_100042085	3300006914	Unclassified	3150
162	Ga0075436_100111287	3300006914	Bacteria	1911
163	Ga0075435_100156877	3300007076	Bacteria	1915
164	Ga0075435_100196695	3300007076	Bacteria	1707
165	Ga0075435_100207163	3300007076	Bacteria	1662
166	Ga0075435_100573108	3300007076	Archaea	978
167	Ga0099794_10000144	3300007265	Bacteria	26471
168	Ga0099794_10000627	3300007265	Bacteria	11774
169	Ga0099794_10028936	3300007265	Unclassified	2579
170	Ga0105240_10144207	3300009093	Bacteria	2843
171	Ga0105240_10150058	3300009093	Bacteria	2777
172	Ga0105240_10210329	3300009093	Bacteria	2274
173	Ga0105240_10998985	3300009093	Bacteria	895
174	Ga0111539_10001124	3300009094	Bacteria	35369
175	Ga0105245_10068404	3300009098	Bacteria	3218
176	Ga0105245_10805510	3300009098	Unclassified	977
177	Ga0114129_10001522	3300009147	Bacteria	31386
178	Ga0114129_10001807	3300009147	Bacteria	29163
179	Ga0114129_10028232	3300009147	Bacteria	7950
180	Ga0114129_10063047	3300009147	Bacteria	5177
181	Ga0114129_11166826	3300009147	Unclassified	961
182	Ga0105243_10166271	3300009148	Bacteria	1906
183	Ga0105241_10074571	3300009174	Bacteria	2642
184	Ga0105242_10172182	3300009176	Unclassified	1903
185	Ga0105237_10150426	3300009545	Bacteria	2324
186	Ga0105238_10197375	3300009551	Bacteria	1988
187	Ga0105249_10140447	3300009553	Bacteria	2316
188	Ga0105239_10269943	3300010375	Unclassified	1913
189	Ga0105239_10806784	3300010375	Bacteria	1075
190	Ga0105246_10115987	3300011119	Unclassified	1976
191	Ga0157373_10194127	3300013100	Bacteria	1431
192	Ga0157373_10288772	3300013100	Bacteria	1163
193	Ga0157370_10003267	3300013104	Bacteria	19105
194	Ga0157370_10006157	3300013104	Bacteria	13310
195	Ga0157370_10015349	3300013104	Bacteria	7787
196	Ga0157370_10408530	3300013104	Bacteria	1249
197	Ga0157369_10002142	3300013105	Bacteria	23816
198	Ga0157369_10027188	3300013105	Bacteria	6344
199	Ga0157369_10081746	3300013105	Bacteria	3457
200	Ga0157369_10086241	3300013105	Bacteria	3353
201	Ga0157369_10187667	3300013105	Bacteria	2173
202	Ga0157369_10411655	3300013105	Unclassified	1402
203	Ga0157369_10461070	3300013105	Bacteria	1316
204	Ga0157374_10078105	3300013296	Bacteria	3134
205	Ga0157372_10032737	3300013307	Bacteria	5703
206	Ga0157372_10555724	3300013307	Bacteria	1338
207	Ga0157372_10694984	3300013307	Bacteria	1184
208	Ga0157372_10755824	3300013307	Unclassified	1130
209	Ga0157372_10899391	3300013307	Bacteria	1027
210	Ga0157375_10176519	3300013308	Bacteria	2286
211	Ga0163163_10183602	3300014325	Bacteria	2139
212	Ga0182008_10084876	3300014497	Bacteria	1560
213	Ga0197907_10178759	3300020069	Bacteria	4179
214	Ga0197907_10470264	3300020069	Bacteria	1037
215	Ga0206356_10008561	3300020070	Bacteria	4422
216	Ga0206356_10375744	3300020070	Bacteria	2039
217	Ga0206356_10464328	3300020070	Unclassified	958
218	Ga0206356_11029346	3300020070	Bacteria	3216
219	Ga0206351_10997873	3300020077	Bacteria	954
220	Ga0206354_10152643	3300020081	Bacteria	2181
221	Ga0206354_10268698	3300020081	Unclassified	1545
222	Ga0206354_10807547	3300020081	Bacteria	4523
223	Ga0206354_11706039	3300020081	Unclassified	1148
224	Ga0206353_10021877	3300020082	Bacteria	4976
225	Ga0206353_10295462	3300020082	Bacteria	11383
226	Ga0206353_10450844	3300020082	Bacteria	3422
227	Ga0206353_10469180	3300020082	Bacteria	869
228	Ga0206353_11357980	3300020082	Bacteria	3253
229	Ga0224712_10088628	3300022467	Bacteria	1292
230	Ga0224712_10128996	3300022467	Bacteria	1103
231	Ga0224712_10255536	3300022467	Bacteria	810
232	Ga0207653_10006747	3300025885	Bacteria	3586
233	Ga0207653_10041692	3300025885	Bacteria	1508
234	Ga0207642_10259169	3300025899	Bacteria	991
235	Ga0207705_10129194	3300025909	Bacteria	1879
236	Ga0207705_10242398	3300025909	Bacteria	1373
237	Ga0207705_10463452	3300025909	Bacteria	983
238	Ga0207684_10000005	3300025910	Bacteria	736617
239	Ga0207684_10000014	3300025910	Bacteria	440027
240	Ga0207684_10000027	3300025910	Bacteria	313272
241	Ga0207684_10000034	3300025910	Bacteria	291009
242	Ga0207684_10006070	3300025910	Bacteria	11053
243	Ga0207684_10055386	3300025910	Bacteria	3365
244	Ga0207684_10084472	3300025910	Unclassified	2703
245	Ga0207684_10249808	3300025910	Unclassified	1530
246	Ga0207684_10275180	3300025910	Bacteria	1452
247	Ga0207684_10468521	3300025910	Bacteria	1081
248	Ga0207707_10002042	3300025912	Bacteria	18319
249	Ga0207707_10007191	3300025912	Bacteria	9691
250	Ga0207707_10027194	3300025912	Bacteria	5002
251	Ga0207707_10068319	3300025912	Bacteria	3096
252	Ga0207707_10092454	3300025912	Bacteria	2643
253	Ga0207707_10125014	3300025912	Bacteria	2249
254	Ga0207707_10417893	3300025912	Bacteria	1150
255	Ga0207695_10078359	3300025913	Bacteria	3353
256	Ga0207695_10233303	3300025913	Bacteria	1744
257	Ga0207695_10290932	3300025913	Bacteria	1526
258	Ga0207695_10453469	3300025913	Bacteria	1165
259	Ga0207693_10144035	3300025915	Unclassified	1874
260	Ga0207693_10765328	3300025915	Unclassified	745
261	Ga0207663_10894476	3300025916	Bacteria	710
262	Ga0207660_10010941	3300025917	Bacteria	5898
263	Ga0207660_10033967	3300025917	Bacteria	3532
264	Ga0207660_10053546	3300025917	Bacteria	2877
265	Ga0207660_10130802	3300025917	Bacteria	1910
266	Ga0207657_10002374	3300025919	Bacteria	20368
267	Ga0207657_10005684	3300025919	Bacteria	13011
268	Ga0207657_10007470	3300025919	Bacteria	11201
269	Ga0207657_10007536	3300025919	Bacteria	11153
270	Ga0207657_10418056	3300025919	Bacteria	1054
271	Ga0207657_10520360	3300025919	Bacteria	931
272	Ga0207649_10035162	3300025920	Bacteria	3009
273	Ga0207649_10190191	3300025920	Bacteria	1443
274	Ga0207649_10367246	3300025920	Bacteria	1069
275	Ga0207652_10007814	3300025921	Bacteria	8590
276	Ga0207652_10014084	3300025921	Bacteria	6474
277	Ga0207652_10024916	3300025921	Bacteria	4967
278	Ga0207652_10027383	3300025921	Bacteria	4750
279	Ga0207652_10072438	3300025921	Unclassified	2996
280	Ga0207652_10084386	3300025921	Bacteria	2783
281	Ga0207652_10085073	3300025921	Bacteria	2771
282	Ga0207652_10760549	3300025921	Bacteria	862
283	Ga0207646_10000018	3300025922	Bacteria	291009
284	Ga0207646_10000111	3300025922	Bacteria	112089
285	Ga0207646_10000119	3300025922	Bacteria	107784
286	Ga0207646_10000439	3300025922	Bacteria	55774
287	Ga0207646_10001009	3300025922	Bacteria	36040
288	Ga0207646_10003108	3300025922	Bacteria	19082
289	Ga0207646_10006973	3300025922	Bacteria	11582
290	Ga0207646_10016000	3300025922	Bacteria	7052
291	Ga0207646_10050996	3300025922	Bacteria	3703
292	Ga0207646_10125962	3300025922	Unclassified	2303
293	Ga0207646_10324427	3300025922	Bacteria	1391
294	Ga0207694_10388147	3300025924	Bacteria	1160
295	Ga0207687_10008986	3300025927	Bacteria	6531
296	Ga0207687_10578110	3300025927	Unclassified	945
297	Ga0207700_10289450	3300025928	Bacteria	1411
298	Ga0207664_10000018	3300025929	Bacteria	222788
299	Ga0207664_10019438	3300025929	Bacteria	5021
300	Ga0207664_10065519	3300025929	Bacteria	2909
301	Ga0207664_10098659	3300025929	Bacteria	2409
302	Ga0207664_10132063	3300025929	Unclassified	2103
303	Ga0207690_10271711	3300025932	Bacteria	1317
304	Ga0207686_10192147	3300025934	Bacteria	1456
305	Ga0207709_10431992	3300025935	Unclassified	1014
306	Ga0207669_10169501	3300025937	Bacteria	1552
307	Ga0207665_10183211	3300025939	Unclassified	1518
308	Ga0207661_10000939	3300025944	Bacteria	19192
309	Ga0207661_10170484	3300025944	Bacteria	1894
310	Ga0207661_10279375	3300025944	Unclassified	1492
311	Ga0207661_10415054	3300025944	Bacteria	1222
312	Ga0207679_10006123	3300025945	Bacteria	7595
313	Ga0207679_10533785	3300025945	Unclassified	1051
314	Ga0207667_10047893	3300025949	Bacteria	4521
315	Ga0207667_10153581	3300025949	Bacteria	2369
316	Ga0207667_10268659	3300025949	Bacteria	1744
317	Ga0207667_10294603	3300025949	Bacteria	1658
318	Ga0207667_10620012	3300025949	Bacteria	1089
319	Ga0207678_10756409	3300026067	Unclassified	857
320	Ga0207702_10066702	3300026078	Bacteria	3086
321	Ga0207702_10235221	3300026078	Bacteria	1714
322	Ga0207698_10582420	3300026142	Unclassified	1101
323	Ga0209588_1000349	3300027671	Bacteria	12021
324	Ga0209588_1029833	3300027671	Unclassified	1741
325	Ga0207428_10002416	3300027907	Bacteria	18641
326	Ga0265326_10009353	3300028558	Bacteria	2930
327	Ga0265319_1004662	3300028563	Bacteria	6732
328	Ga0265319_1005226	3300028563	Bacteria	6267
329	Ga0265319_1073179	3300028563	Bacteria	1096
330	Ga0265334_10000983	3300028573	Bacteria	14114
331	Ga0265334_10065151	3300028573	Unclassified	1367
332	Ga0265334_10093985	3300028573	Unclassified	1091
333	Ga0265318_10001019	3300028577	Bacteria	17905
334	Ga0265318_10020538	3300028577	Bacteria	2664
335	Ga0265318_10075296	3300028577	Bacteria	1249
336	Ga0265323_10033761	3300028653	Bacteria	1893
337	Ga0265322_10025444	3300028654	Bacteria	1692
338	Ga0265338_10036088	3300028800	Bacteria	4738
339	Ga0265338_10097020	3300028800	Bacteria	2416
340	Ga0265338_10179150	3300028800	Bacteria	1618
341	Ga0265330_10006759	3300031235	Bacteria	5655
342	Ga0265332_10003729	3300031238	Bacteria	7292
343	Ga0265328_10003705	3300031239	Bacteria	6733
344	Ga0265320_10004954	3300031240	Bacteria	8635
345	Ga0265320_10018935	3300031240	Unclassified	3776
346	Ga0265320_10152854	3300031240	Bacteria	1042
347	Ga0265325_10001203	3300031241	Bacteria	18422
348	Ga0265325_10060964	3300031241	Bacteria	1915
349	Ga0265329_10006002	3300031242	Bacteria	4858
350	Ga0265340_10019556	3300031247	Bacteria	3486
351	Ga0265339_10010593	3300031249	Bacteria	5720
352	Ga0265331_10019898	3300031250	Bacteria	3456
353	Ga0265327_10009243	3300031251	Bacteria	7146
354	Ga0265327_10067269	3300031251	Bacteria	1805
355	Ga0265316_10025553	3300031344	Bacteria	4926
356	Ga0307408_100283451	3300031548	Unclassified	1381
357	Ga0307408_100391997	3300031548	Unclassified	1190
358	Ga0265313_10002373	3300031595	Bacteria	16370
359	Ga0265313_10157778	3300031595	Unclassified	965
360	Ga0265314_10017031	3300031711	Bacteria	5715
361	Ga0265314_10057217	3300031711	Bacteria	2679
362	Ga0265314_10151963	3300031711	Unclassified	1418
363	Ga0265342_10012514	3300031712	Bacteria	5742
364	Ga0265342_10101080	3300031712	Unclassified	1642
365	Ga0307406_10019641	3300031901	Bacteria	3968
366	Ga0307412_10013609	3300031911	Bacteria	4776
367	Ga0307409_100510612	3300031995	Unclassified	1172
368	Ga0307416_100016660	3300032002	Bacteria	5117
369	Ga0307411_10153036	3300032005	Unclassified	1717
370	Ga0307415_100132761	3300032126	Bacteria	1888
371	Ga0307415_100368455	3300032126	Bacteria	1215
372	Ga0373941_0127293	3300035115	Bacteria	914
373	Ga0373954_0271320	3300035118	Unclassified	836
374	Ga0373956_0058262	3300035119	Bacteria	1746
375	Ga0373937_0125258	3300036401	Bacteria	2396
376	Ga0395899_0048697	3300037312	Bacteria	3152
377	Ga0395899_0228261	3300037312	Bacteria	1287
378	Ga0395899_0316481	3300037312	Bacteria	1052
379	Ga0395900_0026978	3300037418	Bacteria	5879
380	Ga0395900_0085369	3300037418	Unclassified	3244
381	Ga0395900_0166636	3300037418	Bacteria	2245
382	Ga0395898_0656439	3300037466	Bacteria	991
383	Ga0395905_0029028	3300037471	Bacteria	5214
384	Ga0395905_0060438	3300037471	Bacteria	3543
385	Ga0395905_0112030	3300037471	Bacteria	2562
386	Ga0395905_0686485	3300037471	Unclassified	926
387	Ga0395905_0712676	3300037471	Bacteria	906
388	Ga0395901_0007165	3300038443	Bacteria	11252
389	Ga0395901_0073777	3300038443	Bacteria	3559
390	Ga0395901_0174493	3300038443	Bacteria	2255
391	Ga0395901_0206966	3300038443	Unclassified	2055
392	Ga0395901_0233041	3300038443	Bacteria	1922
393	Ga0395901_0376848	3300038443	Unclassified	1461
394	Ga0395901_0487206	3300038443	Bacteria	1257
395	Ga0439466_0065994	3300041411	Bacteria	1159
396	Ga0466969_0005013	3300044656	Bacteria	7048
397	Ga0466965_0024472	3300044683	Bacteria	2921
398	Ga0466966_0005434	3300044684	Bacteria	8375
399	Ga0466966_0043918	3300044684	Bacteria	2863
400	Ga0466966_0159705	3300044684	Bacteria	1372
401	Ga0466961_0003015	3300044693	Bacteria	10441
402	Ga0466961_0012153	3300044693	Bacteria	5505
403	Ga0466961_0198001	3300044693	Bacteria	1243
404	Ga0466963_0004378	3300044694	Bacteria	8203
405	Ga0466971_0000094	3300044719	Bacteria	32664
406	Ga0466971_0009262	3300044719	Bacteria	4302
407	Ga0466971_0126710	3300044719	Bacteria	1184
408	Ga0466970_0142017	3300044765	Unclassified	1323
409	Ga0466957_0002095	3300044842	Bacteria	10672
410	Ga0466957_0013408	3300044842	Bacteria	4754
411	Ga0466959_0011462	3300045049	Bacteria	6373
412	Ga0466959_0056196	3300045049	Bacteria	2872
413	Ga0451576_0108018	3300045051	Bacteria	2895
414	Ga0466958_0000511	3300045836	Bacteria	16254
415	Ga0466958_0008317	3300045836	Bacteria	5747
416	Ga0466967_0001450	3300045976	Bacteria	13773
417	Ga0466967_0008248	3300045976	Bacteria	7608
418	Ga0466967_0022067	3300045976	Bacteria	5186
419	Ga0466967_0140549	3300045976	Bacteria	2249
420	Ga0466967_0335957	3300045976	Bacteria	1460
421	Ga0466967_0418671	3300045976	Bacteria	1305
422	Ga0466967_1182191	3300045976	Unclassified	762
423	Ga0495651_0009754	3300046462	Bacteria	7385
424	Ga0495653_0092389	3300046463	Bacteria	2210
425	Ga0495584_0085387	3300046491	Bacteria	1590
426	Ga0495608_0020124	3300046511	Bacteria	4588
427	Ga0495618_0074226	3300046514	Bacteria	2166
428	Ga0495644_0015619	3300046523	Bacteria	2910
429	Ga0495667_0090672	3300046559	Bacteria	1980
430	Ga0495634_0118122	3300046642	Bacteria	1700
431	Ga0495657_0015073	3300046675	Bacteria	5666
432	Ga0495600_0286938	3300046809	Bacteria	1041
433	Ga0495604_0222468	3300047317	Unclassified	1299
434	Ga0495680_0007510	3300047322	Bacteria	9985
435	Ga0495680_0314016	3300047322	Bacteria	1098
436	Ga0495684_0005954	3300047471	Bacteria	9473
437	Ga0496101_0029464	3300048904	Bacteria	3839
438	Ga0496101_0189287	3300048904	Unclassified	1587
439	Ga0496102_0006592	3300048905	Bacteria	9919
440	Ga0496102_0015793	3300048905	Bacteria	6582
441	Ga0496102_0029266	3300048905	Bacteria	4928
442	Ga0496102_0033216	3300048905	Bacteria	4636
443	Ga0496102_0132490	3300048905	Bacteria	2334
444	Ga0496102_0190978	3300048905	Bacteria	1930
445	Ga0496103_0030355	3300048906	Bacteria	3289
446	Ga0496103_0063073	3300048906	Bacteria	2308
447	Ga0496104_0064911	3300048907	Bacteria	3463
448	Ga0496105_0016032	3300048908	Bacteria	5978
449	Ga0496105_0032369	3300048908	Bacteria	4290
450	Ga0496106_0013751	3300048909	Bacteria	5978
451	Ga0496106_0106691	3300048909	Bacteria	2177
452	Ga0496107_0001125	3300048910	Bacteria	16135
453	Ga0496107_0102928	3300048910	Bacteria	2094
454	Ga0496107_0272116	3300048910	Unclassified	1261
455	Ga0496108_0260414	3300048911	Bacteria	1509
456	Ga0496108_0653468	3300048911	Bacteria	914
457	Ga0496108_0692803	3300048911	Bacteria	884
458	Ga0496109_0058319	3300048912	Bacteria	3526
459	Ga0496109_0185996	3300048912	Bacteria	1952
460	Ga0496109_0242720	3300048912	Bacteria	1696
461	Ga0496109_0377190	3300048912	Bacteria	1340
462	Ga0496109_0395269	3300048912	Bacteria	1306
463	Ga0496110_0003538	3300048913	Bacteria	11996
464	Ga0496110_0217986	3300048913	Unclassified	1735
465	Ga0496112_0018356	3300048915	Bacteria	6585
466	Ga0496112_0062227	3300048915	Bacteria	3681
467	Ga0496112_0113786	3300048915	Bacteria	2676
468	Ga0496112_0129143	3300048915	Bacteria	2498
469	Ga0496112_0339191	3300048915	Bacteria	1446
470	Ga0496113_0200830	3300048916	Bacteria	1585
471	Ga0496113_0389370	3300048916	Bacteria	1119
472	Ga0496113_0435937	3300048916	Bacteria	1053
473	Ga0496114_0000442	3300048917	Bacteria	30535
474	Ga0496114_0035763	3300048917	Unclassified	4102
475	Ga0501031_0001892	3300049568	Bacteria	13196
476	Ga0501031_0029365	3300049568	Bacteria	3586
477	Ga0501031_0159289	3300049568	Unclassified	1475
478	Ga0501031_0222519	3300049568	Bacteria	1229
479	Ga0501032_0000886	3300049569	Bacteria	24238
480	Ga0501032_0035929	3300049569	Bacteria	3384
481	Ga0501033_0000414	3300049570	Bacteria	40879
482	Ga0501033_0092854	3300049570	Unclassified	2207
483	Ga0501034_0055506	3300049571	Bacteria	3986
484	Ga0501034_0169112	3300049571	Bacteria	2154
485	Ga0501036_0001809	3300049572	Bacteria	16572
486	Ga0501036_0012331	3300049572	Bacteria	7078
487	Ga0501036_0026991	3300049572	Bacteria	4853
488	Ga0501036_0027857	3300049572	Bacteria	4776
489	Ga0501036_0108070	3300049572	Unclassified	2352
490	Ga0501036_0149425	3300049572	Bacteria	1971
491	Ga0501036_0641609	3300049572	Bacteria	879
492	Ga0501037_0000070	3300049573	Bacteria	94985
493	Ga0501037_0222209	3300049573	Bacteria	1328
494	Ga0501037_0277861	3300049573	Bacteria	1167
495	Ga0501038_0000082	3300049574	Bacteria	80551
496	Ga0501038_0116553	3300049574	Bacteria	2207
497	Ga0501039_0000077	3300049575	Bacteria	74065
498	Ga0501039_0041511	3300049575	Bacteria	3554
499	Ga0501040_0002008	3300049576	Bacteria	13119
500	Ga0501040_0003624	3300049576	Bacteria	10001
501	Ga0501040_0023609	3300049576	Bacteria	4123
502	Ga0501040_0090760	3300049576	Bacteria	2123
503	Ga0501040_0109498	3300049576	Unclassified	1931
504	Ga0501040_0155034	3300049576	Bacteria	1617
505	Ga0501041_0000007	3300049577	Bacteria	64272
506	Ga0501041_0056221	3300049577	Bacteria	2403
507	Ga0501041_0073223	3300049577	Bacteria	2105
508	Ga0501041_0134167	3300049577	Unclassified	1542
509	Ga0501042_0000011	3300049578	Bacteria	56069
510	Ga0501042_0047147	3300049578	Bacteria	3072
511	Ga0501042_0070334	3300049578	Unclassified	2503
512	Ga0501042_0109298	3300049578	Bacteria	1991
513	Ga0501042_0277438	3300049578	Unclassified	1210
514	Ga0501043_0005368	3300049579	Bacteria	10353
515	Ga0501043_0029610	3300049579	Bacteria	4302
516	Ga0501043_0179230	3300049579	Bacteria	1651
517	Ga0501043_0207180	3300049579	Viruses	1520
518	Ga0501043_0614742	3300049579	Bacteria	801
519	Ga0501046_0000089	3300049580	Bacteria	99031
520	Ga0501046_0161658	3300049580	Bacteria	1684
521	Ga0501046_0258714	3300049580	Unclassified	1279
522	Ga0501046_0316652	3300049580	Bacteria	1137
523	Ga0501047_0000237	3300049581	Bacteria	65237
524	Ga0501047_0056110	3300049581	Bacteria	3808
525	Ga0501048_0003063	3300049582	Bacteria	12744
526	Ga0501048_0014988	3300049582	Bacteria	5732
527	Ga0501048_0022220	3300049582	Bacteria	4642
528	Ga0501048_0040848	3300049582	Unclassified	3322
529	Ga0501048_0076114	3300049582	Bacteria	2368
530	Ga0501067_0205661	3300049583	Bacteria	1096
531	Ga0501068_0000029	3300049584	Bacteria	53512
532	Ga0501068_0037746	3300049584	Bacteria	2892
533	Ga0501068_0118636	3300049584	Bacteria	1648
534	Ga0501068_0266964	3300049584	Bacteria	1092
535	Ga0501069_0000842	3300049585	Bacteria	14513
536	Ga0501070_0000234	3300049586	Bacteria	52540
537	Ga0501071_0000020	3300049587	Bacteria	52938
538	Ga0501071_0004080	3300049587	Bacteria	9233
539	Ga0501071_0103281	3300049587	Bacteria	2102
540	Ga0501071_0156190	3300049587	Bacteria	1703
541	Ga0501071_0233697	3300049587	Bacteria	1385
542	Ga0501071_0542711	3300049587	Bacteria	893
543	Ga0501072_0000132	3300049588	Bacteria	55629
544	Ga0501072_0035021	3300049588	Bacteria	3935
545	Ga0501072_0063401	3300049588	Bacteria	2915
546	Ga0501072_0093780	3300049588	Bacteria	2384
547	Ga0501072_0110478	3300049588	Bacteria	2188
548	Ga0501072_0185880	3300049588	Bacteria	1657
549	Ga0501073_0006514	3300049589	Bacteria	8686
550	Ga0501073_0018629	3300049589	Bacteria	5018
551	Ga0501074_0000002	3300049590	Bacteria	121767
552	Ga0501074_0099603	3300049590	Bacteria	2080
553	Ga0501074_0162367	3300049590	Unclassified	1596
554	Ga0501074_0213592	3300049590	Bacteria	1374
555	Ga0501074_0365529	3300049590	Bacteria	1024
556	Ga0501075_0001969	3300049591	Bacteria	13553
557	Ga0501075_0002606	3300049591	Bacteria	12046
558	Ga0501075_0008130	3300049591	Bacteria	7299
559	Ga0501075_0103788	3300049591	Bacteria	2160
560	Ga0501075_0123564	3300049591	Bacteria	1970
561	Ga0501075_0389001	3300049591	Bacteria	1063
562	Ga0501076_0000167	3300049592	Bacteria	38185
563	Ga0501076_0000927	3300049592	Bacteria	19101
564	Ga0501076_0005900	3300049592	Bacteria	8838
565	Ga0501076_0045143	3300049592	Bacteria	3478
566	Ga0501076_0159109	3300049592	Bacteria	1839
567	Ga0501076_0597428	3300049592	Bacteria	910
568	Ga0501077_0000090	3300049593	Bacteria	46393
569	Ga0501077_0001360	3300049593	Bacteria	14716
570	Ga0501077_0027141	3300049593	Bacteria	3635
571	Ga0501235_069298	3300049669	Bacteria	833
572	Ga0501079_0000002	3300049741	Bacteria	110171
573	Ga0501079_0026161	3300049741	Bacteria	4474
574	Ga0501079_0078797	3300049741	Bacteria	2548
575	Ga0501079_0767592	3300049741	Bacteria	759
576	Ga0501080_0000220	3300049742	Bacteria	42515
577	Ga0501080_0055710	3300049742	Bacteria	3682
578	Ga0501080_0199959	3300049742	Bacteria	1835
579	Ga0501080_0595647	3300049742	Bacteria	982
580	Ga0501081_0000029	3300049743	Bacteria	52725
581	Ga0501081_0028122	3300049743	Bacteria	3792
582	Ga0501081_0045046	3300049743	Bacteria	3029
583	Ga0501081_0091750	3300049743	Unclassified	2137
584	Ga0501081_0099028	3300049743	Bacteria	2059
585	Ga0501081_0143801	3300049743	Unclassified	1710
586	Ga0501081_0204958	3300049743	Bacteria	1431
587	Ga0501081_0544898	3300049743	Bacteria	866
588	Ga0501081_0657539	3300049743	Bacteria	786
589	Ga0501083_0000134	3300049744	Bacteria	50126
590	Ga0501083_0491737	3300049744	Bacteria	798
591	Ga0501035_0001409	3300049822	Bacteria	24656
592	Ga0501035_0007706	3300049822	Bacteria	10057
593	Ga0501044_0013763	3300049823	Bacteria	8741
594	Ga0501044_0356035	3300049823	Bacteria	1382
595	Ga0501045_0000420	3300049824	Bacteria	25873
596	Ga0501045_0003228	3300049824	Bacteria	11142
597	Ga0501045_0007132	3300049824	Bacteria	7752
598	Ga0501045_0010731	3300049824	Bacteria	6421
599	Ga0501045_0411347	3300049824	Unclassified	1006
600	Ga0501045_0415673	3300049824	Bacteria	1000
601	nmdc:mga05p37_196431_c1	3300050507	Unclassified	2446
602	nmdc:mga05p37_334457_c1	3300050507	Bacteria	1788
603	nmdc:mga05p37_47214_c1	3300050507	Bacteria	5295
604	nmdc:mga09592_23188_c1	3300050508	Bacteria	5124
605	nmdc:mga09592_49545_c1	3300050508	Bacteria	3541
606	nmdc:mga0qj67_321228_c1	3300050509	Bacteria	1253
607	nmdc:mga0qj67_33217_c1	3300050509	Bacteria	4026
608	nmdc:mga06r32_428641_c1	3300050510	Bacteria	1303
609	nmdc:mga06r32_479143_c1	3300050510	Bacteria	1222
610	nmdc:mga06r32_6458_c1	3300050510	Bacteria	10535
611	nmdc:mga08y16_6362_c1	3300050511	Bacteria	12387
612	nmdc:mga0n895_333405_c1	3300050512	Bacteria	1537
613	nmdc:mga0n895_364809_c1	3300050512	Bacteria	1462
614	nmdc:mga0n895_632877_c1	3300050512	Unclassified	1070
615	nmdc:mga0n895_82457_c1	3300050512	Bacteria	3206
616	nmdc:mga0rr50_167507_c1	3300050513	Bacteria	1788
617	nmdc:mga0rr50_559734_c1	3300050513	Unclassified	974
618	nmdc:mga08x19_142319_c1	3300050514	Unclassified	1621
619	nmdc:mga08x19_144225_c1	3300050514	Bacteria	1610
620	nmdc:mga08x19_264854_c1	3300050514	Unclassified	1189
621	nmdc:mga08x19_27478_c1	3300050514	Bacteria	3559
622	nmdc:mga08x19_486651_c1	3300050514	Bacteria	870
623	nmdc:mga08x19_560573_c1	3300050514	Unclassified	809
624	nmdc:mga0a205_639313_c1	3300050515	Unclassified	916
625	Ga0495619_0074607	3300053085	Bacteria	2275
626	Ga0501084_0000504	3300054114	Bacteria	29875
627	Ga0501084_0000665	3300054114	Bacteria	26214
628	Ga0501084_0009509	3300054114	Bacteria	8044
629	Ga0501084_0161977	3300054114	Bacteria	1887
630	Ga0501084_0225576	3300054114	Bacteria	1581
631	Ga0590075_067071	3300059424	Bacteria	926
632	Ga0587113_005513	3300059625	Bacteria	1046
633	Ga0501082_0000118	3300060353	Bacteria	62733
634	Ga0501082_0002784	3300060353	Bacteria	15267
635	Ga0501082_0010421	3300060353	Bacteria	8001
636	Ga0501082_0100917	3300060353	Bacteria	2496
637	Ga0501082_0141820	3300060353	Bacteria	2085
638	Ga0501082_0471526	3300060353	Bacteria	1097
639	Ga0466962_0000277	3300061719	Bacteria	21664
640	Ga0466962_0005779	3300061719	Bacteria	5942
641	Ga0466962_0116158	3300061719	Bacteria	1289
642	Ga0530510_0000359	3300061734	Bacteria	29509
643	Ga0530510_0004474	3300061734	Bacteria	9675
644	Ga0530510_0019508	3300061734	Bacteria	4813
645	Ga0530510_0034641	3300061734	Bacteria	3638
646	Ga0530510_0046001	3300061734	Bacteria	3153
647	Ga0530510_0090742	3300061734	Bacteria	2229
648	Ga0530510_0254330	3300061734	Unclassified	1309
649	Ga0530510_0338948	3300061734	Bacteria	1128
650	Ga0530510_0415492	3300061734	Bacteria	1015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005339	Ga0070660_100519918	Ga0070660_1005199181	199
2	3300025919	Ga0207657_10520360	Ga0207657_105203601	199
3	3300025935	Ga0207709_10431992	Ga0207709_104319921	204
4	3300005327	Ga0070658_10009214	Ga0070658_100092148	205
5	3300005339	Ga0070660_100005149	Ga0070660_10000514911	205
6	3300005339	Ga0070660_100211499	Ga0070660_1002114993	205
7	3300005435	Ga0070714_100009829	Ga0070714_1000098293	205
8	3300005435	Ga0070714_100184210	Ga0070714_1001842103	205
9	3300005458	Ga0070681_10066301	Ga0070681_100663013	205
10	3300005530	Ga0070679_100490370	Ga0070679_1004903702	205
11	3300005539	Ga0068853_100224417	Ga0068853_1002244173	205
12	3300005563	Ga0068855_100045858	Ga0068855_1000458587	205
13	3300009093	Ga0105240_10150058	Ga0105240_101500584	205
14	3300013100	Ga0157373_10288772	Ga0157373_102887722	205
15	3300013104	Ga0157370_10003267	Ga0157370_1000326722	205
16	3300013104	Ga0157370_10015349	Ga0157370_100153493	205
17	3300013105	Ga0157369_10027188	Ga0157369_100271888	205
18	3300013105	Ga0157369_10086241	Ga0157369_100862413	205
19	3300013105	Ga0157369_10187667	Ga0157369_101876672	205
20	3300020069	Ga0197907_10178759	Ga0197907_101787592	205
21	3300020070	Ga0206356_10008561	Ga0206356_100085615	205
22	3300020081	Ga0206354_10152643	Ga0206354_101526433	205
23	3300020082	Ga0206353_10450844	Ga0206353_104508445	205
24	3300022467	Ga0224712_10088628	Ga0224712_100886282	205
25	3300025912	Ga0207707_10125014	Ga0207707_101250142	205
26	3300025913	Ga0207695_10233303	Ga0207695_102333032	205
27	3300025919	Ga0207657_10002374	Ga0207657_1000237425	205
28	3300025919	Ga0207657_10007470	Ga0207657_1000747018	205
29	3300025919	Ga0207657_10418056	Ga0207657_104180562	205
30	3300025920	Ga0207649_10035162	Ga0207649_100351621	205
31	3300025921	Ga0207652_10085073	Ga0207652_100850732	205
32	3300025949	Ga0207667_10047893	Ga0207667_100478935	205
33	3300025949	Ga0207667_10268659	Ga0207667_102686591	205
34	3300025949	Ga0207667_10294603	Ga0207667_102946033	205
35	3300037312	Ga0395899_0228261	Ga0395899_0228261_319_939	205
36	3300037312	Ga0395899_0316481	Ga0395899_0316481_38_658	205
37	3300037418	Ga0395900_0166636	Ga0395900_0166636_974_1594	205
38	3300037471	Ga0395905_0112030	Ga0395905_0112030_289_909	205
39	3300038443	Ga0395901_0174493	Ga0395901_0174493_921_1541	205
40	3300049583	Ga0501067_0205661	Ga0501067_0205661_225_866	205
41	3300005329	Ga0070683_100002449	Ga0070683_1000024491	206
42	3300005336	Ga0070680_100264434	Ga0070680_1002644342	206
43	3300005458	Ga0070681_10134082	Ga0070681_101340823	206
44	3300005530	Ga0070679_100027195	Ga0070679_1000271957	206
45	3300005535	Ga0070684_100150405	Ga0070684_1001504053	206
46	3300005563	Ga0068855_100727698	Ga0068855_1007276982	206
47	3300009093	Ga0105240_10210329	Ga0105240_102103293	206
48	3300013104	Ga0157370_10408530	Ga0157370_104085302	206
49	3300013307	Ga0157372_10755824	Ga0157372_107558243	206
50	3300020070	Ga0206356_10375744	Ga0206356_103757443	206
51	3300020081	Ga0206354_10268698	Ga0206354_102686982	206
52	3300020081	Ga0206354_10807547	Ga0206354_108075472	206
53	3300020082	Ga0206353_10021877	Ga0206353_100218775	206
54	3300020082	Ga0206353_10295462	Ga0206353_102954624	206
55	3300025912	Ga0207707_10092454	Ga0207707_100924543	206
56	3300025921	Ga0207652_10760549	Ga0207652_107605492	206
57	3300025944	Ga0207661_10170484	Ga0207661_101704842	206
58	3300025949	Ga0207667_10153581	Ga0207667_101535812	206
59	3300038443	Ga0395901_0487206	Ga0395901_0487206_562_1188	206
60	3300045976	Ga0466967_0008248	Ga0466967_0008248_5882_6508	206
61	3300005435	Ga0070714_100035252	Ga0070714_1000352524	207
62	3300005445	Ga0070708_100643969	Ga0070708_1006439691	207
63	3300005616	Ga0068852_101019466	Ga0068852_1010194662	207
64	3300006028	Ga0070717_10012634	Ga0070717_100126342	207
65	3300025929	Ga0207664_10098659	Ga0207664_100986592	207
66	3300025949	Ga0207667_10620012	Ga0207667_106200122	207
67	3300031548	Ga0307408_100283451	Ga0307408_1002834512	207
68	3300031901	Ga0307406_10019641	Ga0307406_100196413	207
69	3300031995	Ga0307409_100510612	Ga0307409_1005106122	207
70	3300035118	Ga0373954_0271320	Ga0373954_0271320_33_665	207
71	3300035119	Ga0373956_0058262	Ga0373956_0058262_673_1305	207
72	3300036401	Ga0373937_0125258	Ga0373937_0125258_1038_1670	207
73	3300044683	Ga0466965_0024472	Ga0466965_0024472_1366_2025	207
74	3300044684	Ga0466966_0043918	Ga0466966_0043918_536_1195	207
75	3300044693	Ga0466961_0003015	Ga0466961_0003015_1145_1804	207
76	3300044694	Ga0466963_0004378	Ga0466963_0004378_2401_3060	207
77	3300044719	Ga0466971_0000094	Ga0466971_0000094_8661_9320	207
78	3300044765	Ga0466970_0142017	Ga0466970_0142017_206_865	207
79	3300044842	Ga0466957_0002095	Ga0466957_0002095_9294_9953	207
80	3300045049	Ga0466959_0011462	Ga0466959_0011462_2758_3417	207
81	3300045836	Ga0466958_0000511	Ga0466958_0000511_5933_6592	207
82	3300045976	Ga0466967_0001450	Ga0466967_0001450_10035_10694	207
83	3300046462	Ga0495651_0009754	Ga0495651_0009754_5120_5752	207
84	3300046463	Ga0495653_0092389	Ga0495653_0092389_583_1215	207
85	3300046511	Ga0495608_0020124	Ga0495608_0020124_1895_2527	207
86	3300046514	Ga0495618_0074226	Ga0495618_0074226_278_910	207
87	3300046559	Ga0495667_0090672	Ga0495667_0090672_449_1081	207
88	3300046642	Ga0495634_0118122	Ga0495634_0118122_793_1425	207
89	3300046675	Ga0495657_0015073	Ga0495657_0015073_3315_3947	207
90	3300046809	Ga0495600_0286938	Ga0495600_0286938_311_943	207
91	3300047317	Ga0495604_0222468	Ga0495604_0222468_42_674	207
92	3300047322	Ga0495680_0007510	Ga0495680_0007510_645_1277	207
93	3300047471	Ga0495684_0005954	Ga0495684_0005954_3645_4277	207
94	3300048910	Ga0496107_0272116	Ga0496107_0272116_196_825	207
95	3300053085	Ga0495619_0074607	Ga0495619_0074607_648_1280	207
96	3300061719	Ga0466962_0000277	Ga0466962_0000277_6833_7492	207
97	3300005329	Ga0070683_100303097	Ga0070683_1003030972	208
98	3300005336	Ga0070680_100865054	Ga0070680_1008650541	208
99	3300005337	Ga0070682_100006784	Ga0070682_1000067845	208
100	3300005339	Ga0070660_100036931	Ga0070660_1000369312	208
101	3300005344	Ga0070661_100075731	Ga0070661_1000757313	208
102	3300005435	Ga0070714_100870694	Ga0070714_1008706941	208
103	3300005458	Ga0070681_10202806	Ga0070681_102028061	208
104	3300005530	Ga0070679_100087031	Ga0070679_1000870313	208
105	3300005539	Ga0068853_100276752	Ga0068853_1002767522	208
106	3300013100	Ga0157373_10194127	Ga0157373_101941272	208
107	3300013307	Ga0157372_10032737	Ga0157372_100327375	208
108	3300020070	Ga0206356_11029346	Ga0206356_110293462	208
109	3300020082	Ga0206353_11357980	Ga0206353_113579803	208
110	3300025909	Ga0207705_10463452	Ga0207705_104634521	208
111	3300025912	Ga0207707_10027194	Ga0207707_100271944	208
112	3300025913	Ga0207695_10453469	Ga0207695_104534692	208
113	3300025917	Ga0207660_10130802	Ga0207660_101308022	208
114	3300025919	Ga0207657_10005684	Ga0207657_100056843	208
115	3300025920	Ga0207649_10190191	Ga0207649_101901912	208
116	3300025921	Ga0207652_10014084	Ga0207652_100140845	208
117	3300025924	Ga0207694_10388147	Ga0207694_103881472	208
118	3300025932	Ga0207690_10271711	Ga0207690_102717112	208
119	3300028558	Ga0265326_10009353	Ga0265326_100093531	208
120	3300028563	Ga0265319_1005226	Ga0265319_10052263	208
121	3300028563	Ga0265319_1073179	Ga0265319_10731792	208
122	3300028573	Ga0265334_10000983	Ga0265334_100009833	208
123	3300028573	Ga0265334_10093985	Ga0265334_100939852	208
124	3300028577	Ga0265318_10001019	Ga0265318_1000101915	208
125	3300028577	Ga0265318_10075296	Ga0265318_100752962	208
126	3300028653	Ga0265323_10033761	Ga0265323_100337612	208
127	3300028654	Ga0265322_10025444	Ga0265322_100254443	208
128	3300028800	Ga0265338_10036088	Ga0265338_100360884	208
129	3300031235	Ga0265330_10006759	Ga0265330_100067593	208
130	3300031238	Ga0265332_10003729	Ga0265332_100037296	208
131	3300031239	Ga0265328_10003705	Ga0265328_100037053	208
132	3300031240	Ga0265320_10018935	Ga0265320_100189352	208
133	3300031241	Ga0265325_10001203	Ga0265325_100012032	208
134	3300031242	Ga0265329_10006002	Ga0265329_100060022	208
135	3300031247	Ga0265340_10019556	Ga0265340_100195563	208
136	3300031249	Ga0265339_10010593	Ga0265339_100105933	208
137	3300031250	Ga0265331_10019898	Ga0265331_100198984	208
138	3300031251	Ga0265327_10009243	Ga0265327_100092433	208
139	3300031344	Ga0265316_10025553	Ga0265316_100255538	208
140	3300031595	Ga0265313_10002373	Ga0265313_1000237316	208
141	3300031595	Ga0265313_10157778	Ga0265313_101577782	208
142	3300031711	Ga0265314_10017031	Ga0265314_100170318	208
143	3300031711	Ga0265314_10151963	Ga0265314_101519632	208
144	3300031712	Ga0265342_10012514	Ga0265342_100125143	208
145	3300048911	Ga0496108_0260414	Ga0496108_0260414_562_1188	208
146	3300048912	Ga0496109_0395269	Ga0496109_0395269_331_957	208
147	3300048915	Ga0496112_0018356	Ga0496112_0018356_1840_2466	208
148	3300048915	Ga0496112_0129143	Ga0496112_0129143_1252_1878	208
149	3300048916	Ga0496113_0389370	Ga0496113_0389370_307_933	208
150	3300054114	Ga0501084_0161977	Ga0501084_0161977_22_705	208
151	3300005329	Ga0070683_100258196	Ga0070683_1002581961	209
152	3300005336	Ga0070680_100218939	Ga0070680_1002189392	209
153	3300005339	Ga0070660_100041966	Ga0070660_1000419665	209
154	3300005339	Ga0070660_100135208	Ga0070660_1001352082	209
155	3300005444	Ga0070694_100065826	Ga0070694_1000658263	209
156	3300005458	Ga0070681_10039323	Ga0070681_100393232	209
157	3300005458	Ga0070681_10347045	Ga0070681_103470452	209
158	3300005468	Ga0070707_100108894	Ga0070707_1001088941	209
159	3300005468	Ga0070707_100276902	Ga0070707_1002769021	209
160	3300005471	Ga0070698_100608593	Ga0070698_1006085931	209
161	3300005530	Ga0070679_100022648	Ga0070679_1000226485	209
162	3300005535	Ga0070684_100023856	Ga0070684_1000238564	209
163	3300005535	Ga0070684_100478949	Ga0070684_1004789492	209
164	3300005563	Ga0068855_100015497	Ga0068855_1000154972	209
165	3300013307	Ga0157372_10555724	Ga0157372_105557241	209
166	3300013307	Ga0157372_10899391	Ga0157372_108993912	209
167	3300025912	Ga0207707_10417893	Ga0207707_104178932	209
168	3300025917	Ga0207660_10033967	Ga0207660_100339674	209
169	3300025919	Ga0207657_10007536	Ga0207657_100075366	209
170	3300025920	Ga0207649_10367246	Ga0207649_103672462	209
171	3300025921	Ga0207652_10024916	Ga0207652_100249163	209
172	3300025944	Ga0207661_10279375	Ga0207661_102793751	209
173	3300025944	Ga0207661_10415054	Ga0207661_104150542	209
174	3300031240	Ga0265320_10152854	Ga0265320_101528542	209
175	3300038443	Ga0395901_0233041	Ga0395901_0233041_313_945	209
176	3300044684	Ga0466966_0159705	Ga0466966_0159705_109_768	209
177	3300044693	Ga0466961_0198001	Ga0466961_0198001_336_995	209
178	3300045976	Ga0466967_0022067	Ga0466967_0022067_153_812	209
179	3300045976	Ga0466967_0418671	Ga0466967_0418671_117_764	209
180	3300048905	Ga0496102_0015793	Ga0496102_0015793_1817_2455	209
181	3300048912	Ga0496109_0242720	Ga0496109_0242720_927_1565	209
182	3300048915	Ga0496112_0062227	Ga0496112_0062227_42_710	209
183	3300048915	Ga0496112_0113786	Ga0496112_0113786_150_788	209
184	3300048916	Ga0496113_0435937	Ga0496113_0435937_251_922	209
185	3300005327	Ga0070658_10166482	Ga0070658_101664822	210
186	3300005985	Ga0081539_10094495	Ga0081539_100944952	210
187	3300006844	Ga0075428_100106874	Ga0075428_1001068742	210
188	3300009147	Ga0114129_10028232	Ga0114129_100282327	210
189	3300009148	Ga0105243_10166271	Ga0105243_101662712	210
190	3300013105	Ga0157369_10002142	Ga0157369_100021423	210
191	3300020070	Ga0206356_10464328	Ga0206356_104643281	210
192	3300020081	Ga0206354_11706039	Ga0206354_117060392	210
193	3300025909	Ga0207705_10129194	Ga0207705_101291942	210
194	3300026067	Ga0207678_10756409	Ga0207678_107564092	210
195	3300037471	Ga0395905_0712676	Ga0395905_0712676_64_702	210
196	3300038443	Ga0395901_0376848	Ga0395901_0376848_34_666	210
197	3300044719	Ga0466971_0126710	Ga0466971_0126710_37_684	210
198	3300044842	Ga0466957_0013408	Ga0466957_0013408_3121_3768	210
199	3300045976	Ga0466967_1182191	Ga0466967_1182191_40_681	210
200	3300049571	Ga0501034_0169112	Ga0501034_0169112_510_1151	210
201	3300049741	Ga0501079_0767592	Ga0501079_0767592_48_680	210
202	3300049742	Ga0501080_0595647	Ga0501080_0595647_63_704	210
203	3300061719	Ga0466962_0116158	Ga0466962_0116158_346_993	210
204	3300061734	Ga0530510_0034641	Ga0530510_0034641_412_1065	210
205	3300005530	Ga0070679_100059995	Ga0070679_1000599952	211
206	3300005614	Ga0068856_100224442	Ga0068856_1002244422	211
207	3300006175	Ga0070712_100557518	Ga0070712_1005575181	211
208	3300009093	Ga0105240_10998985	Ga0105240_109989852	211
209	3300013105	Ga0157369_10081746	Ga0157369_100817464	211
210	3300025912	Ga0207707_10068319	Ga0207707_100683193	211
211	3300025921	Ga0207652_10027383	Ga0207652_100273832	211
212	3300025929	Ga0207664_10019438	Ga0207664_100194387	211
213	3300026078	Ga0207702_10235221	Ga0207702_102352212	211
214	3300048905	Ga0496102_0029266	Ga0496102_0029266_25_666	211
215	3300048909	Ga0496106_0013751	Ga0496106_0013751_1812_2453	211
216	3300048910	Ga0496107_0001125	Ga0496107_0001125_13358_13999	211
217	3300048911	Ga0496108_0653468	Ga0496108_0653468_193_834	211
218	3300048915	Ga0496112_0339191	Ga0496112_0339191_318_959	211
219	3300048916	Ga0496113_0200830	Ga0496113_0200830_440_1081	211
220	3300049587	Ga0501071_0542711	Ga0501071_0542711_66_746	211
221	3300061734	Ga0530510_0254330	Ga0530510_0254330_620_1255	211
222	3300005435	Ga0070714_100000004	Ga0070714_100000004162	212
223	3300005436	Ga0070713_100067052	Ga0070713_1000670522	212
224	3300005981	Ga0081538_10045839	Ga0081538_100458392	212
225	3300006028	Ga0070717_10016222	Ga0070717_100162224	212
226	3300025915	Ga0207693_10144035	Ga0207693_101440352	212
227	3300025915	Ga0207693_10765328	Ga0207693_107653281	212
228	3300025916	Ga0207663_10894476	Ga0207663_108944761	212
229	3300025929	Ga0207664_10000018	Ga0207664_1000001860	212
230	3300028563	Ga0265319_1004662	Ga0265319_10046622	212
231	3300028573	Ga0265334_10065151	Ga0265334_100651512	212
232	3300028577	Ga0265318_10020538	Ga0265318_100205382	212
233	3300028800	Ga0265338_10097020	Ga0265338_100970203	212
234	3300031240	Ga0265320_10004954	Ga0265320_100049542	212
235	3300031241	Ga0265325_10060964	Ga0265325_100609642	212
236	3300031251	Ga0265327_10067269	Ga0265327_100672692	212
237	3300031711	Ga0265314_10057217	Ga0265314_100572173	212
238	3300031712	Ga0265342_10101080	Ga0265342_101010802	212
239	3300047322	Ga0495680_0314016	Ga0495680_0314016_257_934	212
240	3300049568	Ga0501031_0159289	Ga0501031_0159289_11_649	212
241	3300049570	Ga0501033_0092854	Ga0501033_0092854_1207_1845	212
242	3300049572	Ga0501036_0108070	Ga0501036_0108070_550_1188	212
243	3300049575	Ga0501039_0041511	Ga0501039_0041511_1906_2544	212
244	3300049576	Ga0501040_0109498	Ga0501040_0109498_860_1498	212
245	3300049577	Ga0501041_0134167	Ga0501041_0134167_18_656	212
246	3300049578	Ga0501042_0070334	Ga0501042_0070334_878_1516	212
247	3300049579	Ga0501043_0207180	Ga0501043_0207180_467_1105	212
248	3300049580	Ga0501046_0258714	Ga0501046_0258714_235_873	212
249	3300049582	Ga0501048_0040848	Ga0501048_0040848_2056_2694	212
250	3300049587	Ga0501071_0004080	Ga0501071_0004080_7718_8356	212
251	3300049588	Ga0501072_0035021	Ga0501072_0035021_2980_3618	212
252	3300049590	Ga0501074_0099603	Ga0501074_0099603_1247_1885	212
253	3300049591	Ga0501075_0008130	Ga0501075_0008130_2274_2912	212
254	3300049592	Ga0501076_0045143	Ga0501076_0045143_1484_2122	212
255	3300049741	Ga0501079_0026161	Ga0501079_0026161_1072_1710	212
256	3300049743	Ga0501081_0143801	Ga0501081_0143801_1024_1662	212
257	3300049824	Ga0501045_0010731	Ga0501045_0010731_3990_4628	212
258	3300054114	Ga0501084_0009509	Ga0501084_0009509_5039_5677	212
259	3300060353	Ga0501082_0100917	Ga0501082_0100917_997_1635	212
260	3300061734	Ga0530510_0046001	Ga0530510_0046001_1263_1901	212
261	3300014497	Ga0182008_10084876	Ga0182008_100848761	213
262	3300061734	Ga0530510_0415492	Ga0530510_0415492_227_898	213
263	3300005435	Ga0070714_100074256	Ga0070714_1000742563	214
264	3300005435	Ga0070714_100349497	Ga0070714_1003494972	214
265	3300005436	Ga0070713_100130587	Ga0070713_1001305872	214
266	3300005468	Ga0070707_100368694	Ga0070707_1003686942	214
267	3300005471	Ga0070698_100316983	Ga0070698_1003169832	214
268	3300005545	Ga0070695_100387722	Ga0070695_1003877222	214
269	3300006914	Ga0075436_100041786	Ga0075436_1000417863	214
270	3300007265	Ga0099794_10000144	Ga0099794_1000014419	214
271	3300007265	Ga0099794_10028936	Ga0099794_100289362	214
272	3300025929	Ga0207664_10132063	Ga0207664_101320632	214
273	3300025939	Ga0207665_10183211	Ga0207665_101832112	214
274	3300027671	Ga0209588_1000349	Ga0209588_100034912	214
275	3300048905	Ga0496102_0132490	Ga0496102_0132490_1533_2189	214
276	3300048909	Ga0496106_0106691	Ga0496106_0106691_72_728	214
277	3300048910	Ga0496107_0102928	Ga0496107_0102928_338_994	214
278	3300048912	Ga0496109_0377190	Ga0496109_0377190_608_1264	214
279	3300050514	nmdc:mga08x19_27478_c1	nmdc:mga08x19_27478_c1_1077_1727	214
280	3300005406	Ga0070703_10005870	Ga0070703_100058705	215
281	3300005440	Ga0070705_100000445	Ga0070705_10000044513	215
282	3300005440	Ga0070705_100382968	Ga0070705_1003829682	215
283	3300005445	Ga0070708_100000018	Ga0070708_10000001885	215
284	3300005445	Ga0070708_100002296	Ga0070708_1000022968	215
285	3300005445	Ga0070708_100057774	Ga0070708_1000577743	215
286	3300005445	Ga0070708_100181094	Ga0070708_1001810942	215
287	3300005445	Ga0070708_100228616	Ga0070708_1002286162	215
288	3300005445	Ga0070708_100255227	Ga0070708_1002552272	215
289	3300005445	Ga0070708_100361816	Ga0070708_1003618161	215
290	3300005467	Ga0070706_100000026	Ga0070706_100000026115	215
291	3300005467	Ga0070706_100000157	Ga0070706_10000015721	215
292	3300005467	Ga0070706_100000354	Ga0070706_10000035434	215
293	3300005467	Ga0070706_100000566	Ga0070706_10000056632	215
294	3300005467	Ga0070706_100011315	Ga0070706_10001131510	215
295	3300005467	Ga0070706_100228880	Ga0070706_1002288802	215
296	3300005467	Ga0070706_100371148	Ga0070706_1003711481	215
297	3300005467	Ga0070706_100374738	Ga0070706_1003747382	215
298	3300005467	Ga0070706_100381052	Ga0070706_1003810522	215
299	3300005468	Ga0070707_100000004	Ga0070707_10000000486	215
300	3300005468	Ga0070707_100000396	Ga0070707_1000003962	215
301	3300005468	Ga0070707_100005818	Ga0070707_10000581812	215
302	3300005468	Ga0070707_100015636	Ga0070707_1000156365	215
303	3300005468	Ga0070707_100020341	Ga0070707_1000203416	215
304	3300005468	Ga0070707_100262393	Ga0070707_1002623931	215
305	3300005468	Ga0070707_100333251	Ga0070707_1003332512	215
306	3300005468	Ga0070707_100667298	Ga0070707_1006672982	215
307	3300005471	Ga0070698_100004617	Ga0070698_1000046174	215
308	3300005471	Ga0070698_100093391	Ga0070698_1000933913	215
309	3300005471	Ga0070698_100287711	Ga0070698_1002877112	215
310	3300005471	Ga0070698_100355512	Ga0070698_1003555122	215
311	3300005471	Ga0070698_100655050	Ga0070698_1006550501	215
312	3300005518	Ga0070699_100000042	Ga0070699_10000004221	215
313	3300005518	Ga0070699_100000118	Ga0070699_10000011820	215
314	3300005518	Ga0070699_100000307	Ga0070699_10000030713	215
315	3300005518	Ga0070699_100007721	Ga0070699_1000077212	215
316	3300005518	Ga0070699_100035121	Ga0070699_1000351214	215
317	3300005518	Ga0070699_100045888	Ga0070699_1000458884	215
318	3300005518	Ga0070699_100076319	Ga0070699_1000763193	215
319	3300005518	Ga0070699_100090862	Ga0070699_1000908622	215
320	3300005518	Ga0070699_100121650	Ga0070699_1001216503	215
321	3300005536	Ga0070697_100000025	Ga0070697_100000025114	215
322	3300005536	Ga0070697_100007893	Ga0070697_1000078935	215
323	3300005536	Ga0070697_100036686	Ga0070697_1000366864	215
324	3300005536	Ga0070697_100041487	Ga0070697_1000414874	215
325	3300005536	Ga0070697_100048918	Ga0070697_1000489184	215
326	3300005536	Ga0070697_100050288	Ga0070697_1000502882	215
327	3300005536	Ga0070697_100057062	Ga0070697_1000570623	215
328	3300005536	Ga0070697_100086412	Ga0070697_1000864123	215
329	3300005545	Ga0070695_100010014	Ga0070695_1000100142	215
330	3300005545	Ga0070695_100178099	Ga0070695_1001780992	215
331	3300006028	Ga0070717_10000225	Ga0070717_1000022539	215
332	3300006028	Ga0070717_10003774	Ga0070717_100037745	215
333	3300006175	Ga0070712_100286889	Ga0070712_1002868892	215
334	3300006871	Ga0075434_100129880	Ga0075434_1001298802	215
335	3300006871	Ga0075434_100893751	Ga0075434_1008937511	215
336	3300006914	Ga0075436_100042085	Ga0075436_1000420853	215
337	3300006914	Ga0075436_100111287	Ga0075436_1001112872	215
338	3300007076	Ga0075435_100156877	Ga0075435_1001568772	215
339	3300007076	Ga0075435_100196695	Ga0075435_1001966952	215
340	3300007076	Ga0075435_100207163	Ga0075435_1002071632	215
341	3300007265	Ga0099794_10000627	Ga0099794_100006272	215
342	3300009553	Ga0105249_10140447	Ga0105249_101404473	215
343	3300025885	Ga0207653_10006747	Ga0207653_100067472	215
344	3300025885	Ga0207653_10041692	Ga0207653_100416922	215
345	3300025910	Ga0207684_10000005	Ga0207684_10000005226	215
346	3300025910	Ga0207684_10000014	Ga0207684_10000014223	215
347	3300025910	Ga0207684_10000027	Ga0207684_10000027241	215
348	3300025910	Ga0207684_10000034	Ga0207684_10000034117	215
349	3300025910	Ga0207684_10006070	Ga0207684_100060702	215
350	3300025910	Ga0207684_10055386	Ga0207684_100553863	215
351	3300025910	Ga0207684_10084472	Ga0207684_100844723	215
352	3300025910	Ga0207684_10249808	Ga0207684_102498082	215
353	3300025910	Ga0207684_10275180	Ga0207684_102751802	215
354	3300025910	Ga0207684_10468521	Ga0207684_104685211	215
355	3300025922	Ga0207646_10000018	Ga0207646_10000018117	215
356	3300025922	Ga0207646_10000111	Ga0207646_1000011160	215
357	3300025922	Ga0207646_10000119	Ga0207646_1000011959	215
358	3300025922	Ga0207646_10000439	Ga0207646_1000043923	215
359	3300025922	Ga0207646_10001009	Ga0207646_1000100932	215
360	3300025922	Ga0207646_10003108	Ga0207646_1000310815	215
361	3300025922	Ga0207646_10006973	Ga0207646_100069732	215
362	3300025922	Ga0207646_10016000	Ga0207646_100160005	215
363	3300025922	Ga0207646_10050996	Ga0207646_100509964	215
364	3300025922	Ga0207646_10125962	Ga0207646_101259623	215
365	3300025922	Ga0207646_10324427	Ga0207646_103244272	215
366	3300027671	Ga0209588_1029833	Ga0209588_10298332	215
367	3300028800	Ga0265338_10179150	Ga0265338_101791502	215
368	3300031911	Ga0307412_10013609	Ga0307412_100136093	215
369	3300032005	Ga0307411_10153036	Ga0307411_101530362	215
370	3300032126	Ga0307415_100368455	Ga0307415_1003684552	215
371	3300037418	Ga0395900_0085369	Ga0395900_0085369_1042_1710	215
372	3300037471	Ga0395905_0029028	Ga0395905_0029028_1993_2661	215
373	3300038443	Ga0395901_0007165	Ga0395901_0007165_6385_7053	215
374	3300049572	Ga0501036_0012331	Ga0501036_0012331_6378_7067	215
375	3300049572	Ga0501036_0641609	Ga0501036_0641609_132_821	215
376	3300049573	Ga0501037_0277861	Ga0501037_0277861_394_1083	215
377	3300049576	Ga0501040_0003624	Ga0501040_0003624_8040_8729	215
378	3300049577	Ga0501041_0056221	Ga0501041_0056221_519_1208	215
379	3300049578	Ga0501042_0047147	Ga0501042_0047147_788_1477	215
380	3300049579	Ga0501043_0614742	Ga0501043_0614742_19_708	215
381	3300049580	Ga0501046_0161658	Ga0501046_0161658_841_1524	215
382	3300049582	Ga0501048_0014988	Ga0501048_0014988_3174_3863	215
383	3300049587	Ga0501071_0156190	Ga0501071_0156190_977_1660	215
384	3300049588	Ga0501072_0093780	Ga0501072_0093780_866_1555	215
385	3300049588	Ga0501072_0110478	Ga0501072_0110478_1426_2109	215
386	3300049590	Ga0501074_0213592	Ga0501074_0213592_90_779	215
387	3300049591	Ga0501075_0103788	Ga0501075_0103788_1454_2137	215
388	3300049592	Ga0501076_0000927	Ga0501076_0000927_10285_10974	215
389	3300049592	Ga0501076_0159109	Ga0501076_0159109_102_785	215
390	3300049593	Ga0501077_0001360	Ga0501077_0001360_13982_14671	215
391	3300049669	Ga0501235_069298	Ga0501235_069298_86_778	215
392	3300049741	Ga0501079_0078797	Ga0501079_0078797_1199_1882	215
393	3300049743	Ga0501081_0045046	Ga0501081_0045046_825_1514	215
394	3300049743	Ga0501081_0099028	Ga0501081_0099028_692_1375	215
395	3300049824	Ga0501045_0003228	Ga0501045_0003228_10093_10782	215
396	3300050512	nmdc:mga0n895_333405_c1	nmdc:mga0n895_333405_c1_41_694	215
397	3300050512	nmdc:mga0n895_364809_c1	nmdc:mga0n895_364809_c1_41_694	215
398	3300050512	nmdc:mga0n895_632877_c1	nmdc:mga0n895_632877_c1_214_867	215
399	3300050513	nmdc:mga0rr50_167507_c1	nmdc:mga0rr50_167507_c1_438_1091	215
400	3300050513	nmdc:mga0rr50_559734_c1	nmdc:mga0rr50_559734_c1_55_708	215
401	3300050514	nmdc:mga08x19_142319_c1	nmdc:mga08x19_142319_c1_879_1532	215
402	3300050514	nmdc:mga08x19_144225_c1	nmdc:mga08x19_144225_c1_731_1384	215
403	3300050514	nmdc:mga08x19_264854_c1	nmdc:mga08x19_264854_c1_210_863	215
404	3300050514	nmdc:mga08x19_486651_c1	nmdc:mga08x19_486651_c1_138_791	215
405	3300050514	nmdc:mga08x19_560573_c1	nmdc:mga08x19_560573_c1_27_680	215
406	3300050515	nmdc:mga0a205_639313_c1	nmdc:mga0a205_639313_c1_101_754	215
407	3300060353	Ga0501082_0010421	Ga0501082_0010421_1581_2270	215
408	3300061734	Ga0530510_0019508	Ga0530510_0019508_99_782	215
409	3300005356	Ga0070674_100007813	Ga0070674_1000078132	216
410	3300005435	Ga0070714_100913400	Ga0070714_1009134001	216
411	3300005436	Ga0070713_100598062	Ga0070713_1005980622	216
412	3300005530	Ga0070679_100044614	Ga0070679_1000446144	216
413	3300005718	Ga0068866_10086778	Ga0068866_100867782	216
414	3300005840	Ga0068870_10261957	Ga0068870_102619571	216
415	3300006237	Ga0097621_100886543	Ga0097621_1008865431	216
416	3300006881	Ga0068865_100098458	Ga0068865_1000984581	216
417	3300009098	Ga0105245_10068404	Ga0105245_100684044	216
418	3300020077	Ga0206351_10997873	Ga0206351_109978731	216
419	3300022467	Ga0224712_10128996	Ga0224712_101289961	216
420	3300025899	Ga0207642_10259169	Ga0207642_102591691	216
421	3300025912	Ga0207707_10007191	Ga0207707_100071913	216
422	3300025917	Ga0207660_10053546	Ga0207660_100535462	216
423	3300025928	Ga0207700_10289450	Ga0207700_102894501	216
424	3300025929	Ga0207664_10065519	Ga0207664_100655192	216
425	3300049578	Ga0501042_0277438	Ga0501042_0277438_508_1161	216
426	3300035115	Ga0373941_0127293	Ga0373941_0127293_73_726	217
427	3300045051	Ga0451576_0108018	Ga0451576_0108018_966_1652	217
428	3300013105	Ga0157369_10411655	Ga0157369_104116552	218
429	3300022467	Ga0224712_10255536	Ga0224712_102555361	218
430	3300026142	Ga0207698_10582420	Ga0207698_105824202	218
431	3300005327	Ga0070658_10350020	Ga0070658_103500202	219
432	3300005329	Ga0070683_100181936	Ga0070683_1001819362	219
433	3300005535	Ga0070684_100301061	Ga0070684_1003010612	219
434	3300005937	Ga0081455_10184044	Ga0081455_101840442	219
435	3300006844	Ga0075428_100087942	Ga0075428_1000879424	219
436	3300006847	Ga0075431_100334420	Ga0075431_1003344202	219
437	3300009093	Ga0105240_10144207	Ga0105240_101442073	219
438	3300013104	Ga0157370_10006157	Ga0157370_1000615711	219
439	3300020069	Ga0197907_10470264	Ga0197907_104702642	219
440	3300020082	Ga0206353_10469180	Ga0206353_104691801	219
441	3300025909	Ga0207705_10242398	Ga0207705_102423981	219
442	3300025913	Ga0207695_10290932	Ga0207695_102909322	219
443	3300025921	Ga0207652_10084386	Ga0207652_100843863	219
444	3300031548	Ga0307408_100391997	Ga0307408_1003919971	219
445	3300032002	Ga0307416_100016660	Ga0307416_1000166603	219
446	3300032126	Ga0307415_100132761	Ga0307415_1001327612	219
447	3300049568	Ga0501031_0001892	Ga0501031_0001892_11613_12320	219
448	3300049569	Ga0501032_0000886	Ga0501032_0000886_12334_13041	219
449	3300049570	Ga0501033_0000414	Ga0501033_0000414_27443_28150	219
450	3300049572	Ga0501036_0001809	Ga0501036_0001809_12732_13439	219
451	3300049572	Ga0501036_0026991	Ga0501036_0026991_1241_1948	219
452	3300049573	Ga0501037_0000070	Ga0501037_0000070_48215_48922	219
453	3300049574	Ga0501038_0000082	Ga0501038_0000082_29077_29784	219
454	3300049575	Ga0501039_0000077	Ga0501039_0000077_2538_3245	219
455	3300049576	Ga0501040_0002008	Ga0501040_0002008_9485_10192	219
456	3300049576	Ga0501040_0023609	Ga0501040_0023609_3134_3841	219
457	3300049577	Ga0501041_0000007	Ga0501041_0000007_43537_44244	219
458	3300049577	Ga0501041_0073223	Ga0501041_0073223_138_845	219
459	3300049578	Ga0501042_0000011	Ga0501042_0000011_28962_29669	219
460	3300049579	Ga0501043_0005368	Ga0501043_0005368_9364_10071	219
461	3300049579	Ga0501043_0179230	Ga0501043_0179230_266_973	219
462	3300049580	Ga0501046_0000089	Ga0501046_0000089_29017_29724	219
463	3300049580	Ga0501046_0316652	Ga0501046_0316652_37_744	219
464	3300049581	Ga0501047_0000237	Ga0501047_0000237_59108_59815	219
465	3300049582	Ga0501048_0003063	Ga0501048_0003063_1003_1710	219
466	3300049582	Ga0501048_0022220	Ga0501048_0022220_3363_4070	219
467	3300049584	Ga0501068_0000029	Ga0501068_0000029_12732_13439	219
468	3300049584	Ga0501068_0266964	Ga0501068_0266964_73_780	219
469	3300049585	Ga0501069_0000842	Ga0501069_0000842_9510_10217	219
470	3300049586	Ga0501070_0000234	Ga0501070_0000234_21566_22273	219
471	3300049587	Ga0501071_0000020	Ga0501071_0000020_29077_29784	219
472	3300049587	Ga0501071_0233697	Ga0501071_0233697_240_947	219
473	3300049588	Ga0501072_0000132	Ga0501072_0000132_46065_46772	219
474	3300049588	Ga0501072_0063401	Ga0501072_0063401_2084_2791	219
475	3300049589	Ga0501073_0006514	Ga0501073_0006514_70_777	219
476	3300049590	Ga0501074_0000002	Ga0501074_0000002_81970_82677	219
477	3300049591	Ga0501075_0001969	Ga0501075_0001969_9883_10590	219
478	3300049591	Ga0501075_0002606	Ga0501075_0002606_11185_11892	219
479	3300049592	Ga0501076_0000167	Ga0501076_0000167_11316_12023	219
480	3300049592	Ga0501076_0005900	Ga0501076_0005900_6634_7341	219
481	3300049593	Ga0501077_0000090	Ga0501077_0000090_43462_44169	219
482	3300049593	Ga0501077_0027141	Ga0501077_0027141_2285_2992	219
483	3300049741	Ga0501079_0000002	Ga0501079_0000002_83430_84137	219
484	3300049742	Ga0501080_0000220	Ga0501080_0000220_12732_13439	219
485	3300049743	Ga0501081_0000029	Ga0501081_0000029_29077_29784	219
486	3300049744	Ga0501083_0000134	Ga0501083_0000134_29583_30290	219
487	3300049822	Ga0501035_0001409	Ga0501035_0001409_11670_12377	219
488	3300049823	Ga0501044_0013763	Ga0501044_0013763_1621_2328	219
489	3300049824	Ga0501045_0000420	Ga0501045_0000420_23070_23777	219
490	3300049824	Ga0501045_0007132	Ga0501045_0007132_5579_6286	219
491	3300050510	nmdc:mga06r32_428641_c1	nmdc:mga06r32_428641_c1_417_1076	219
492	3300054114	Ga0501084_0000504	Ga0501084_0000504_3134_3841	219
493	3300054114	Ga0501084_0000665	Ga0501084_0000665_23934_24641	219
494	3300060353	Ga0501082_0000118	Ga0501082_0000118_22942_23649	219
495	3300060353	Ga0501082_0002784	Ga0501082_0002784_11351_12058	219
496	3300061734	Ga0530510_0000359	Ga0530510_0000359_3134_3841	219
497	3300061734	Ga0530510_0004474	Ga0530510_0004474_2967_3674	219
498	3300044656	Ga0466969_0005013	Ga0466969_0005013_3150_3851	220
499	3300044684	Ga0466966_0005434	Ga0466966_0005434_1447_2148	220
500	3300044693	Ga0466961_0012153	Ga0466961_0012153_4400_5101	220
501	3300044719	Ga0466971_0009262	Ga0466971_0009262_3126_3827	220
502	3300045049	Ga0466959_0056196	Ga0466959_0056196_2031_2732	220
503	3300045836	Ga0466958_0008317	Ga0466958_0008317_2721_3422	220
504	3300061719	Ga0466962_0005779	Ga0466962_0005779_4898_5599	220
505	3300037466	Ga0395898_0656439	Ga0395898_0656439_174_890	221
506	3300038443	Ga0395901_0206966	Ga0395901_0206966_1183_1899	221
507	3300049743	Ga0501081_0657539	Ga0501081_0657539_54_737	221
508	3300009147	Ga0114129_10001522	Ga0114129_1000152215	222
509	3300050507	nmdc:mga05p37_334457_c1	nmdc:mga05p37_334457_c1_1015_1725	222
510	3300005329	Ga0070683_100001335	Ga0070683_10000133512	223
511	3300005336	Ga0070680_100003057	Ga0070680_1000030574	223
512	3300005337	Ga0070682_100017079	Ga0070682_1000170794	223
513	3300005344	Ga0070661_100150483	Ga0070661_1001504831	223
514	3300005356	Ga0070674_100278261	Ga0070674_1002782611	223
515	3300005530	Ga0070679_100004333	Ga0070679_1000043334	223
516	3300005530	Ga0070679_100157344	Ga0070679_1001573443	223
517	3300005530	Ga0070679_100746477	Ga0070679_1007464772	223
518	3300005535	Ga0070684_100000721	Ga0070684_1000007212	223
519	3300005545	Ga0070695_100000016	Ga0070695_10000001672	223
520	3300005547	Ga0070693_100035179	Ga0070693_1000351793	223
521	3300005549	Ga0070704_100183117	Ga0070704_1001831172	223
522	3300005564	Ga0070664_100017637	Ga0070664_1000176372	223
523	3300005614	Ga0068856_100008596	Ga0068856_1000085964	223
524	3300009174	Ga0105241_10074571	Ga0105241_100745712	223
525	3300009176	Ga0105242_10172182	Ga0105242_101721821	223
526	3300009545	Ga0105237_10150426	Ga0105237_101504261	223
527	3300009551	Ga0105238_10197375	Ga0105238_101973752	223
528	3300010375	Ga0105239_10269943	Ga0105239_102699432	223
529	3300010375	Ga0105239_10806784	Ga0105239_108067841	223
530	3300011119	Ga0105246_10115987	Ga0105246_101159872	223
531	3300013105	Ga0157369_10461070	Ga0157369_104610702	223
532	3300013296	Ga0157374_10078105	Ga0157374_100781053	223
533	3300013307	Ga0157372_10694984	Ga0157372_106949841	223
534	3300013308	Ga0157375_10176519	Ga0157375_101765191	223
535	3300014325	Ga0163163_10183602	Ga0163163_101836022	223
536	3300025912	Ga0207707_10002042	Ga0207707_100020426	223
537	3300025913	Ga0207695_10078359	Ga0207695_100783592	223
538	3300025917	Ga0207660_10010941	Ga0207660_100109414	223
539	3300025921	Ga0207652_10007814	Ga0207652_100078141	223
540	3300025921	Ga0207652_10072438	Ga0207652_100724383	223
541	3300025927	Ga0207687_10008986	Ga0207687_100089865	223
542	3300025934	Ga0207686_10192147	Ga0207686_101921472	223
543	3300025937	Ga0207669_10169501	Ga0207669_101695012	223
544	3300025944	Ga0207661_10000939	Ga0207661_100009395	223
545	3300025945	Ga0207679_10006123	Ga0207679_100061234	223
546	3300026078	Ga0207702_10066702	Ga0207702_100667023	223
547	3300037471	Ga0395905_0686485	Ga0395905_0686485_68_781	223
548	3300045976	Ga0466967_0335957	Ga0466967_0335957_176_889	223
549	3300048904	Ga0496101_0029464	Ga0496101_0029464_1826_2560	223
550	3300048904	Ga0496101_0189287	Ga0496101_0189287_49_759	223
551	3300048905	Ga0496102_0006592	Ga0496102_0006592_2449_3159	223
552	3300048905	Ga0496102_0033216	Ga0496102_0033216_3650_4363	223
553	3300048905	Ga0496102_0190978	Ga0496102_0190978_965_1699	223
554	3300048906	Ga0496103_0030355	Ga0496103_0030355_1688_2398	223
555	3300048906	Ga0496103_0063073	Ga0496103_0063073_1256_1969	223
556	3300048907	Ga0496104_0064911	Ga0496104_0064911_1461_2195	223
557	3300048908	Ga0496105_0016032	Ga0496105_0016032_2782_3492	223
558	3300048908	Ga0496105_0032369	Ga0496105_0032369_2889_3623	223
559	3300048912	Ga0496109_0058319	Ga0496109_0058319_2343_3077	223
560	3300048912	Ga0496109_0185996	Ga0496109_0185996_707_1417	223
561	3300048913	Ga0496110_0003538	Ga0496110_0003538_10905_11639	223
562	3300048913	Ga0496110_0217986	Ga0496110_0217986_947_1657	223
563	3300048917	Ga0496114_0000442	Ga0496114_0000442_23170_23880	223
564	3300048917	Ga0496114_0035763	Ga0496114_0035763_3020_3754	223
565	3300049568	Ga0501031_0222519	Ga0501031_0222519_506_1213	223
566	3300049572	Ga0501036_0149425	Ga0501036_0149425_658_1365	223
567	3300049591	Ga0501075_0389001	Ga0501075_0389001_305_1015	223
568	3300059625	Ga0587113_005513	Ga0587113_005513_282_995	223
569	3300006844	Ga0075428_100172904	Ga0075428_1001729043	224
570	3300009147	Ga0114129_11166826	Ga0114129_111668262	224
571	3300045976	Ga0466967_0140549	Ga0466967_0140549_669_1391	224
572	3300049590	Ga0501074_0162367	Ga0501074_0162367_158_850	224
573	3300049743	Ga0501081_0091750	Ga0501081_0091750_1275_1967	224
574	3300049824	Ga0501045_0411347	Ga0501045_0411347_52_744	224
575	3300009147	Ga0114129_10063047	Ga0114129_100630475	225
576	3300041411	Ga0439466_0065994	Ga0439466_0065994_69_764	225
577	3300049568	Ga0501031_0029365	Ga0501031_0029365_2304_3053	225
578	3300049569	Ga0501032_0035929	Ga0501032_0035929_622_1371	225
579	3300049571	Ga0501034_0055506	Ga0501034_0055506_130_879	225
580	3300049572	Ga0501036_0027857	Ga0501036_0027857_2908_3657	225
581	3300049573	Ga0501037_0222209	Ga0501037_0222209_28_777	225
582	3300049574	Ga0501038_0116553	Ga0501038_0116553_1174_1923	225
583	3300049576	Ga0501040_0090760	Ga0501040_0090760_1120_1869	225
584	3300049578	Ga0501042_0109298	Ga0501042_0109298_143_847	225
585	3300049579	Ga0501043_0029610	Ga0501043_0029610_3543_4292	225
586	3300049581	Ga0501047_0056110	Ga0501047_0056110_2335_3084	225
587	3300049582	Ga0501048_0076114	Ga0501048_0076114_817_1566	225
588	3300049584	Ga0501068_0118636	Ga0501068_0118636_115_864	225
589	3300049587	Ga0501071_0103281	Ga0501071_0103281_802_1551	225
590	3300049588	Ga0501072_0185880	Ga0501072_0185880_220_969	225
591	3300049589	Ga0501073_0018629	Ga0501073_0018629_1128_1877	225
592	3300049590	Ga0501074_0365529	Ga0501074_0365529_61_765	225
593	3300049591	Ga0501075_0123564	Ga0501075_0123564_544_1248	225
594	3300049592	Ga0501076_0597428	Ga0501076_0597428_178_882	225
595	3300049742	Ga0501080_0055710	Ga0501080_0055710_139_888	225
596	3300049742	Ga0501080_0199959	Ga0501080_0199959_699_1403	225
597	3300049743	Ga0501081_0028122	Ga0501081_0028122_1353_2102	225
598	3300049743	Ga0501081_0544898	Ga0501081_0544898_105_809	225
599	3300049744	Ga0501083_0491737	Ga0501083_0491737_33_782	225
600	3300049822	Ga0501035_0007706	Ga0501035_0007706_7052_7801	225
601	3300049823	Ga0501044_0356035	Ga0501044_0356035_101_850	225
602	3300049824	Ga0501045_0415673	Ga0501045_0415673_113_862	225
603	3300050507	nmdc:mga05p37_196431_c1	nmdc:mga05p37_196431_c1_911_1606	225
604	3300054114	Ga0501084_0225576	Ga0501084_0225576_404_1108	225
605	3300060353	Ga0501082_0141820	Ga0501082_0141820_534_1283	225
606	3300060353	Ga0501082_0471526	Ga0501082_0471526_257_961	225
607	3300061734	Ga0530510_0338948	Ga0530510_0338948_139_888	225
608	3300009098	Ga0105245_10805510	Ga0105245_108055102	227
609	3300025927	Ga0207687_10578110	Ga0207687_105781101	227
610	3300025945	Ga0207679_10533785	Ga0207679_105337852	227
611	3300048911	Ga0496108_0692803	Ga0496108_0692803_58_792	227
612	3300005937	Ga0081455_10022642	Ga0081455_100226423	228
613	3300049576	Ga0501040_0155034	Ga0501040_0155034_455_1141	228
614	3300049584	Ga0501068_0037746	Ga0501068_0037746_383_1069	228
615	3300049743	Ga0501081_0204958	Ga0501081_0204958_685_1371	228
616	3300003911	JGI25405J52794_10050818	JGI25405J52794_100508181	229
617	3300005937	Ga0081455_10009379	Ga0081455_100093792	229
618	3300005937	Ga0081455_10024163	Ga0081455_100241636	229
619	3300005981	Ga0081538_10106617	Ga0081538_101066172	229
620	3300006844	Ga0075428_100024964	Ga0075428_1000249642	229
621	3300006844	Ga0075428_100062368	Ga0075428_1000623682	229
622	3300006846	Ga0075430_100004656	Ga0075430_10000465610	229
623	3300006846	Ga0075430_100343843	Ga0075430_1003438432	229
624	3300006847	Ga0075431_100032156	Ga0075431_1000321563	229
625	3300006847	Ga0075431_100418551	Ga0075431_1004185512	229
626	3300006852	Ga0075433_10004294	Ga0075433_100042942	229
627	3300006871	Ga0075434_100089967	Ga0075434_1000899672	229
628	3300006880	Ga0075429_100007893	Ga0075429_1000078936	229
629	3300006880	Ga0075429_100221048	Ga0075429_1002210482	229
630	3300007076	Ga0075435_100573108	Ga0075435_1005731082	229
631	3300009094	Ga0111539_10001124	Ga0111539_1000112432	229
632	3300009147	Ga0114129_10001807	Ga0114129_1000180720	229
633	3300027907	Ga0207428_10002416	Ga0207428_1000241612	229
634	3300037312	Ga0395899_0048697	Ga0395899_0048697_2418_3107	229
635	3300037418	Ga0395900_0026978	Ga0395900_0026978_695_1384	229
636	3300037471	Ga0395905_0060438	Ga0395905_0060438_1474_2163	229
637	3300038443	Ga0395901_0073777	Ga0395901_0073777_1044_1733	229
638	3300046491	Ga0495584_0085387	Ga0495584_0085387_839_1528	229
639	3300046523	Ga0495644_0015619	Ga0495644_0015619_1377_2066	229
640	3300050507	nmdc:mga05p37_47214_c1	nmdc:mga05p37_47214_c1_485_1174	229
641	3300050508	nmdc:mga09592_23188_c1	nmdc:mga09592_23188_c1_409_1098	229
642	3300050508	nmdc:mga09592_49545_c1	nmdc:mga09592_49545_c1_1402_2091	229
643	3300050509	nmdc:mga0qj67_321228_c1	nmdc:mga0qj67_321228_c1_243_932	229
644	3300050509	nmdc:mga0qj67_33217_c1	nmdc:mga0qj67_33217_c1_59_748	229
645	3300050510	nmdc:mga06r32_479143_c1	nmdc:mga06r32_479143_c1_187_876	229
646	3300050510	nmdc:mga06r32_6458_c1	nmdc:mga06r32_6458_c1_6962_7651	229
647	3300050511	nmdc:mga08y16_6362_c1	nmdc:mga08y16_6362_c1_2028_2717	229
648	3300050512	nmdc:mga0n895_82457_c1	nmdc:mga0n895_82457_c1_472_1161	229
649	3300059424	Ga0590075_067071	Ga0590075_067071_161_850	229
650	3300061734	Ga0530510_0090742	Ga0530510_0090742_184_873	229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

41

216

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6z89-assembly1.cif.gz_C-2	human gtp cyclohydrolase i in complex with allosteric inhibitor	0.9566	89	223
6z85-assembly1.cif.gz_A	inhibitory human gtp cyclohydrolase i - gfrp complex	0.9426	40	223
7ala-assembly1.cif.gz_B-2	human gch-gfrp inhibitory complex	0.936	41	223
6z89-assembly1.cif.gz_C-2	human gtp cyclohydrolase i in complex with allosteric inhibitor	0.9334	89	223
7alc-assembly1.cif.gz_B-2	human gch-gfrp stimulatory complex	0.9287	38	223

ID	Description	Score	Start	End	Superfamily
4uqfA02	Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain	0.9765	104	223	3.30.1130.10
af_Q8I5H7_254_381_3.30.1130.10	Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain	0.9591	89	209	3.30.1130.10
af_A0A1D6DUT0_342_468_3.30.1130.10	Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain	0.9438	105	222	3.30.1130.10
1a8rA02	Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain	0.9429	88	222	3.30.1130.10
1a8rA02	Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain	0.8965	88	222	3.30.1130.10

ID	Description	Score	Start	End	GO Terms
AF-A0A538BY74-F1-model_v4	GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I)	0.9777	116	225	GO:0003934 GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654
AF-A0A0G4MU50-F1-model_v4	GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I)	0.9772	106	223	GO:0003934 GO:0005525 GO:0005737 GO:0006729 GO:0008270 GO:0046654 GO:0046656
AF-X1MIN2-F1-model_v4	GTP cyclohydrolase I (EC 3.5.4.16)	0.9769	91	188	GO:0003934 GO:0005525 GO:0005737 GO:0006729 GO:0008270 GO:0046654
AF-A0A382BGG5-F1-model_v4	GTP cyclohydrolase I (EC 3.5.4.16)	0.9767	119	223	GO:0003934 GO:0005525 GO:0005737 GO:0006729 GO:0008270 GO:0046654
AF-A0A539CVM0-F1-model_v4	GTP cyclohydrolase I (EC 3.5.4.16)	0.9762	106	223	GO:0003934 GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654

Feature Viewer

pLDDT	pTM	Quality
83.04	0.79	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F472560

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

41

216

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map