F472558

General Info

Members Datasets Scaffolds Average Seq Length
650 252 1300 366

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_55844_c1|nmdc:mga08y16_55844_c1_3009_4055
Length 348
Sequence MVEFGGWDMPVEYSGIADEHMAVRTRAGLFDVSHMGEIEIAGADALRAVQHITSNDVSRLATNQIQYSALTTPQGTFVDDVLTYRIAPDHYMLVVNASNIVKDFHWIAEHIKDVGGDAVAVNASSRYALVALQGPAAQGVLQSLTGVDLAGMKYYWFSTGEVAGVRVTISRTGYTGEDGFEVFAPPSAAERVWDAILQAGKSAGVVPAGLGARDTLRLEASMRLYGNDMDETTTVVEADLNWIVGWKKDEFLGHDVLKRQKADGVARKLAGFEMLERAIGRHGYDIYINGAKAGVVTSGTQTPYLKKAIGMAYLPADCTAPGTEFEIDIRGRRARAAVVAMPFYKRPK

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
175 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
176 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.23
Rhizosphere 94.46
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_55844_c1 3300050511 Bacteria 4126
2 SwRhRL2b_contig_1010207 2162886007 Bacteria 1849
3 SwRhRL2b_contig_2799339 2162886007 Bacteria 1821
4 Ga0065704_10086049 3300005289 Bacteria 3159
5 Ga0065712_10000298 3300005290 Bacteria 14350
6 Ga0065712_10068093 3300005290 Bacteria 15009
7 Ga0065712_10091478 3300005290 Bacteria 2370
8 Ga0065715_10009157 3300005293 Bacteria 2873
9 Ga0065715_10123946 3300005293 Bacteria 2165
10 Ga0065715_10142096 3300005293 Bacteria 1838
11 Ga0065715_10204628 3300005293 Bacteria 1343
12 Ga0065707_10097177 3300005295 Bacteria 3191
13 Ga0065707_10100414 3300005295 Bacteria 2931
14 Ga0065707_10104846 3300005295 Bacteria 2675
15 Ga0070676_10137874 3300005328 Bacteria 1550
16 Ga0070683_100000700 3300005329 Bacteria 24378
17 Ga0070683_100159088 3300005329 Bacteria 2143
18 Ga0070690_100059841 3300005330 Bacteria 2450
19 Ga0070690_100194840 3300005330 Bacteria 1407
20 Ga0070670_100003765 3300005331 Bacteria 12627
21 Ga0070670_100004042 3300005331 Bacteria 12247
22 Ga0070670_100004962 3300005331 Bacteria 11192
23 Ga0068869_100040188 3300005334 Bacteria 3344
24 Ga0070666_10044751 3300005335 Bacteria 2967
25 Ga0070680_100095045 3300005336 Bacteria 2470
26 Ga0070660_100051620 3300005339 Bacteria 3168
27 Ga0070689_100027805 3300005340 Bacteria 4267
28 Ga0070689_100147929 3300005340 Bacteria 1893
29 Ga0070691_10005442 3300005341 Bacteria 5794
30 Ga0070661_100034014 3300005344 Bacteria 3696
31 Ga0070692_10035606 3300005345 Bacteria 2521
32 Ga0070669_100001163 3300005353 Bacteria 19202
33 Ga0070669_100002006 3300005353 Bacteria 14731
34 Ga0070669_100110833 3300005353 Bacteria 2082
35 Ga0070675_100002889 3300005354 Bacteria 12950
36 Ga0070675_100006331 3300005354 Bacteria 9086
37 Ga0070675_100021576 3300005354 Bacteria 5147
38 Ga0070675_100031646 3300005354 Bacteria 4279
39 Ga0070675_100038662 3300005354 Bacteria 3890
40 Ga0070675_100201134 3300005354 Bacteria 1729
41 Ga0070671_100020275 3300005355 Bacteria 5420
42 Ga0070671_100096352 3300005355 Bacteria 2481
43 Ga0070671_100140392 3300005355 Bacteria 2039
44 Ga0070674_100049201 3300005356 Bacteria 2897
45 Ga0070674_100056703 3300005356 Bacteria 2717
46 Ga0070673_100072637 3300005364 Bacteria 2767
47 Ga0070673_100231287 3300005364 Bacteria 1604
48 Ga0070659_100185586 3300005366 Bacteria 1708
49 Ga0070667_100333677 3300005367 Bacteria 1370
50 Ga0070713_100012996 3300005436 Bacteria 6130
51 Ga0070701_10018581 3300005438 Bacteria 3270
52 Ga0070705_100000216 3300005440 Bacteria 34255
53 Ga0070705_100002854 3300005440 Bacteria 8604
54 Ga0070700_100024980 3300005441 Bacteria 3515
55 Ga0070700_100032286 3300005441 Bacteria 3145
56 Ga0070700_100104848 3300005441 Bacteria 1869
57 Ga0070694_100001283 3300005444 Bacteria 14586
58 Ga0070694_100001872 3300005444 Bacteria 12455
59 Ga0070694_100005613 3300005444 Bacteria 7604
60 Ga0070694_100050090 3300005444 Bacteria 2814
61 Ga0070694_100154650 3300005444 Bacteria 1678
62 Ga0070694_100276121 3300005444 Bacteria 1280
63 Ga0070662_100005765 3300005457 Bacteria 7938
64 Ga0070662_100080805 3300005457 Bacteria 2421
65 Ga0070662_100089014 3300005457 Bacteria 2315
66 Ga0070681_10396287 3300005458 Bacteria 1292
67 Ga0068867_100012493 3300005459 Bacteria 6010
68 Ga0070685_10013048 3300005466 Bacteria 4375
69 Ga0070706_100271067 3300005467 Bacteria 1584
70 Ga0070706_100306774 3300005467 Bacteria 1481
71 Ga0070706_100327283 3300005467 Bacteria 1429
72 Ga0070707_100017792 3300005468 Bacteria 6681
73 Ga0070707_100139869 3300005468 Bacteria 2356
74 Ga0070698_100000631 3300005471 Bacteria 37971
75 Ga0070698_100001037 3300005471 Bacteria 30575
76 Ga0070698_100028678 3300005471 Bacteria 5779
77 Ga0070698_100050664 3300005471 Bacteria 4232
78 Ga0070698_100221891 3300005471 Bacteria 1824
79 Ga0070699_100000559 3300005518 Bacteria 35129
80 Ga0070699_100002200 3300005518 Bacteria 17638
81 Ga0070699_100003852 3300005518 Bacteria 13261
82 Ga0070699_100007651 3300005518 Bacteria 9392
83 Ga0070699_100019842 3300005518 Bacteria 5794
84 Ga0070699_100041132 3300005518 Bacteria 4001
85 Ga0070684_100000084 3300005535 Bacteria 61595
86 Ga0070684_100101023 3300005535 Bacteria 2577
87 Ga0070697_100029365 3300005536 Bacteria 4407
88 Ga0070697_100123971 3300005536 Bacteria 2163
89 Ga0070672_100084996 3300005543 Bacteria 2542
90 Ga0070672_100095054 3300005543 Bacteria 2410
91 Ga0070686_100002747 3300005544 Bacteria 9690
92 Ga0070695_100001415 3300005545 Bacteria 13302
93 Ga0070695_100006539 3300005545 Bacteria 6886
94 Ga0070695_100104014 3300005545 Bacteria 1916
95 Ga0070695_100140413 3300005545 Bacteria 1675
96 Ga0070695_100144693 3300005545 Bacteria 1652
97 Ga0070696_100001113 3300005546 Bacteria 17390
98 Ga0070696_100055035 3300005546 Bacteria 2775
99 Ga0070696_100114516 3300005546 Bacteria 1945
100 Ga0070665_100002497 3300005548 Bacteria 20241
101 Ga0070665_100003475 3300005548 Bacteria 16783
102 Ga0070665_100222887 3300005548 Bacteria 1886
103 Ga0070704_100001042 3300005549 Bacteria 14315
104 Ga0070704_100008855 3300005549 Bacteria 6058
105 Ga0070704_100024597 3300005549 Bacteria 3953
106 Ga0070704_100160579 3300005549 Bacteria 1777
107 Ga0068855_100029520 3300005563 Bacteria 6553
108 Ga0070664_100000177 3300005564 Bacteria 44970
109 Ga0070664_100001771 3300005564 Bacteria 17311
110 Ga0070664_100022480 3300005564 Bacteria 5200
111 Ga0070664_100067364 3300005564 Bacteria 3060
112 Ga0070664_100094693 3300005564 Bacteria 2590
113 Ga0070664_100196315 3300005564 Bacteria 1799
114 Ga0068857_100003082 3300005577 Bacteria 13783
115 Ga0068857_100030980 3300005577 Bacteria 4727
116 Ga0068857_100050070 3300005577 Bacteria 3706
117 Ga0068854_100023816 3300005578 Bacteria 4185
118 Ga0068856_100081971 3300005614 Bacteria 3201
119 Ga0070702_100013291 3300005615 Bacteria 4153
120 Ga0070702_100014595 3300005615 Bacteria 3988
121 Ga0070702_100125187 3300005615 Bacteria 1615
122 Ga0068859_100005155 3300005617 Bacteria 13269
123 Ga0068859_100027423 3300005617 Bacteria 5712
124 Ga0068859_100036672 3300005617 Bacteria 4922
125 Ga0068859_100176689 3300005617 Bacteria 2217
126 Ga0068864_100004905 3300005618 Bacteria 10962
127 Ga0068864_100007760 3300005618 Bacteria 8842
128 Ga0068864_100027124 3300005618 Bacteria 4834
129 Ga0068864_100152927 3300005618 Bacteria 2092
130 Ga0068864_100242535 3300005618 Bacteria 1670
131 Ga0068866_10028568 3300005718 Bacteria 2659
132 Ga0068861_100001506 3300005719 Bacteria 14785
133 Ga0068863_100007375 3300005841 Bacteria 10764
134 Ga0068863_100027497 3300005841 Bacteria 5426
135 Ga0068863_100037671 3300005841 Bacteria 4602
136 Ga0068858_100004215 3300005842 Bacteria 14158
137 Ga0068858_100007243 3300005842 Bacteria 10750
138 Ga0068860_100002485 3300005843 Bacteria 19341
139 Ga0068862_100000802 3300005844 Bacteria 31167
140 Ga0068862_100002274 3300005844 Bacteria 17192
141 Ga0068862_100086319 3300005844 Bacteria 2728
142 Ga0081538_10030261 3300005981 Bacteria 3679
143 Ga0081539_10000722 3300005985 Bacteria 66164
144 Ga0081539_10003038 3300005985 Bacteria 21740
145 Ga0081539_10077323 3300005985 Bacteria 1760
146 Ga0070712_100084226 3300006175 Bacteria 2311
147 Ga0097621_100005540 3300006237 Bacteria 8896
148 Ga0097621_100038025 3300006237 Bacteria 3861
149 Ga0097621_100065267 3300006237 Bacteria 2995
150 Ga0097621_100098387 3300006237 Bacteria 2458
151 Ga0097621_100114184 3300006237 Bacteria 2285
152 Ga0068871_100000880 3300006358 Bacteria 20009
153 Ga0068871_100006929 3300006358 Bacteria 8075
154 Ga0068871_100022800 3300006358 Bacteria 4833
155 Ga0068871_100079791 3300006358 Bacteria 2709
156 Ga0068871_100084961 3300006358 Bacteria 2627
157 Ga0075428_100035064 3300006844 Bacteria 5531
158 Ga0075428_100037724 3300006844 Bacteria 5318
159 Ga0075428_100041142 3300006844 Bacteria 5083
160 Ga0075428_100218447 3300006844 Bacteria 2059
161 Ga0075428_100382295 3300006844 Bacteria 1509
162 Ga0075428_100406480 3300006844 Bacteria 1459
163 Ga0075428_100455064 3300006844 Bacteria 1371
164 Ga0075430_100004286 3300006846 Bacteria 12044
165 Ga0075430_100058879 3300006846 Bacteria 3229
166 Ga0075430_100077913 3300006846 Bacteria 2778
167 Ga0075430_100181270 3300006846 Bacteria 1752
168 Ga0075431_100042601 3300006847 Bacteria 4683
169 Ga0075431_100059550 3300006847 Bacteria 3941
170 Ga0075431_100079925 3300006847 Bacteria 3376
171 Ga0075431_100141332 3300006847 Bacteria 2481
172 Ga0075431_100189641 3300006847 Bacteria 2107
173 Ga0075431_100224731 3300006847 Bacteria 1914
174 Ga0075433_10024776 3300006852 Bacteria 5068
175 Ga0075433_10067073 3300006852 Bacteria 3149
176 Ga0075433_10083802 3300006852 Bacteria 2814
177 Ga0075433_10096502 3300006852 Bacteria 2616
178 Ga0075434_100001076 3300006871 Bacteria 22339
179 Ga0075434_100002259 3300006871 Bacteria 16854
180 Ga0075434_100003592 3300006871 Bacteria 13860
181 Ga0075434_100007687 3300006871 Bacteria 9979
182 Ga0075434_100019014 3300006871 Bacteria 6640
183 Ga0075434_100112341 3300006871 Bacteria 2736
184 Ga0075434_100143390 3300006871 Bacteria 2409
185 Ga0075434_100155230 3300006871 Bacteria 2308
186 Ga0075434_100169554 3300006871 Bacteria 2203
187 Ga0075429_100033002 3300006880 Bacteria 4499
188 Ga0075429_100048586 3300006880 Bacteria 3690
189 Ga0075429_100262055 3300006880 Bacteria 1513
190 Ga0068865_100004400 3300006881 Bacteria 8488
191 Ga0068865_100161803 3300006881 Bacteria 1708
192 Ga0075436_100016172 3300006914 Bacteria 5107
193 Ga0075436_100123464 3300006914 Bacteria 1813
194 Ga0075436_100179199 3300006914 Bacteria 1497
195 Ga0097620_100005155 3300006931 Bacteria 13269
196 Ga0097620_100027423 3300006931 Bacteria 5712
197 Ga0097620_100036672 3300006931 Bacteria 4922
198 Ga0097620_100176705 3300006931 Bacteria 2217
199 Ga0075435_100000200 3300007076 Bacteria 35997
200 Ga0075435_100001801 3300007076 Bacteria 13935
201 Ga0075435_100025732 3300007076 Bacteria 4583
202 Ga0075435_100029332 3300007076 Bacteria 4317
203 Ga0075435_100067189 3300007076 Bacteria 2919
204 Ga0075435_100293456 3300007076 Bacteria 1390
205 Ga0105240_10466157 3300009093 Bacteria 1410
206 Ga0111539_10001118 3300009094 Bacteria 35458
207 Ga0111539_10001539 3300009094 Bacteria 30721
208 Ga0111539_10004413 3300009094 Bacteria 18387
209 Ga0111539_10023319 3300009094 Bacteria 7603
210 Ga0111539_10029383 3300009094 Bacteria 6695
211 Ga0111539_10032334 3300009094 Bacteria 6354
212 Ga0111539_10055387 3300009094 Bacteria 4713
213 Ga0111539_10082191 3300009094 Bacteria 3789
214 Ga0111539_10088504 3300009094 Bacteria 3638
215 Ga0111539_10227112 3300009094 Bacteria 2174
216 Ga0111539_10320949 3300009094 Bacteria 1802
217 Ga0111539_10396583 3300009094 Bacteria 1607
218 Ga0105245_10003848 3300009098 Bacteria 13353
219 Ga0105245_10054120 3300009098 Bacteria 3604
220 Ga0105247_10008220 3300009101 Bacteria 6365
221 Ga0105247_10031741 3300009101 Bacteria 3207
222 Ga0114129_10001097 3300009147 Bacteria 35568
223 Ga0114129_10002050 3300009147 Bacteria 27658
224 Ga0114129_10005828 3300009147 Bacteria 17453
225 Ga0114129_10007736 3300009147 Bacteria 15292
226 Ga0114129_10018063 3300009147 Bacteria 10046
227 Ga0114129_10020676 3300009147 Bacteria 9357
228 Ga0114129_10044518 3300009147 Bacteria 6244
229 Ga0114129_10071729 3300009147 Bacteria 4829
230 Ga0114129_10123688 3300009147 Bacteria 3558
231 Ga0114129_10132407 3300009147 Bacteria 3423
232 Ga0114129_10247301 3300009147 Bacteria 2395
233 Ga0114129_10595574 3300009147 Bacteria 1433
234 Ga0105243_10093975 3300009148 Bacteria 2476
235 Ga0105241_10049566 3300009174 Bacteria 3198
236 Ga0105242_10005689 3300009176 Bacteria 9619
237 Ga0105242_10031269 3300009176 Bacteria 4250
238 Ga0105242_10073407 3300009176 Bacteria 2844
239 Ga0105242_10103785 3300009176 Bacteria 2412
240 Ga0105248_10001685 3300009177 Bacteria 24592
241 Ga0105248_10005522 3300009177 Bacteria 13886
242 Ga0105248_10014735 3300009177 Bacteria 8609
243 Ga0105248_10020487 3300009177 Bacteria 7328
244 Ga0105248_10244725 3300009177 Bacteria 2019
245 Ga0105237_10171080 3300009545 Bacteria 2172
246 Ga0105249_10010558 3300009553 Bacteria 8117
247 Ga0105249_10022243 3300009553 Bacteria 5679
248 Ga0105249_10298567 3300009553 Unclassified 1615
249 Ga0105249_10319902 3300009553 Bacteria 1562
250 Ga0105249_10411459 3300009553 Bacteria 1384
251 Ga0105246_10115416 3300011119 Bacteria 1980
252 Ga0157378_10245677 3300013297 Bacteria 1711
253 Ga0163162_10146868 3300013306 Bacteria 2475
254 Ga0157375_10248046 3300013308 Bacteria 1941
255 Ga0157375_10314193 3300013308 Bacteria 1731
256 Ga0157375_10410215 3300013308 Bacteria 1521
257 Ga0157375_10445973 3300013308 Bacteria 1460
258 Ga0163163_10000019 3300014325 Bacteria 199037
259 Ga0163163_10004667 3300014325 Bacteria 11718
260 Ga0163163_10020341 3300014325 Bacteria 6249
261 Ga0163163_10145214 3300014325 Bacteria 2416
262 Ga0157380_10011193 3300014326 Bacteria 6475
263 Ga0157380_10077018 3300014326 Bacteria 2716
264 Ga0157380_10092841 3300014326 Bacteria 2495
265 Ga0157380_10288940 3300014326 Bacteria 1504
266 Ga0157377_10016534 3300014745 Bacteria 3797
267 Ga0157379_10088912 3300014968 Bacteria 2770
268 Ga0157376_10019539 3300014969 Bacteria 5225
269 Ga0157376_10074015 3300014969 Bacteria 2903
270 Ga0157376_10165539 3300014969 Bacteria 2009
271 Ga0213876_10024804 3300021384 Bacteria 3166
272 Ga0207697_10011036 3300025315 Bacteria 3832
273 Ga0207697_10051452 3300025315 Bacteria 1702
274 Ga0207653_10018568 3300025885 Bacteria 2189
275 Ga0207653_10060337 3300025885 Bacteria 1278
276 Ga0207682_10019546 3300025893 Bacteria 2652
277 Ga0207642_10023532 3300025899 Bacteria 2462
278 Ga0207642_10095488 3300025899 Bacteria 1480
279 Ga0207680_10085682 3300025903 Bacteria 1991
280 Ga0207680_10117296 3300025903 Bacteria 1736
281 Ga0207680_10122117 3300025903 Bacteria 1705
282 Ga0207680_10210370 3300025903 Bacteria 1329
283 Ga0207643_10003389 3300025908 Bacteria 8591
284 Ga0207684_10060798 3300025910 Bacteria 3209
285 Ga0207657_10011250 3300025919 Bacteria 8892
286 Ga0207649_10024238 3300025920 Bacteria 3525
287 Ga0207646_10017593 3300025922 Bacteria 6679
288 Ga0207646_10283613 3300025922 Bacteria 1497
289 Ga0207646_10297413 3300025922 Bacteria 1458
290 Ga0207681_10001396 3300025923 Bacteria 15605
291 Ga0207681_10025340 3300025923 Bacteria 3814
292 Ga0207681_10050361 3300025923 Bacteria 2818
293 Ga0207650_10025765 3300025925 Bacteria 4190
294 Ga0207650_10028799 3300025925 Bacteria 3986
295 Ga0207650_10047189 3300025925 Bacteria 3174
296 Ga0207650_10071833 3300025925 Bacteria 2604
297 Ga0207659_10010362 3300025926 Bacteria 5856
298 Ga0207659_10034868 3300025926 Bacteria 3474
299 Ga0207659_10044328 3300025926 Bacteria 3129
300 Ga0207659_10054771 3300025926 Bacteria 2849
301 Ga0207659_10081979 3300025926 Bacteria 2387
302 Ga0207659_10155298 3300025926 Bacteria 1791
303 Ga0207659_10329754 3300025926 Bacteria 1261
304 Ga0207687_10040995 3300025927 Bacteria 3177
305 Ga0207687_10176056 3300025927 Bacteria 1654
306 Ga0207644_10044016 3300025931 Bacteria 3170
307 Ga0207644_10224015 3300025931 Bacteria 1492
308 Ga0207690_10121729 3300025932 Bacteria 1897
309 Ga0207706_10013040 3300025933 Bacteria 7563
310 Ga0207706_10034465 3300025933 Bacteria 4503
311 Ga0207706_10096815 3300025933 Bacteria 2595
312 Ga0207706_10156271 3300025933 Bacteria 2005
313 Ga0207706_10197378 3300025933 Bacteria 1765
314 Ga0207706_10225715 3300025933 Bacteria 1639
315 Ga0207686_10014223 3300025934 Bacteria 4426
316 Ga0207686_10023443 3300025934 Bacteria 3565
317 Ga0207686_10039843 3300025934 Bacteria 2852
318 Ga0207709_10210768 3300025935 Bacteria 1394
319 Ga0207670_10007133 3300025936 Bacteria 6227
320 Ga0207670_10009005 3300025936 Bacteria 5666
321 Ga0207669_10117453 3300025937 Bacteria 1798
322 Ga0207704_10016147 3300025938 Bacteria 3829
323 Ga0207704_10094689 3300025938 Bacteria 1973
324 Ga0207691_10034311 3300025940 Bacteria 4719
325 Ga0207691_10084948 3300025940 Bacteria 2841
326 Ga0207691_10146634 3300025940 Bacteria 2077
327 Ga0207691_10347422 3300025940 Bacteria 1269
328 Ga0207711_10002785 3300025941 Bacteria 15377
329 Ga0207711_10033775 3300025941 Bacteria 4331
330 Ga0207711_10143617 3300025941 Bacteria 2149
331 Ga0207711_10175857 3300025941 Bacteria 1945
332 Ga0207689_10302512 3300025942 Bacteria 1326
333 Ga0207661_10003401 3300025944 Bacteria 11045
334 Ga0207679_10002063 3300025945 Bacteria 12458
335 Ga0207679_10042405 3300025945 Bacteria 3270
336 Ga0207679_10046144 3300025945 Bacteria 3157
337 Ga0207679_10085225 3300025945 Bacteria 2427
338 Ga0207679_10153683 3300025945 Bacteria 1876
339 Ga0207667_10336618 3300025949 Bacteria 1540
340 Ga0207651_10046257 3300025960 Bacteria 2925
341 Ga0207651_10092914 3300025960 Bacteria 2214
342 Ga0207651_10130610 3300025960 Bacteria 1922
343 Ga0207651_10162362 3300025960 Bacteria 1753
344 Ga0207651_10185049 3300025960 Bacteria 1656
345 Ga0207712_10059051 3300025961 Bacteria 2713
346 Ga0207712_10117024 3300025961 Bacteria 2009
347 Ga0207668_10123703 3300025972 Bacteria 1963
348 Ga0207640_10078468 3300025981 Bacteria 2248
349 Ga0207658_10295365 3300025986 Bacteria 1394
350 Ga0207677_10041391 3300026023 Bacteria 3046
351 Ga0207703_10013600 3300026035 Bacteria 6343
352 Ga0207703_10044412 3300026035 Bacteria 3571
353 Ga0207703_10261288 3300026035 Bacteria 1565
354 Ga0207678_10087653 3300026067 Bacteria 2660
355 Ga0207708_10009931 3300026075 Bacteria 7066
356 Ga0207708_10039682 3300026075 Bacteria 3588
357 Ga0207708_10051731 3300026075 Bacteria 3128
358 Ga0207708_10065102 3300026075 Bacteria 2786
359 Ga0207702_10073266 3300026078 Bacteria 2952
360 Ga0207641_10016340 3300026088 Bacteria 6077
361 Ga0207641_10028128 3300026088 Bacteria 4643
362 Ga0207648_10000447 3300026089 Bacteria 45676
363 Ga0207648_10052480 3300026089 Bacteria 3565
364 Ga0207648_10218686 3300026089 Bacteria 1693
365 Ga0207676_10017226 3300026095 Bacteria 5236
366 Ga0207676_10047298 3300026095 Bacteria 3333
367 Ga0207676_10153822 3300026095 Bacteria 1984
368 Ga0207676_10174084 3300026095 Bacteria 1878
369 Ga0207674_10016065 3300026116 Bacteria 8200
370 Ga0207674_10048350 3300026116 Bacteria 4354
371 Ga0207675_100004068 3300026118 Bacteria 14155
372 Ga0207675_100040086 3300026118 Bacteria 4371
373 Ga0207675_100073390 3300026118 Bacteria 3202
374 Ga0207675_100116414 3300026118 Bacteria 2526
375 Ga0209971_1014809 3300027682 Bacteria 1848
376 Ga0209974_10016420 3300027876 Bacteria 2459
377 Ga0207428_10000813 3300027907 Bacteria 35311
378 Ga0207428_10012558 3300027907 Bacteria 7436
379 Ga0207428_10028240 3300027907 Bacteria 4663
380 Ga0207428_10050903 3300027907 Bacteria 3311
381 Ga0207428_10204733 3300027907 Bacteria 1484
382 Ga0207428_10218562 3300027907 Bacteria 1429
383 Ga0268266_10001066 3300028379 Bacteria 34388
384 Ga0268266_10064661 3300028379 Bacteria 3161
385 Ga0268265_10000611 3300028380 Bacteria 35660
386 Ga0268265_10002835 3300028380 Bacteria 12747
387 Ga0268265_10050414 3300028380 Bacteria 3136
388 Ga0268265_10193935 3300028380 Bacteria 1756
389 Ga0268264_10014025 3300028381 Bacteria 6588
390 Ga0307408_100005965 3300031548 Bacteria 8113
391 Ga0307408_100225725 3300031548 Bacteria 1531
392 Ga0307408_100314026 3300031548 Bacteria 1318
393 Ga0307405_10015216 3300031731 Bacteria 4160
394 Ga0307413_10006418 3300031824 Bacteria 5367
395 Ga0307413_10115159 3300031824 Bacteria 1809
396 Ga0307410_10005786 3300031852 Bacteria 6592
397 Ga0307410_10101435 3300031852 Bacteria 2063
398 Ga0307410_10172256 3300031852 Bacteria 1632
399 Ga0307407_10000955 3300031903 Bacteria 9839
400 Ga0307407_10059970 3300031903 Bacteria 2218
401 Ga0307412_10038384 3300031911 Bacteria 3084
402 Ga0307412_10068952 3300031911 Bacteria 2406
403 Ga0307412_10134002 3300031911 Bacteria 1804
404 Ga0307409_100009811 3300031995 Bacteria 5905
405 Ga0307409_100131355 3300031995 Bacteria 2141
406 Ga0307416_100014592 3300032002 Bacteria 5393
407 Ga0307416_100016493 3300032002 Bacteria 5137
408 Ga0307411_10004203 3300032005 Bacteria 6845
409 Ga0307415_100027811 3300032126 Bacteria 3588
410 Ga0307415_100043389 3300032126 Bacteria 3000
411 Ga0373938_0000602 3300034957 Bacteria 5809
412 Ga0373928_0000582 3300035084 Bacteria 7177
413 Ga0373929_0000608 3300035085 Bacteria 6923
414 Ga0373934_0121010 3300035086 Bacteria 1065
415 Ga0373940_0000552 3300035088 Bacteria 5913
416 Ga0373944_0037682 3300035089 Bacteria 1482
417 Ga0373949_0005098 3300035090 Bacteria 2952
418 Ga0373951_0037005 3300035091 Bacteria 1166
419 Ga0373932_0004302 3300035112 Bacteria 3377
420 Ga0373941_0035448 3300035115 Bacteria 1511
421 Ga0373960_0000397 3300035121 Bacteria 8500
422 Ga0373942_0001953 3300035207 Bacteria 5156
423 Ga0373961_0007541 3300035241 Bacteria 2634
424 Ga0373931_0015454 3300035691 Bacteria 3745
425 Ga0373935_0278767 3300035692 Bacteria 1177
426 Ga0373937_0024194 3300036401 Bacteria 5475
427 Ga0373937_0173721 3300036401 Bacteria 2022
428 Ga0373937_0291837 3300036401 Bacteria 1541
429 Ga0373925_0138300 3300037068 Bacteria 1905
430 Ga0436365_1175498 3300039437 Bacteria 5954
431 Ga0439453_0010630 3300041408 Bacteria 1521
432 Ga0439433_0008836 3300041999 Bacteria 2191
433 Ga0450898_008683 3300042134 Bacteria 1609
434 Ga0439435_0002587 3300042436 Bacteria 3624
435 Ga0439435_0016200 3300042436 Bacteria 1866
436 Ga0439435_0049086 3300042436 Bacteria 1203
437 Ga0439464_0031826 3300042439 Bacteria 1481
438 Ga0439464_0034308 3300042439 Unclassified 1431
439 Ga0439460_0029477 3300042461 Bacteria 1554
440 Ga0439460_0039049 3300042461 Bacteria 1386
441 Ga0451576_0018698 3300045051 Bacteria 7582
442 Ga0451576_0019058 3300045051 Bacteria 7498
443 Ga0451576_0026335 3300045051 Bacteria 6256
444 Ga0451576_0057941 3300045051 Bacteria 4049
445 Ga0451576_0123239 3300045051 Bacteria 2699
446 Ga0451576_0143793 3300045051 Bacteria 2487
447 Ga0466967_0065754 3300045976 Bacteria 3229
448 Ga0495603_0048996 3300046455 Bacteria 2515
449 Ga0495629_0096706 3300046459 Bacteria 2060
450 Ga0495629_0276553 3300046459 Bacteria 1153
451 Ga0495638_0003000 3300046460 Bacteria 13481
452 Ga0495582_0166928 3300046473 Bacteria 1253
453 Ga0495639_0112952 3300046475 Bacteria 1291
454 Ga0495664_0052556 3300046477 Bacteria 2422
455 Ga0495594_0010537 3300046499 Bacteria 4795
456 Ga0495594_0011218 3300046499 Bacteria 4654
457 Ga0495628_0184325 3300046516 Bacteria 1578
458 Ga0495621_0001653 3300046539 Bacteria 5838
459 Ga0495621_0007297 3300046539 Bacteria 3269
460 Ga0495645_0010938 3300046543 Bacteria 6374
461 Ga0495667_0121796 3300046559 Bacteria 1684
462 Ga0495659_0002452 3300046664 Bacteria 5986
463 Ga0495659_0078489 3300046664 Bacteria 1249
464 Ga0495659_0086868 3300046664 Bacteria 1195
465 Ga0495658_0028022 3300046683 Bacteria 3037
466 Ga0495669_0009703 3300046684 Bacteria 4063
467 Ga0495669_0062334 3300046684 Bacteria 1690
468 Ga0495600_0138572 3300046809 Bacteria 1579
469 Ga0495604_0184714 3300047317 Bacteria 1457
470 Ga0495676_0059520 3300047321 Bacteria 2999
471 Ga0495684_0236415 3300047471 Bacteria 1334
472 Ga0496101_0434116 3300048904 Bacteria 1036
473 Ga0496102_0039316 3300048905 Bacteria 4274
474 Ga0496102_0080846 3300048905 Bacteria 2995
475 Ga0496102_0168901 3300048905 Bacteria 2059
476 Ga0496102_0312077 3300048905 Bacteria 1482
477 Ga0496104_0001005 3300048907 Bacteria 24151
478 Ga0496104_0044417 3300048907 Bacteria 4175
479 Ga0496104_0155529 3300048907 Bacteria 2194
480 Ga0496104_0295606 3300048907 Bacteria 1532
481 Ga0496105_0279848 3300048908 Bacteria 1345
482 Ga0496106_0353874 3300048909 Bacteria 1180
483 Ga0496108_0000350 3300048911 Bacteria 38965
484 Ga0496108_0004939 3300048911 Bacteria 10774
485 Ga0496108_0058000 3300048911 Bacteria 3253
486 Ga0496109_0000257 3300048912 Bacteria 51399
487 Ga0496109_0055619 3300048912 Bacteria 3610
488 Ga0496109_0160098 3300048912 Bacteria 2109
489 Ga0496110_0000390 3300048913 Bacteria 29574
490 Ga0496110_0025503 3300048913 Bacteria 5053
491 Ga0496110_0175410 3300048913 Bacteria 1945
492 Ga0496111_0002799 3300048914 Bacteria 10626
493 Ga0496111_0249454 3300048914 Bacteria 1318
494 Ga0496112_0000175 3300048915 Bacteria 40859
495 Ga0496112_0002169 3300048915 Bacteria 15596
496 Ga0496112_0010486 3300048915 Bacteria 8406
497 Ga0496112_0052441 3300048915 Bacteria 4003
498 Ga0496112_0155236 3300048915 Bacteria 2256
499 Ga0496112_0189510 3300048915 Bacteria 2019
500 Ga0496112_0235014 3300048915 Bacteria 1787
501 Ga0496113_0027825 3300048916 Bacteria 4058
502 Ga0496113_0028809 3300048916 Bacteria 3999
503 Ga0496113_0064581 3300048916 Bacteria 2768
504 Ga0496113_0228637 3300048916 Bacteria 1483
505 Ga0496114_0053546 3300048917 Bacteria 3364
506 Ga0501299_004784 3300049522 Bacteria 2047
507 Ga0501034_0119032 3300049571 Bacteria 2628
508 Ga0501036_0041816 3300049572 Bacteria 3878
509 Ga0501036_0248812 3300049572 Bacteria 1490
510 Ga0501037_0196460 3300049573 Bacteria 1427
511 Ga0501039_0028898 3300049575 Bacteria 4269
512 Ga0501040_0062335 3300049576 Bacteria 2565
513 Ga0501040_0108956 3300049576 Bacteria 1936
514 Ga0501041_0029765 3300049577 Bacteria 3295
515 Ga0501041_0292723 3300049577 Bacteria 1025
516 Ga0501042_0021983 3300049578 Bacteria 4453
517 Ga0501042_0170709 3300049578 Bacteria 1569
518 Ga0501046_0248427 3300049580 Bacteria 1310
519 Ga0501048_0049457 3300049582 Bacteria 2996
520 Ga0501048_0054089 3300049582 Bacteria 2852
521 Ga0501048_0374768 3300049582 Unclassified 1016
522 Ga0501071_0002469 3300049587 Bacteria 11234
523 Ga0501071_0022105 3300049587 Bacteria 4432
524 Ga0501071_0025483 3300049587 Bacteria 4144
525 Ga0501071_0113821 3300049587 Bacteria 2001
526 Ga0501072_0017747 3300049588 Bacteria 5473
527 Ga0501072_0032594 3300049588 Bacteria 4081
528 Ga0501072_0041834 3300049588 Bacteria 3599
529 Ga0501073_0056850 3300049589 Bacteria 2736
530 Ga0501074_0075567 3300049590 Bacteria 2418
531 Ga0501074_0091701 3300049590 Bacteria 2176
532 Ga0501075_0006576 3300049591 Bacteria 8005
533 Ga0501075_0011966 3300049591 Bacteria 6157
534 Ga0501075_0022560 3300049591 Bacteria 4599
535 Ga0501075_0041901 3300049591 Bacteria 3432
536 Ga0501075_0055029 3300049591 Bacteria 2993
537 Ga0501075_0201481 3300049591 Bacteria 1518
538 Ga0501076_0011533 3300049592 Bacteria 6589
539 Ga0501076_0040955 3300049592 Bacteria 3642
540 Ga0501076_0068790 3300049592 Bacteria 2829
541 Ga0501076_0073882 3300049592 Bacteria 2730
542 Ga0501076_0120598 3300049592 Bacteria 2124
543 Ga0501077_0178266 3300049593 Bacteria 1350
544 Ga0501077_0200579 3300049593 Bacteria 1267
545 Ga0501079_0026002 3300049741 Bacteria 4489
546 Ga0501079_0034485 3300049741 Bacteria 3894
547 Ga0501079_0077456 3300049741 Bacteria 2572
548 Ga0501080_0086389 3300049742 Bacteria 2915
549 Ga0501080_0117077 3300049742 Bacteria 2470
550 Ga0501080_0211293 3300049742 Bacteria 1778
551 Ga0501080_0472194 3300049742 Bacteria 1123
552 Ga0501081_0024366 3300049743 Bacteria 4063
553 Ga0501081_0031778 3300049743 Bacteria 3578
554 Ga0501081_0094289 3300049743 Bacteria 2109
555 Ga0501083_0182858 3300049744 Bacteria 1369
556 Ga0501271_002961 3300049768 Bacteria 1545
557 Ga0501045_0017480 3300049824 Bacteria 5092
558 Ga0501045_0033456 3300049824 Bacteria 3728
559 Ga0501045_0048017 3300049824 Bacteria 3111
560 Ga0501045_0069772 3300049824 Bacteria 2584
561 Ga0501045_0167045 3300049824 Bacteria 1639
562 Ga0501045_0224194 3300049824 Bacteria 1399
563 nmdc:mga05p37_109355_c1 3300050507 Bacteria 3401
564 nmdc:mga05p37_120029_c1 3300050507 Bacteria 3230
565 nmdc:mga05p37_13020_c1 3300050507 Bacteria 9953
566 nmdc:mga05p37_147531_c1 3300050507 Bacteria 2879
567 nmdc:mga05p37_19862_c1 3300050507 Bacteria 8129
568 nmdc:mga05p37_200010_c1 3300050507 Bacteria 2421
569 nmdc:mga05p37_273829_c1 3300050507 Bacteria 2016
570 nmdc:mga05p37_307547_c1 3300050507 Bacteria 1880
571 nmdc:mga05p37_3312_c1 3300050507 Bacteria 18799
572 nmdc:mga05p37_34193_c1 3300050507 Bacteria 6225
573 nmdc:mga05p37_3905_c1 3300050507 Bacteria 17445
574 nmdc:mga05p37_55664_c1 3300050507 Bacteria 4868
575 nmdc:mga05p37_60808_c1 3300050507 Bacteria 4651
576 nmdc:mga05p37_731_c1 3300050507 Bacteria 27405
577 nmdc:mga05p37_95958_c1 3300050507 Bacteria 3653
578 nmdc:mga09592_160406_c1 3300050508 Bacteria 1943
579 nmdc:mga09592_206976_c1 3300050508 Bacteria 1699
580 nmdc:mga09592_270889_c1 3300050508 Bacteria 1473
581 nmdc:mga0qj67_11094_c1 3300050509 Bacteria 6747
582 nmdc:mga0qj67_25010_c1 3300050509 Bacteria 4608
583 nmdc:mga0qj67_52659_c1 3300050509 Bacteria 3222
584 nmdc:mga06r32_133506_c1 3300050510 Bacteria 2456
585 nmdc:mga06r32_172637_c1 3300050510 Bacteria 2146
586 nmdc:mga06r32_198109_c1 3300050510 Bacteria 1996
587 nmdc:mga06r32_31729_c1 3300050510 Bacteria 4965
588 nmdc:mga06r32_59135_c1 3300050510 Bacteria 3685
589 nmdc:mga06r32_6002_c1 3300050510 Bacteria 5420
590 nmdc:mga06r32_72040_c1 3300050510 Bacteria 3345
591 nmdc:mga08y16_11196_c1 3300050511 Bacteria 9423
592 nmdc:mga08y16_119903_c1 3300050511 Bacteria 2738
593 nmdc:mga08y16_1262_c1 3300050511 Bacteria 25130
594 nmdc:mga08y16_153172_c1 3300050511 Bacteria 2396
595 nmdc:mga08y16_171260_c1 3300050511 Bacteria 2255
596 nmdc:mga08y16_18622_c1 3300050511 Bacteria 7314
597 nmdc:mga08y16_23346_c1 3300050511 Bacteria 6533
598 nmdc:mga08y16_314119_c1 3300050511 Bacteria 1614
599 nmdc:mga08y16_326881_c1 3300050511 Unclassified 1578
600 nmdc:mga08y16_40785_c1 3300050511 Bacteria 4864
601 nmdc:mga08y16_9368_c1 3300050511 Bacteria 10270
602 nmdc:mga0n895_106068_c1 3300050512 Bacteria 2822
603 nmdc:mga0n895_11152_c1 3300050512 Bacteria 8000
604 nmdc:mga0n895_167886_c1 3300050512 Bacteria 2226
605 nmdc:mga0n895_18431_c1 3300050512 Bacteria 6460
606 nmdc:mga0n895_188926_c1 3300050512 Bacteria 2091
607 nmdc:mga0n895_335_c1 3300050512 Bacteria 31397
608 nmdc:mga0n895_38692_c1 3300050512 Bacteria 4623
609 nmdc:mga0n895_80296_c1 3300050512 Bacteria 3250
610 nmdc:mga0n895_83_c1 3300050512 Bacteria 54380
611 nmdc:mga0n895_8763_c1 3300050512 Bacteria 8795
612 nmdc:mga0rr50_14496_c1 3300050513 Bacteria 5175
613 nmdc:mga0rr50_24662_c1 3300050513 Bacteria 4170
614 nmdc:mga0rr50_262583_c1 3300050513 Bacteria 1437
615 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
616 nmdc:mga0rr50_49175_c1 3300050513 Bacteria 3121
617 nmdc:mga0rr50_614_c1 3300050513 Bacteria 19086
618 nmdc:mga08x19_10221_c1 3300050514 Bacteria 5630
619 nmdc:mga08x19_153017_c1 3300050514 Bacteria 1563
620 nmdc:mga08x19_3410_c1 3300050514 Bacteria 9479
621 nmdc:mga08x19_36273_c1 3300050514 Bacteria 3123
622 nmdc:mga08x19_52156_c1 3300050514 Bacteria 2630
623 nmdc:mga0a205_105911_c1 3300050515 Bacteria 2711
624 nmdc:mga0a205_11783_c1 3300050515 Bacteria 8069
625 nmdc:mga0a205_130550_c1 3300050515 Bacteria 2413
626 nmdc:mga0a205_135224_c1 3300050515 Bacteria 2366
627 nmdc:mga0a205_18988_c1 3300050515 Bacteria 6476
628 nmdc:mga0a205_2832_c2 3300050515 Bacteria 13358
629 nmdc:mga0a205_51370_c1 3300050515 Bacteria 3979
630 nmdc:mga0a205_54169_c1 3300050515 Bacteria 3873
631 nmdc:mga0a205_54267_c2 3300050515 Bacteria 2464
632 nmdc:mga0a205_79923_c1 3300050515 Bacteria 3160
633 nmdc:mga0a205_87839_c1 3300050515 Bacteria 3004
634 Ga0495601_0133698 3300053077 Bacteria 1616
635 Ga0495655_0029744 3300053083 Bacteria 1315
636 Ga0495619_0005625 3300053085 Bacteria 7953
637 Ga0501084_0176103 3300054114 Bacteria 1806
638 Ga0501084_0229432 3300054114 Bacteria 1567
639 Ga0501084_0291127 3300054114 Bacteria 1379
640 Ga0590071_000723 3300059421 Bacteria 9316
641 Ga0590071_004017 3300059421 Bacteria 3591
642 Ga0590074_000042 3300059423 Bacteria 12110
643 Ga0590074_000730 3300059423 Bacteria 5003
644 Ga0590075_000135 3300059424 Bacteria 19348
645 Ga0590075_000600 3300059424 Bacteria 9685
646 Ga0590075_006232 3300059424 Bacteria 2829
647 Ga0590077_000746 3300059426 Bacteria 8537
648 Ga0590077_000999 3300059426 Bacteria 7159
649 Ga0501082_0073125 3300060353 Bacteria 2953
650 Ga0530510_0008471 3300061734 Bacteria 7171
651 nmdc:mga08y16_55844_c1
652 SwRhRL2b_contig_1010207
653 SwRhRL2b_contig_2799339
654 Ga0065704_10086049
655 Ga0065712_10000298
656 Ga0065712_10068093
657 Ga0065712_10091478
658 Ga0065715_10009157
659 Ga0065715_10123946
660 Ga0065715_10142096
661 Ga0065715_10204628
662 Ga0065707_10097177
663 Ga0065707_10100414
664 Ga0065707_10104846
665 Ga0070676_10137874
666 Ga0070683_100000700
667 Ga0070683_100159088
668 Ga0070690_100059841
669 Ga0070690_100194840
670 Ga0070670_100003765
671 Ga0070670_100004042
672 Ga0070670_100004962
673 Ga0068869_100040188
674 Ga0070666_10044751
675 Ga0070680_100095045
676 Ga0070660_100051620
677 Ga0070689_100027805
678 Ga0070689_100147929
679 Ga0070691_10005442
680 Ga0070661_100034014
681 Ga0070692_10035606
682 Ga0070669_100001163
683 Ga0070669_100002006
684 Ga0070669_100110833
685 Ga0070675_100002889
686 Ga0070675_100006331
687 Ga0070675_100021576
688 Ga0070675_100031646
689 Ga0070675_100038662
690 Ga0070675_100201134
691 Ga0070671_100020275
692 Ga0070671_100096352
693 Ga0070671_100140392
694 Ga0070674_100049201
695 Ga0070674_100056703
696 Ga0070673_100072637
697 Ga0070673_100231287
698 Ga0070659_100185586
699 Ga0070667_100333677
700 Ga0070713_100012996
701 Ga0070701_10018581
702 Ga0070705_100000216
703 Ga0070705_100002854
704 Ga0070700_100024980
705 Ga0070700_100032286
706 Ga0070700_100104848
707 Ga0070694_100001283
708 Ga0070694_100001872
709 Ga0070694_100005613
710 Ga0070694_100050090
711 Ga0070694_100154650
712 Ga0070694_100276121
713 Ga0070662_100005765
714 Ga0070662_100080805
715 Ga0070662_100089014
716 Ga0070681_10396287
717 Ga0068867_100012493
718 Ga0070685_10013048
719 Ga0070706_100271067
720 Ga0070706_100306774
721 Ga0070706_100327283
722 Ga0070707_100017792
723 Ga0070707_100139869
724 Ga0070698_100000631
725 Ga0070698_100001037
726 Ga0070698_100028678
727 Ga0070698_100050664
728 Ga0070698_100221891
729 Ga0070699_100000559
730 Ga0070699_100002200
731 Ga0070699_100003852
732 Ga0070699_100007651
733 Ga0070699_100019842
734 Ga0070699_100041132
735 Ga0070684_100000084
736 Ga0070684_100101023
737 Ga0070697_100029365
738 Ga0070697_100123971
739 Ga0070672_100084996
740 Ga0070672_100095054
741 Ga0070686_100002747
742 Ga0070695_100001415
743 Ga0070695_100006539
744 Ga0070695_100104014
745 Ga0070695_100140413
746 Ga0070695_100144693
747 Ga0070696_100001113
748 Ga0070696_100055035
749 Ga0070696_100114516
750 Ga0070665_100002497
751 Ga0070665_100003475
752 Ga0070665_100222887
753 Ga0070704_100001042
754 Ga0070704_100008855
755 Ga0070704_100024597
756 Ga0070704_100160579
757 Ga0068855_100029520
758 Ga0070664_100000177
759 Ga0070664_100001771
760 Ga0070664_100022480
761 Ga0070664_100067364
762 Ga0070664_100094693
763 Ga0070664_100196315
764 Ga0068857_100003082
765 Ga0068857_100030980
766 Ga0068857_100050070
767 Ga0068854_100023816
768 Ga0068856_100081971
769 Ga0070702_100013291
770 Ga0070702_100014595
771 Ga0070702_100125187
772 Ga0068859_100005155
773 Ga0068859_100027423
774 Ga0068859_100036672
775 Ga0068859_100176689
776 Ga0068864_100004905
777 Ga0068864_100007760
778 Ga0068864_100027124
779 Ga0068864_100152927
780 Ga0068864_100242535
781 Ga0068866_10028568
782 Ga0068861_100001506
783 Ga0068863_100007375
784 Ga0068863_100027497
785 Ga0068863_100037671
786 Ga0068858_100004215
787 Ga0068858_100007243
788 Ga0068860_100002485
789 Ga0068862_100000802
790 Ga0068862_100002274
791 Ga0068862_100086319
792 Ga0081538_10030261
793 Ga0081539_10000722
794 Ga0081539_10003038
795 Ga0081539_10077323
796 Ga0070712_100084226
797 Ga0097621_100005540
798 Ga0097621_100038025
799 Ga0097621_100065267
800 Ga0097621_100098387
801 Ga0097621_100114184
802 Ga0068871_100000880
803 Ga0068871_100006929
804 Ga0068871_100022800
805 Ga0068871_100079791
806 Ga0068871_100084961
807 Ga0075428_100035064
808 Ga0075428_100037724
809 Ga0075428_100041142
810 Ga0075428_100218447
811 Ga0075428_100382295
812 Ga0075428_100406480
813 Ga0075428_100455064
814 Ga0075430_100004286
815 Ga0075430_100058879
816 Ga0075430_100077913
817 Ga0075430_100181270
818 Ga0075431_100042601
819 Ga0075431_100059550
820 Ga0075431_100079925
821 Ga0075431_100141332
822 Ga0075431_100189641
823 Ga0075431_100224731
824 Ga0075433_10024776
825 Ga0075433_10067073
826 Ga0075433_10083802
827 Ga0075433_10096502
828 Ga0075434_100001076
829 Ga0075434_100002259
830 Ga0075434_100003592
831 Ga0075434_100007687
832 Ga0075434_100019014
833 Ga0075434_100112341
834 Ga0075434_100143390
835 Ga0075434_100155230
836 Ga0075434_100169554
837 Ga0075429_100033002
838 Ga0075429_100048586
839 Ga0075429_100262055
840 Ga0068865_100004400
841 Ga0068865_100161803
842 Ga0075436_100016172
843 Ga0075436_100123464
844 Ga0075436_100179199
845 Ga0097620_100005155
846 Ga0097620_100027423
847 Ga0097620_100036672
848 Ga0097620_100176705
849 Ga0075435_100000200
850 Ga0075435_100001801
851 Ga0075435_100025732
852 Ga0075435_100029332
853 Ga0075435_100067189
854 Ga0075435_100293456
855 Ga0105240_10466157
856 Ga0111539_10001118
857 Ga0111539_10001539
858 Ga0111539_10004413
859 Ga0111539_10023319
860 Ga0111539_10029383
861 Ga0111539_10032334
862 Ga0111539_10055387
863 Ga0111539_10082191
864 Ga0111539_10088504
865 Ga0111539_10227112
866 Ga0111539_10320949
867 Ga0111539_10396583
868 Ga0105245_10003848
869 Ga0105245_10054120
870 Ga0105247_10008220
871 Ga0105247_10031741
872 Ga0114129_10001097
873 Ga0114129_10002050
874 Ga0114129_10005828
875 Ga0114129_10007736
876 Ga0114129_10018063
877 Ga0114129_10020676
878 Ga0114129_10044518
879 Ga0114129_10071729
880 Ga0114129_10123688
881 Ga0114129_10132407
882 Ga0114129_10247301
883 Ga0114129_10595574
884 Ga0105243_10093975
885 Ga0105241_10049566
886 Ga0105242_10005689
887 Ga0105242_10031269
888 Ga0105242_10073407
889 Ga0105242_10103785
890 Ga0105248_10001685
891 Ga0105248_10005522
892 Ga0105248_10014735
893 Ga0105248_10020487
894 Ga0105248_10244725
895 Ga0105237_10171080
896 Ga0105249_10010558
897 Ga0105249_10022243
898 Ga0105249_10298567
899 Ga0105249_10319902
900 Ga0105249_10411459
901 Ga0105246_10115416
902 Ga0157378_10245677
903 Ga0163162_10146868
904 Ga0157375_10248046
905 Ga0157375_10314193
906 Ga0157375_10410215
907 Ga0157375_10445973
908 Ga0163163_10000019
909 Ga0163163_10004667
910 Ga0163163_10020341
911 Ga0163163_10145214
912 Ga0157380_10011193
913 Ga0157380_10077018
914 Ga0157380_10092841
915 Ga0157380_10288940
916 Ga0157377_10016534
917 Ga0157379_10088912
918 Ga0157376_10019539
919 Ga0157376_10074015
920 Ga0157376_10165539
921 Ga0213876_10024804
922 Ga0207697_10011036
923 Ga0207697_10051452
924 Ga0207653_10018568
925 Ga0207653_10060337
926 Ga0207682_10019546
927 Ga0207642_10023532
928 Ga0207642_10095488
929 Ga0207680_10085682
930 Ga0207680_10117296
931 Ga0207680_10122117
932 Ga0207680_10210370
933 Ga0207643_10003389
934 Ga0207684_10060798
935 Ga0207657_10011250
936 Ga0207649_10024238
937 Ga0207646_10017593
938 Ga0207646_10283613
939 Ga0207646_10297413
940 Ga0207681_10001396
941 Ga0207681_10025340
942 Ga0207681_10050361
943 Ga0207650_10025765
944 Ga0207650_10028799
945 Ga0207650_10047189
946 Ga0207650_10071833
947 Ga0207659_10010362
948 Ga0207659_10034868
949 Ga0207659_10044328
950 Ga0207659_10054771
951 Ga0207659_10081979
952 Ga0207659_10155298
953 Ga0207659_10329754
954 Ga0207687_10040995
955 Ga0207687_10176056
956 Ga0207644_10044016
957 Ga0207644_10224015
958 Ga0207690_10121729
959 Ga0207706_10013040
960 Ga0207706_10034465
961 Ga0207706_10096815
962 Ga0207706_10156271
963 Ga0207706_10197378
964 Ga0207706_10225715
965 Ga0207686_10014223
966 Ga0207686_10023443
967 Ga0207686_10039843
968 Ga0207709_10210768
969 Ga0207670_10007133
970 Ga0207670_10009005
971 Ga0207669_10117453
972 Ga0207704_10016147
973 Ga0207704_10094689
974 Ga0207691_10034311
975 Ga0207691_10084948
976 Ga0207691_10146634
977 Ga0207691_10347422
978 Ga0207711_10002785
979 Ga0207711_10033775
980 Ga0207711_10143617
981 Ga0207711_10175857
982 Ga0207689_10302512
983 Ga0207661_10003401
984 Ga0207679_10002063
985 Ga0207679_10042405
986 Ga0207679_10046144
987 Ga0207679_10085225
988 Ga0207679_10153683
989 Ga0207667_10336618
990 Ga0207651_10046257
991 Ga0207651_10092914
992 Ga0207651_10130610
993 Ga0207651_10162362
994 Ga0207651_10185049
995 Ga0207712_10059051
996 Ga0207712_10117024
997 Ga0207668_10123703
998 Ga0207640_10078468
999 Ga0207658_10295365
1000 Ga0207677_10041391
1001 Ga0207703_10013600
1002 Ga0207703_10044412
1003 Ga0207703_10261288
1004 Ga0207678_10087653
1005 Ga0207708_10009931
1006 Ga0207708_10039682
1007 Ga0207708_10051731
1008 Ga0207708_10065102
1009 Ga0207702_10073266
1010 Ga0207641_10016340
1011 Ga0207641_10028128
1012 Ga0207648_10000447
1013 Ga0207648_10052480
1014 Ga0207648_10218686
1015 Ga0207676_10017226
1016 Ga0207676_10047298
1017 Ga0207676_10153822
1018 Ga0207676_10174084
1019 Ga0207674_10016065
1020 Ga0207674_10048350
1021 Ga0207675_100004068
1022 Ga0207675_100040086
1023 Ga0207675_100073390
1024 Ga0207675_100116414
1025 Ga0209971_1014809
1026 Ga0209974_10016420
1027 Ga0207428_10000813
1028 Ga0207428_10012558
1029 Ga0207428_10028240
1030 Ga0207428_10050903
1031 Ga0207428_10204733
1032 Ga0207428_10218562
1033 Ga0268266_10001066
1034 Ga0268266_10064661
1035 Ga0268265_10000611
1036 Ga0268265_10002835
1037 Ga0268265_10050414
1038 Ga0268265_10193935
1039 Ga0268264_10014025
1040 Ga0307408_100005965
1041 Ga0307408_100225725
1042 Ga0307408_100314026
1043 Ga0307405_10015216
1044 Ga0307413_10006418
1045 Ga0307413_10115159
1046 Ga0307410_10005786
1047 Ga0307410_10101435
1048 Ga0307410_10172256
1049 Ga0307407_10000955
1050 Ga0307407_10059970
1051 Ga0307412_10038384
1052 Ga0307412_10068952
1053 Ga0307412_10134002
1054 Ga0307409_100009811
1055 Ga0307409_100131355
1056 Ga0307416_100014592
1057 Ga0307416_100016493
1058 Ga0307411_10004203
1059 Ga0307415_100027811
1060 Ga0307415_100043389
1061 Ga0373938_0000602
1062 Ga0373928_0000582
1063 Ga0373929_0000608
1064 Ga0373934_0121010
1065 Ga0373940_0000552
1066 Ga0373944_0037682
1067 Ga0373949_0005098
1068 Ga0373951_0037005
1069 Ga0373932_0004302
1070 Ga0373941_0035448
1071 Ga0373960_0000397
1072 Ga0373942_0001953
1073 Ga0373961_0007541
1074 Ga0373931_0015454
1075 Ga0373935_0278767
1076 Ga0373937_0024194
1077 Ga0373937_0173721
1078 Ga0373937_0291837
1079 Ga0373925_0138300
1080 Ga0436365_1175498
1081 Ga0439453_0010630
1082 Ga0439433_0008836
1083 Ga0450898_008683
1084 Ga0439435_0002587
1085 Ga0439435_0016200
1086 Ga0439435_0049086
1087 Ga0439464_0031826
1088 Ga0439464_0034308
1089 Ga0439460_0029477
1090 Ga0439460_0039049
1091 Ga0451576_0018698
1092 Ga0451576_0019058
1093 Ga0451576_0026335
1094 Ga0451576_0057941
1095 Ga0451576_0123239
1096 Ga0451576_0143793
1097 Ga0466967_0065754
1098 Ga0495603_0048996
1099 Ga0495629_0096706
1100 Ga0495629_0276553
1101 Ga0495638_0003000
1102 Ga0495582_0166928
1103 Ga0495639_0112952
1104 Ga0495664_0052556
1105 Ga0495594_0010537
1106 Ga0495594_0011218
1107 Ga0495628_0184325
1108 Ga0495621_0001653
1109 Ga0495621_0007297
1110 Ga0495645_0010938
1111 Ga0495667_0121796
1112 Ga0495659_0002452
1113 Ga0495659_0078489
1114 Ga0495659_0086868
1115 Ga0495658_0028022
1116 Ga0495669_0009703
1117 Ga0495669_0062334
1118 Ga0495600_0138572
1119 Ga0495604_0184714
1120 Ga0495676_0059520
1121 Ga0495684_0236415
1122 Ga0496101_0434116
1123 Ga0496102_0039316
1124 Ga0496102_0080846
1125 Ga0496102_0168901
1126 Ga0496102_0312077
1127 Ga0496104_0001005
1128 Ga0496104_0044417
1129 Ga0496104_0155529
1130 Ga0496104_0295606
1131 Ga0496105_0279848
1132 Ga0496106_0353874
1133 Ga0496108_0000350
1134 Ga0496108_0004939
1135 Ga0496108_0058000
1136 Ga0496109_0000257
1137 Ga0496109_0055619
1138 Ga0496109_0160098
1139 Ga0496110_0000390
1140 Ga0496110_0025503
1141 Ga0496110_0175410
1142 Ga0496111_0002799
1143 Ga0496111_0249454
1144 Ga0496112_0000175
1145 Ga0496112_0002169
1146 Ga0496112_0010486
1147 Ga0496112_0052441
1148 Ga0496112_0155236
1149 Ga0496112_0189510
1150 Ga0496112_0235014
1151 Ga0496113_0027825
1152 Ga0496113_0028809
1153 Ga0496113_0064581
1154 Ga0496113_0228637
1155 Ga0496114_0053546
1156 Ga0501299_004784
1157 Ga0501034_0119032
1158 Ga0501036_0041816
1159 Ga0501036_0248812
1160 Ga0501037_0196460
1161 Ga0501039_0028898
1162 Ga0501040_0062335
1163 Ga0501040_0108956
1164 Ga0501041_0029765
1165 Ga0501041_0292723
1166 Ga0501042_0021983
1167 Ga0501042_0170709
1168 Ga0501046_0248427
1169 Ga0501048_0049457
1170 Ga0501048_0054089
1171 Ga0501048_0374768
1172 Ga0501071_0002469
1173 Ga0501071_0022105
1174 Ga0501071_0025483
1175 Ga0501071_0113821
1176 Ga0501072_0017747
1177 Ga0501072_0032594
1178 Ga0501072_0041834
1179 Ga0501073_0056850
1180 Ga0501074_0075567
1181 Ga0501074_0091701
1182 Ga0501075_0006576
1183 Ga0501075_0011966
1184 Ga0501075_0022560
1185 Ga0501075_0041901
1186 Ga0501075_0055029
1187 Ga0501075_0201481
1188 Ga0501076_0011533
1189 Ga0501076_0040955
1190 Ga0501076_0068790
1191 Ga0501076_0073882
1192 Ga0501076_0120598
1193 Ga0501077_0178266
1194 Ga0501077_0200579
1195 Ga0501079_0026002
1196 Ga0501079_0034485
1197 Ga0501079_0077456
1198 Ga0501080_0086389
1199 Ga0501080_0117077
1200 Ga0501080_0211293
1201 Ga0501080_0472194
1202 Ga0501081_0024366
1203 Ga0501081_0031778
1204 Ga0501081_0094289
1205 Ga0501083_0182858
1206 Ga0501271_002961
1207 Ga0501045_0017480
1208 Ga0501045_0033456
1209 Ga0501045_0048017
1210 Ga0501045_0069772
1211 Ga0501045_0167045
1212 Ga0501045_0224194
1213 nmdc:mga05p37_109355_c1
1214 nmdc:mga05p37_120029_c1
1215 nmdc:mga05p37_13020_c1
1216 nmdc:mga05p37_147531_c1
1217 nmdc:mga05p37_19862_c1
1218 nmdc:mga05p37_200010_c1
1219 nmdc:mga05p37_273829_c1
1220 nmdc:mga05p37_307547_c1
1221 nmdc:mga05p37_3312_c1
1222 nmdc:mga05p37_34193_c1
1223 nmdc:mga05p37_3905_c1
1224 nmdc:mga05p37_55664_c1
1225 nmdc:mga05p37_60808_c1
1226 nmdc:mga05p37_731_c1
1227 nmdc:mga05p37_95958_c1
1228 nmdc:mga09592_160406_c1
1229 nmdc:mga09592_206976_c1
1230 nmdc:mga09592_270889_c1
1231 nmdc:mga0qj67_11094_c1
1232 nmdc:mga0qj67_25010_c1
1233 nmdc:mga0qj67_52659_c1
1234 nmdc:mga06r32_133506_c1
1235 nmdc:mga06r32_172637_c1
1236 nmdc:mga06r32_198109_c1
1237 nmdc:mga06r32_31729_c1
1238 nmdc:mga06r32_59135_c1
1239 nmdc:mga06r32_6002_c1
1240 nmdc:mga06r32_72040_c1
1241 nmdc:mga08y16_11196_c1
1242 nmdc:mga08y16_119903_c1
1243 nmdc:mga08y16_1262_c1
1244 nmdc:mga08y16_153172_c1
1245 nmdc:mga08y16_171260_c1
1246 nmdc:mga08y16_18622_c1
1247 nmdc:mga08y16_23346_c1
1248 nmdc:mga08y16_314119_c1
1249 nmdc:mga08y16_326881_c1
1250 nmdc:mga08y16_40785_c1
1251 nmdc:mga08y16_9368_c1
1252 nmdc:mga0n895_106068_c1
1253 nmdc:mga0n895_11152_c1
1254 nmdc:mga0n895_167886_c1
1255 nmdc:mga0n895_18431_c1
1256 nmdc:mga0n895_188926_c1
1257 nmdc:mga0n895_335_c1
1258 nmdc:mga0n895_38692_c1
1259 nmdc:mga0n895_80296_c1
1260 nmdc:mga0n895_83_c1
1261 nmdc:mga0n895_8763_c1
1262 nmdc:mga0rr50_14496_c1
1263 nmdc:mga0rr50_24662_c1
1264 nmdc:mga0rr50_262583_c1
1265 nmdc:mga0rr50_3_c1
1266 nmdc:mga0rr50_49175_c1
1267 nmdc:mga0rr50_614_c1
1268 nmdc:mga08x19_10221_c1
1269 nmdc:mga08x19_153017_c1
1270 nmdc:mga08x19_3410_c1
1271 nmdc:mga08x19_36273_c1
1272 nmdc:mga08x19_52156_c1
1273 nmdc:mga0a205_105911_c1
1274 nmdc:mga0a205_11783_c1
1275 nmdc:mga0a205_130550_c1
1276 nmdc:mga0a205_135224_c1
1277 nmdc:mga0a205_18988_c1
1278 nmdc:mga0a205_2832_c2
1279 nmdc:mga0a205_51370_c1
1280 nmdc:mga0a205_54169_c1
1281 nmdc:mga0a205_54267_c2
1282 nmdc:mga0a205_79923_c1
1283 nmdc:mga0a205_87839_c1
1284 Ga0495601_0133698
1285 Ga0495655_0029744
1286 Ga0495619_0005625
1287 Ga0501084_0176103
1288 Ga0501084_0229432
1289 Ga0501084_0291127
1290 Ga0590071_000723
1291 Ga0590071_004017
1292 Ga0590074_000042
1293 Ga0590074_000730
1294 Ga0590075_000135
1295 Ga0590075_000600
1296 Ga0590075_006232
1297 Ga0590077_000746
1298 Ga0590077_000999
1299 Ga0501082_0073125
1300 Ga0530510_0008471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

1

243

0.99

PF08669

GCV_T_C

Glycine cleavage T-protein C-terminal barrel domain

267

345

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1woo-assembly1.cif.gz_A crystal structure of t-protein of the glycine cleavage system 0.979 9 368
1woo-assembly1.cif.gz_A crystal structure of t-protein of the glycine cleavage system 0.963 9 368
4pab-assembly2.cif.gz_B crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate 0.9599 17 370
4paa-assembly2.cif.gz_B crystal structure of the mature form of rat dmgdh complexed with tetrahydrofolate 0.959 11 368
1yx2-assembly1.cif.gz_A crystal structure of the probable aminomethyltransferase from bacillus subtilis 0.9586 9 366
ID Description Score Start End Superfamily
1wopA01 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Probable tRNA modification gtpase trme; domain 1 0.987 9 243 3.30.1360.120
1wopA01 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Probable tRNA modification gtpase trme; domain 1 0.9804 9 243 3.30.1360.120
1wosA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9711 58 145 3.30.70.1400
1wosA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9603 58 145 3.30.70.1400
1yx2B01 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Probable tRNA modification gtpase trme; domain 1 0.9559 9 243 3.30.1360.120
ID Description Score Start End GO Terms
AF-A0A660RE58-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT 0.9932 6 130 GO:0005829
GO:0008168
GO:0032259
AF-A0A533WEH3-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT 0.9885 10 181 GO:0005829
GO:0008168
GO:0032259
AF-A0A7V2ATS3-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT 0.9879 8 131 GO:0005829
AF-A0A2V7HRR6-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT 0.9869 20 159 GO:0005829
GO:0008168
GO:0032259
AF-A0A7X4YHE0-F1-model_v4 Aminomethyltransferase (EC 2.1.2.10) (Glycine cleavage system T protein) 0.9867 9 370 GO:0004047
GO:0005829
GO:0005960
GO:0008168
GO:0008483
GO:0019464
GO:0032259

Map