F472525
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 650 | 370 | 589 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300025935|Ga0207709_10000076|Ga0207709_10000076132 |
| Length | 300 |
| Sequence | MAAILDENNSQMKHPRVSGPEAWLGIVGRVFFPTSPGDSDTMSYENIDVRTEAGKVGIITLNRPKALNALNDALMTELGQALKAFDADDAIGCIILTGSERAFAAGADIAAMAKYSFIDTYKGDYITRNWETIRSIRKPVIAAVSGFALGGGCELAMMCDFIIAADNAKFGQPEIKIGVIPGAGGTQRLPRAVGKSKAMDMALTARMMDAAEAERAGLVSRVVPFEKLADEALGAALIIAGFSQIAVMAAKESVNRAFESGLSDGVMFERRLFHALFATQDQKEGMDAFLAKRQPDFKNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 9 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 10 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 11 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 12 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 13 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 14 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 15 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 16 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 17 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 18 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 19 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 20 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 21 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 22 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 23 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 24 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 25 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 26 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 27 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 28 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 29 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 30 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 31 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 32 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 33 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 34 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 35 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 36 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 37 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 38 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 39 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 40 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 41 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 42 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 43 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 44 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 45 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 46 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 47 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 48 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 49 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 50 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 51 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 52 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 53 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 54 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 55 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 56 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 57 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 58 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 59 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 60 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 61 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 62 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 63 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 64 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 65 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 66 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 67 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 68 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 69 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 70 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 71 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 72 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 75 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 77 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 79 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 80 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 85 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 86 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 87 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 90 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 103 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 106 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 109 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 111 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 112 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 113 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 114 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 115 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 116 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 117 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 118 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 119 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 120 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 121 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 122 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 123 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 124 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 125 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 126 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 127 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 128 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 133 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 230 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 231 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 232 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 233 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 234 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 235 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 236 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 241 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 246 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 248 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 249 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 255 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 265 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 266 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 267 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 268 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 269 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 270 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 271 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 272 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 273 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 274 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 275 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 276 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 277 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 278 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 279 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 280 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 281 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 282 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 283 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 284 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 285 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 286 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 287 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 288 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 289 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 290 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 291 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 292 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 293 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 294 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 295 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 296 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 297 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 298 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 299 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 300 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 335 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 342 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 343 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 344 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 345 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 346 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 347 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 348 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 351 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 355 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 358 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 362 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 363 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 364 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 365 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 368 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 370 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.31 |
| Metatranscriptomes | 0.46 |
| Isolates | 9.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.85 |
| Nodule | 1.38 |
| Rhizoplane | 2.15 |
| Rhizosphere | 55.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10052958 | 3300001989 | Bacteria | 1304 |
| 2 | JGI25155J39150_1000029 | 3300002704 | Bacteria | 118964 |
| 3 | JGI25156J39149_1000272 | 3300002705 | Bacteria | 35071 |
| 4 | JGI25154J39366_1000053 | 3300002738 | Bacteria | 119466 |
| 5 | JGI25157J39369_1000046 | 3300002741 | Bacteria | 119470 |
| 6 | JGI25150J39212_1004866 | 3300002774 | Bacteria | 2928 |
| 7 | JGI25150J39212_1011896 | 3300002774 | Bacteria | 1560 |
| 8 | JGI25150J39212_1015851 | 3300002774 | Bacteria | 1247 |
| 9 | JGI25159J45721_1005232 | 3300002987 | Bacteria | 4107 |
| 10 | JGI25159J45721_1014942 | 3300002987 | Bacteria | 1723 |
| 11 | JGI25151J46595_10001446 | 3300003187 | Bacteria | 16098 |
| 12 | JGI25151J46595_10003511 | 3300003187 | Bacteria | 8633 |
| 13 | JGI25151J46595_10008613 | 3300003187 | Bacteria | 4889 |
| 14 | JGI25151J46595_10011783 | 3300003187 | Bacteria | 4006 |
| 15 | JGI25153J46596_10002887 | 3300003215 | Bacteria | 9753 |
| 16 | JGI25153J46596_10026617 | 3300003215 | Bacteria | 2043 |
| 17 | JGI25160J50197_1008376 | 3300003354 | Bacteria | 3946 |
| 18 | JGI25160J50197_1010335 | 3300003354 | Bacteria | 3382 |
| 19 | JGI25160J50197_1030576 | 3300003354 | Bacteria | 1400 |
| 20 | JGI25161J50226_1000046 | 3300003374 | Bacteria | 116165 |
| 21 | JGI25161J50226_1004960 | 3300003374 | Bacteria | 2692 |
| 22 | Ga0006562J51391_1044074 | 3300003578 | Bacteria | 1655 |
| 23 | Ga0006562J51391_1045467 | 3300003578 | Bacteria | 6752 |
| 24 | Ga0006562J51391_1045469 | 3300003578 | Bacteria | 3632 |
| 25 | Ga0055535_1000289 | 3300003761 | Bacteria | 53058 |
| 26 | Ga0055542_1000036 | 3300003762 | Bacteria | 227346 |
| 27 | Ga0055526_1004155 | 3300003771 | Bacteria | 8815 |
| 28 | Ga0055526_1005732 | 3300003771 | Bacteria | 7017 |
| 29 | Ga0055537_1000623 | 3300003773 | Bacteria | 19351 |
| 30 | Ga0055524_1000044 | 3300003775 | Bacteria | 151631 |
| 31 | Ga0055524_1000469 | 3300003775 | Bacteria | 32369 |
| 32 | Ga0055524_1022088 | 3300003775 | Bacteria | 2088 |
| 33 | Ga0055536_1014715 | 3300003781 | Bacteria | 2723 |
| 34 | Ga0055534_1000397 | 3300003784 | Bacteria | 26870 |
| 35 | Ga0055528_1008275 | 3300003790 | Bacteria | 4486 |
| 36 | Ga0055530_10000630 | 3300003791 | Bacteria | 30400 |
| 37 | Ga0055530_10003088 | 3300003791 | Bacteria | 9896 |
| 38 | Ga0055540_1000063 | 3300003792 | Bacteria | 127901 |
| 39 | Ga0055540_1000173 | 3300003792 | Bacteria | 63434 |
| 40 | Ga0055540_1007713 | 3300003792 | Bacteria | 4007 |
| 41 | Ga0055531_10000276 | 3300003794 | Bacteria | 52882 |
| 42 | Ga0055531_10014054 | 3300003794 | Bacteria | 3637 |
| 43 | Ga0055543_1001803 | 3300004625 | Bacteria | 7904 |
| 44 | Ga0055543_1002615 | 3300004625 | Bacteria | 5812 |
| 45 | Ga0065165_1056801 | 3300005262 | Bacteria | 1086 |
| 46 | Ga0065704_10196713 | 3300005289 | Bacteria | 1164 |
| 47 | Ga0065704_10220127 | 3300005289 | Bacteria | 1077 |
| 48 | Ga0065707_10152043 | 3300005295 | Bacteria | 1648 |
| 49 | Ga0070658_10079968 | 3300005327 | Bacteria | 2684 |
| 50 | Ga0070658_10180959 | 3300005327 | Bacteria | 1774 |
| 51 | Ga0070658_10209465 | 3300005327 | Bacteria | 1647 |
| 52 | Ga0070670_100091617 | 3300005331 | Bacteria | 2613 |
| 53 | Ga0068868_100565144 | 3300005338 | Bacteria | 1004 |
| 54 | Ga0070661_100001470 | 3300005344 | Bacteria | 16360 |
| 55 | Ga0070668_100249499 | 3300005347 | Bacteria | 1473 |
| 56 | Ga0070668_100463328 | 3300005347 | Bacteria | 1092 |
| 57 | Ga0070669_100081971 | 3300005353 | Bacteria | 2404 |
| 58 | Ga0070669_100148324 | 3300005353 | Bacteria | 1814 |
| 59 | Ga0070669_100164412 | 3300005353 | Bacteria | 1727 |
| 60 | Ga0070675_100024440 | 3300005354 | Bacteria | 4838 |
| 61 | Ga0070671_100025509 | 3300005355 | Bacteria | 4851 |
| 62 | Ga0070671_100047940 | 3300005355 | Bacteria | 3552 |
| 63 | Ga0070673_100020985 | 3300005364 | Bacteria | 4723 |
| 64 | Ga0070659_100001712 | 3300005366 | Bacteria | 15775 |
| 65 | Ga0070659_100089034 | 3300005366 | Bacteria | 2472 |
| 66 | Ga0070667_100015275 | 3300005367 | Bacteria | 6346 |
| 67 | Ga0070708_100111340 | 3300005445 | Bacteria | 2517 |
| 68 | Ga0070663_100091088 | 3300005455 | Bacteria | 2259 |
| 69 | Ga0070678_100228320 | 3300005456 | Bacteria | 1551 |
| 70 | Ga0070662_100040739 | 3300005457 | Bacteria | 3309 |
| 71 | Ga0068867_100069959 | 3300005459 | Bacteria | 2622 |
| 72 | Ga0068867_100149273 | 3300005459 | Bacteria | 1835 |
| 73 | Ga0070685_10407842 | 3300005466 | Bacteria | 943 |
| 74 | Ga0070706_100003421 | 3300005467 | Bacteria | 15654 |
| 75 | Ga0068853_100012883 | 3300005539 | Bacteria | 6814 |
| 76 | Ga0068853_100224713 | 3300005539 | Bacteria | 1716 |
| 77 | Ga0070672_100039085 | 3300005543 | Bacteria | 3632 |
| 78 | Ga0070672_100165814 | 3300005543 | Bacteria | 1835 |
| 79 | Ga0070665_100085161 | 3300005548 | Bacteria | 3166 |
| 80 | Ga0070665_100105115 | 3300005548 | Bacteria | 2825 |
| 81 | Ga0070665_100345199 | 3300005548 | Bacteria | 1494 |
| 82 | Ga0070665_100506427 | 3300005548 | Bacteria | 1219 |
| 83 | Ga0068855_100022176 | 3300005563 | Bacteria | 7609 |
| 84 | Ga0068855_100089597 | 3300005563 | Bacteria | 3552 |
| 85 | Ga0068855_100116141 | 3300005563 | Bacteria | 3067 |
| 86 | Ga0070664_100002031 | 3300005564 | Bacteria | 16231 |
| 87 | Ga0070664_100013022 | 3300005564 | Bacteria | 6767 |
| 88 | Ga0070664_100693134 | 3300005564 | Bacteria | 949 |
| 89 | Ga0068857_100064053 | 3300005577 | Bacteria | 3269 |
| 90 | Ga0068857_100354154 | 3300005577 | Bacteria | 1360 |
| 91 | Ga0068854_100124322 | 3300005578 | Bacteria | 1963 |
| 92 | Ga0068852_100056642 | 3300005616 | Bacteria | 3389 |
| 93 | Ga0068852_100242356 | 3300005616 | Bacteria | 1724 |
| 94 | Ga0068859_100044987 | 3300005617 | Bacteria | 4435 |
| 95 | Ga0068864_100032354 | 3300005618 | Bacteria | 4444 |
| 96 | Ga0068864_100104975 | 3300005618 | Bacteria | 2511 |
| 97 | Ga0068851_10014047 | 3300005834 | Bacteria | 3797 |
| 98 | Ga0068863_100034397 | 3300005841 | Bacteria | 4827 |
| 99 | Ga0068863_100414650 | 3300005841 | Bacteria | 1319 |
| 100 | Ga0068863_100541600 | 3300005841 | Bacteria | 1149 |
| 101 | Ga0068860_100080422 | 3300005843 | Bacteria | 3099 |
| 102 | Ga0068860_100258559 | 3300005843 | Bacteria | 1697 |
| 103 | Ga0068862_100199483 | 3300005844 | Bacteria | 1804 |
| 104 | Ga0081455_10153923 | 3300005937 | Bacteria | 1770 |
| 105 | Ga0075365_10003479 | 3300006038 | Bacteria | 8122 |
| 106 | Ga0075365_10076520 | 3300006038 | Bacteria | 2259 |
| 107 | Ga0075365_10132489 | 3300006038 | Bacteria | 1726 |
| 108 | Ga0075365_10138900 | 3300006038 | Bacteria | 1686 |
| 109 | Ga0075368_10054797 | 3300006042 | Bacteria | 1589 |
| 110 | Ga0075363_100082242 | 3300006048 | Bacteria | 1762 |
| 111 | Ga0075364_10091292 | 3300006051 | Bacteria | 2021 |
| 112 | Ga0075432_10033726 | 3300006058 | Bacteria | 1776 |
| 113 | Ga0075362_10003327 | 3300006177 | Bacteria | 5602 |
| 114 | Ga0075362_10015585 | 3300006177 | Bacteria | 3094 |
| 115 | Ga0075362_10017376 | 3300006177 | Bacteria | 2963 |
| 116 | Ga0075362_10024283 | 3300006177 | Bacteria | 2570 |
| 117 | Ga0075362_10099598 | 3300006177 | Bacteria | 1357 |
| 118 | Ga0075367_10028530 | 3300006178 | Bacteria | 3185 |
| 119 | Ga0075367_10045067 | 3300006178 | Bacteria | 2587 |
| 120 | Ga0075367_10083729 | 3300006178 | Bacteria | 1933 |
| 121 | Ga0075366_10001341 | 3300006195 | Bacteria | 12307 |
| 122 | Ga0075366_10007913 | 3300006195 | Bacteria | 5880 |
| 123 | Ga0075366_10022118 | 3300006195 | Bacteria | 3698 |
| 124 | Ga0075366_10053794 | 3300006195 | Bacteria | 2392 |
| 125 | Ga0075366_10061318 | 3300006195 | Bacteria | 2235 |
| 126 | Ga0075366_10065134 | 3300006195 | Bacteria | 2167 |
| 127 | Ga0075366_10102128 | 3300006195 | Bacteria | 1721 |
| 128 | Ga0075366_10105054 | 3300006195 | Bacteria | 1697 |
| 129 | Ga0075366_10131971 | 3300006195 | Bacteria | 1507 |
| 130 | Ga0097621_100111445 | 3300006237 | Bacteria | 2312 |
| 131 | Ga0075370_10001058 | 3300006353 | Bacteria | 11460 |
| 132 | Ga0075370_10009223 | 3300006353 | Bacteria | 5112 |
| 133 | Ga0075370_10033362 | 3300006353 | Bacteria | 2882 |
| 134 | Ga0075370_10161389 | 3300006353 | Bacteria | 1315 |
| 135 | Ga0068871_100151985 | 3300006358 | Bacteria | 1975 |
| 136 | Ga0097620_100044987 | 3300006931 | Bacteria | 4435 |
| 137 | Ga0079104_1000037 | 3300006946 | Bacteria | 189207 |
| 138 | Ga0079104_1000294 | 3300006946 | Bacteria | 63150 |
| 139 | Ga0079104_1008514 | 3300006946 | Bacteria | 3581 |
| 140 | Ga0079104_1026331 | 3300006946 | Bacteria | 1504 |
| 141 | Ga0105240_10001543 | 3300009093 | Bacteria | 39121 |
| 142 | Ga0105240_10002814 | 3300009093 | Bacteria | 27490 |
| 143 | Ga0105240_10351882 | 3300009093 | Bacteria | 1671 |
| 144 | Ga0105245_10182584 | 3300009098 | Bacteria | 2005 |
| 145 | Ga0105245_10418446 | 3300009098 | Bacteria | 1343 |
| 146 | Ga0105247_10124116 | 3300009101 | Bacteria | 1676 |
| 147 | Ga0105243_10015400 | 3300009148 | Bacteria | 5782 |
| 148 | Ga0105243_10054766 | 3300009148 | Bacteria | 3167 |
| 149 | Ga0105243_10122609 | 3300009148 | Bacteria | 2194 |
| 150 | Ga0105241_10381380 | 3300009174 | Bacteria | 1232 |
| 151 | Ga0105237_10002372 | 3300009545 | Bacteria | 23375 |
| 152 | Ga0105237_10014572 | 3300009545 | Bacteria | 8216 |
| 153 | Ga0105237_10053518 | 3300009545 | Bacteria | 4048 |
| 154 | Ga0105238_10027529 | 3300009551 | Bacteria | 5794 |
| 155 | Ga0105238_10508411 | 3300009551 | Bacteria | 1206 |
| 156 | Ga0105238_10596867 | 3300009551 | Bacteria | 1112 |
| 157 | Ga0105239_10001168 | 3300010375 | Bacteria | 36102 |
| 158 | Ga0105239_10016215 | 3300010375 | Bacteria | 8242 |
| 159 | Ga0157347_1005573 | 3300012502 | Bacteria | 1208 |
| 160 | Ga0157347_1009747 | 3300012502 | Bacteria | 999 |
| 161 | Ga0157373_10003982 | 3300013100 | Bacteria | 11140 |
| 162 | Ga0157371_10108489 | 3300013102 | Bacteria | 1970 |
| 163 | Ga0157370_10007530 | 3300013104 | Bacteria | 11828 |
| 164 | Ga0157370_10374199 | 3300013104 | Bacteria | 1312 |
| 165 | Ga0157369_10050951 | 3300013105 | Bacteria | 4482 |
| 166 | Ga0157378_10271907 | 3300013297 | Bacteria | 1630 |
| 167 | Ga0163162_10021978 | 3300013306 | Bacteria | 6286 |
| 168 | Ga0157372_10804912 | 3300013307 | Bacteria | 1092 |
| 169 | Ga0157375_10192299 | 3300013308 | Bacteria | 2196 |
| 170 | Ga0157375_10295556 | 3300013308 | Bacteria | 1783 |
| 171 | Ga0182008_10000191 | 3300014497 | Bacteria | 48580 |
| 172 | Ga0182008_10003941 | 3300014497 | Bacteria | 8786 |
| 173 | Ga0182008_10005474 | 3300014497 | Bacteria | 7230 |
| 174 | Ga0182008_10006656 | 3300014497 | Bacteria | 6434 |
| 175 | Ga0182008_10026178 | 3300014497 | Bacteria | 2959 |
| 176 | Ga0157376_10175324 | 3300014969 | Bacteria | 1955 |
| 177 | Ga0157376_10708669 | 3300014969 | Bacteria | 1012 |
| 178 | Ga0182006_1001724 | 3300015261 | Bacteria | 12705 |
| 179 | Ga0182006_1058840 | 3300015261 | Bacteria | 1456 |
| 180 | Ga0182007_10002842 | 3300015262 | Bacteria | 8423 |
| 181 | Ga0182005_1025809 | 3300015265 | Bacteria | 1604 |
| 182 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 183 | Ga0163161_10000244 | 3300017792 | Bacteria | 49165 |
| 184 | Ga0163161_10128426 | 3300017792 | Bacteria | 1910 |
| 185 | Ga0163161_10131556 | 3300017792 | Bacteria | 1888 |
| 186 | Ga0163161_10181282 | 3300017792 | Bacteria | 1615 |
| 187 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 188 | Ga0209436_106712 | 3300025208 | Bacteria | 2488 |
| 189 | Ga0209672_101200 | 3300025228 | Bacteria | 10518 |
| 190 | Ga0209147_100961 | 3300025229 | Bacteria | 12646 |
| 191 | Ga0209258_100091 | 3300025242 | Bacteria | 227454 |
| 192 | Ga0207425_1000183 | 3300025245 | Bacteria | 51638 |
| 193 | Ga0207425_1000933 | 3300025245 | Bacteria | 13901 |
| 194 | Ga0207425_1009626 | 3300025245 | Bacteria | 2394 |
| 195 | Ga0207425_1033787 | 3300025245 | Bacteria | 1006 |
| 196 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 197 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 198 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 199 | Ga0209759_1000026 | 3300025256 | Bacteria | 311743 |
| 200 | Ga0209129_1000091 | 3300025258 | Bacteria | 175716 |
| 201 | Ga0209129_1004863 | 3300025258 | Bacteria | 5026 |
| 202 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 203 | Ga0209565_1000200 | 3300025263 | Bacteria | 71490 |
| 204 | Ga0209565_1000270 | 3300025263 | Bacteria | 52764 |
| 205 | Ga0209565_1000507 | 3300025263 | Bacteria | 28238 |
| 206 | Ga0209565_1001022 | 3300025263 | Bacteria | 14301 |
| 207 | Ga0209565_1027612 | 3300025263 | Bacteria | 1128 |
| 208 | Ga0209565_1028856 | 3300025263 | Bacteria | 1093 |
| 209 | Ga0209673_1000009 | 3300025273 | Bacteria | 620735 |
| 210 | Ga0209673_1000012 | 3300025273 | Bacteria | 579480 |
| 211 | Ga0209673_1000072 | 3300025273 | Bacteria | 236935 |
| 212 | Ga0209673_1000154 | 3300025273 | Bacteria | 146394 |
| 213 | Ga0209673_1000772 | 3300025273 | Bacteria | 43167 |
| 214 | Ga0209673_1007609 | 3300025273 | Bacteria | 4951 |
| 215 | Ga0209130_1000064 | 3300025284 | Bacteria | 196568 |
| 216 | Ga0209130_1000140 | 3300025284 | Bacteria | 115434 |
| 217 | Ga0209130_1000203 | 3300025284 | Bacteria | 80023 |
| 218 | Ga0209130_1000225 | 3300025284 | Bacteria | 74120 |
| 219 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 220 | Ga0209675_1000144 | 3300025291 | Bacteria | 94908 |
| 221 | Ga0209675_1000447 | 3300025291 | Bacteria | 32004 |
| 222 | Ga0209675_1001399 | 3300025291 | Bacteria | 14004 |
| 223 | Ga0209676_1000051 | 3300025292 | Bacteria | 389016 |
| 224 | Ga0209676_1000088 | 3300025292 | Bacteria | 263010 |
| 225 | Ga0209676_1000267 | 3300025292 | Bacteria | 109237 |
| 226 | Ga0209676_1000966 | 3300025292 | Bacteria | 34669 |
| 227 | Ga0209676_1002156 | 3300025292 | Bacteria | 14892 |
| 228 | Ga0209676_1009167 | 3300025292 | Bacteria | 4305 |
| 229 | Ga0209025_1000207 | 3300025294 | Bacteria | 140774 |
| 230 | Ga0209025_1000356 | 3300025294 | Bacteria | 98547 |
| 231 | Ga0209025_1001327 | 3300025294 | Bacteria | 33484 |
| 232 | Ga0209025_1001509 | 3300025294 | Bacteria | 29944 |
| 233 | Ga0209025_1007756 | 3300025294 | Bacteria | 7907 |
| 234 | Ga0209025_1008400 | 3300025294 | Bacteria | 7443 |
| 235 | Ga0209025_1013276 | 3300025294 | Bacteria | 5193 |
| 236 | Ga0209564_1000103 | 3300025295 | Bacteria | 221166 |
| 237 | Ga0209564_1000530 | 3300025295 | Bacteria | 62121 |
| 238 | Ga0209564_1000797 | 3300025295 | Bacteria | 43362 |
| 239 | Ga0209564_1000945 | 3300025295 | Bacteria | 37432 |
| 240 | Ga0209564_1001673 | 3300025295 | Bacteria | 21213 |
| 241 | Ga0209758_1000092 | 3300025297 | Bacteria | 241910 |
| 242 | Ga0209758_1000327 | 3300025297 | Bacteria | 89663 |
| 243 | Ga0209758_1010345 | 3300025297 | Bacteria | 5599 |
| 244 | Ga0209758_1010394 | 3300025297 | Bacteria | 5577 |
| 245 | Ga0209758_1015192 | 3300025297 | Bacteria | 4013 |
| 246 | Ga0209050_1000044 | 3300025298 | Bacteria | 391114 |
| 247 | Ga0209050_1000110 | 3300025298 | Bacteria | 216664 |
| 248 | Ga0209050_1000916 | 3300025298 | Bacteria | 38869 |
| 249 | Ga0209050_1000983 | 3300025298 | Bacteria | 36304 |
| 250 | Ga0209050_1005037 | 3300025298 | Bacteria | 8559 |
| 251 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 252 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 253 | Ga0209256_1000065 | 3300025299 | Bacteria | 248104 |
| 254 | Ga0209256_1000094 | 3300025299 | Bacteria | 208177 |
| 255 | Ga0207426_1000084 | 3300025302 | Bacteria | 298123 |
| 256 | Ga0207426_1000116 | 3300025302 | Bacteria | 225245 |
| 257 | Ga0207426_1000124 | 3300025302 | Bacteria | 218145 |
| 258 | Ga0207426_1001529 | 3300025302 | Bacteria | 18859 |
| 259 | Ga0209051_1000031 | 3300025303 | Bacteria | 391114 |
| 260 | Ga0209051_1000069 | 3300025303 | Bacteria | 219208 |
| 261 | Ga0209051_1000114 | 3300025303 | Bacteria | 152303 |
| 262 | Ga0209051_1000230 | 3300025303 | Bacteria | 94027 |
| 263 | Ga0209051_1000379 | 3300025303 | Bacteria | 63486 |
| 264 | Ga0209051_1000685 | 3300025303 | Bacteria | 37585 |
| 265 | Ga0209051_1001139 | 3300025303 | Bacteria | 24282 |
| 266 | Ga0209051_1001228 | 3300025303 | Bacteria | 23035 |
| 267 | Ga0209051_1002160 | 3300025303 | Bacteria | 14589 |
| 268 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 269 | Ga0209257_1000058 | 3300025304 | Bacteria | 381686 |
| 270 | Ga0209257_1000093 | 3300025304 | Bacteria | 263088 |
| 271 | Ga0209257_1000141 | 3300025304 | Bacteria | 201130 |
| 272 | Ga0209257_1000575 | 3300025304 | Bacteria | 61759 |
| 273 | Ga0207656_10007635 | 3300025321 | Bacteria | 3948 |
| 274 | Ga0207655_1001961 | 3300025728 | Bacteria | 17580 |
| 275 | Ga0207642_10169774 | 3300025899 | Bacteria | 1179 |
| 276 | Ga0207710_10101190 | 3300025900 | Bacteria | 1359 |
| 277 | Ga0207680_10353356 | 3300025903 | Bacteria | 1033 |
| 278 | Ga0207645_10162906 | 3300025907 | Bacteria | 1459 |
| 279 | Ga0207645_10265362 | 3300025907 | Bacteria | 1138 |
| 280 | Ga0207705_10352441 | 3300025909 | Bacteria | 1134 |
| 281 | Ga0207705_10400712 | 3300025909 | Bacteria | 1061 |
| 282 | Ga0207684_10053942 | 3300025910 | Bacteria | 3411 |
| 283 | Ga0207654_10291750 | 3300025911 | Bacteria | 1106 |
| 284 | Ga0207695_10005159 | 3300025913 | Bacteria | 17488 |
| 285 | Ga0207695_10068733 | 3300025913 | Bacteria | 3629 |
| 286 | Ga0207695_10163527 | 3300025913 | Bacteria | 2155 |
| 287 | Ga0207695_10256385 | 3300025913 | Bacteria | 1648 |
| 288 | Ga0207671_10013375 | 3300025914 | Bacteria | 6538 |
| 289 | Ga0207671_10044087 | 3300025914 | Bacteria | 3298 |
| 290 | Ga0207671_10252773 | 3300025914 | Bacteria | 1386 |
| 291 | Ga0207657_10031330 | 3300025919 | Bacteria | 4818 |
| 292 | Ga0207657_10186173 | 3300025919 | Bacteria | 1677 |
| 293 | Ga0207649_10010410 | 3300025920 | Bacteria | 5110 |
| 294 | Ga0207649_10136167 | 3300025920 | Bacteria | 1675 |
| 295 | Ga0207652_10382497 | 3300025921 | Bacteria | 1270 |
| 296 | Ga0207681_10002439 | 3300025923 | Bacteria | 11796 |
| 297 | Ga0207681_10170720 | 3300025923 | Bacteria | 1648 |
| 298 | Ga0207681_10176916 | 3300025923 | Bacteria | 1622 |
| 299 | Ga0207694_10042635 | 3300025924 | Bacteria | 3500 |
| 300 | Ga0207650_10160955 | 3300025925 | Bacteria | 1778 |
| 301 | Ga0207687_10120309 | 3300025927 | Bacteria | 1963 |
| 302 | Ga0207644_10038729 | 3300025931 | Bacteria | 3361 |
| 303 | Ga0207644_10186148 | 3300025931 | Bacteria | 1630 |
| 304 | Ga0207690_10002101 | 3300025932 | Bacteria | 12197 |
| 305 | Ga0207690_10022892 | 3300025932 | Bacteria | 3892 |
| 306 | Ga0207706_10042818 | 3300025933 | Bacteria | 4012 |
| 307 | Ga0207686_10011859 | 3300025934 | Bacteria | 4782 |
| 308 | Ga0207709_10000076 | 3300025935 | Bacteria | 173292 |
| 309 | Ga0207709_10000472 | 3300025935 | Bacteria | 36896 |
| 310 | Ga0207709_10002379 | 3300025935 | Bacteria | 11866 |
| 311 | Ga0207709_10042383 | 3300025935 | Bacteria | 2737 |
| 312 | Ga0207691_10015393 | 3300025940 | Bacteria | 7277 |
| 313 | Ga0207691_10223290 | 3300025940 | Bacteria | 1633 |
| 314 | Ga0207689_10137037 | 3300025942 | Bacteria | 2015 |
| 315 | Ga0207689_10347778 | 3300025942 | Bacteria | 1232 |
| 316 | Ga0207689_10391223 | 3300025942 | Bacteria | 1158 |
| 317 | Ga0207679_10000088 | 3300025945 | Bacteria | 79836 |
| 318 | Ga0207679_10027321 | 3300025945 | Bacteria | 3945 |
| 319 | Ga0207667_10039365 | 3300025949 | Bacteria | 5039 |
| 320 | Ga0207667_10117417 | 3300025949 | Bacteria | 2742 |
| 321 | Ga0207651_10013397 | 3300025960 | Bacteria | 4692 |
| 322 | Ga0207651_10266560 | 3300025960 | Bacteria | 1409 |
| 323 | Ga0207651_10298052 | 3300025960 | Bacteria | 1340 |
| 324 | Ga0207668_10058976 | 3300025972 | Bacteria | 2686 |
| 325 | Ga0207640_10320841 | 3300025981 | Bacteria | 1233 |
| 326 | Ga0207677_10010744 | 3300026023 | Bacteria | 5190 |
| 327 | Ga0207677_10014817 | 3300026023 | Bacteria | 4566 |
| 328 | Ga0207677_10383172 | 3300026023 | Bacteria | 1187 |
| 329 | Ga0207639_10019378 | 3300026041 | Bacteria | 4851 |
| 330 | Ga0207639_10139927 | 3300026041 | Bacteria | 2015 |
| 331 | Ga0207678_10026992 | 3300026067 | Bacteria | 5008 |
| 332 | Ga0207641_10008372 | 3300026088 | Bacteria | 8547 |
| 333 | Ga0207641_10523579 | 3300026088 | Bacteria | 1154 |
| 334 | Ga0207648_10013164 | 3300026089 | Bacteria | 7711 |
| 335 | Ga0207648_10065424 | 3300026089 | Bacteria | 3170 |
| 336 | Ga0207648_10502337 | 3300026089 | Bacteria | 1110 |
| 337 | Ga0207676_10033357 | 3300026095 | Bacteria | 3889 |
| 338 | Ga0207676_10132659 | 3300026095 | Bacteria | 2120 |
| 339 | Ga0207676_10324649 | 3300026095 | Bacteria | 1414 |
| 340 | Ga0207674_10016085 | 3300026116 | Bacteria | 8194 |
| 341 | Ga0207674_10034413 | 3300026116 | Bacteria | 5296 |
| 342 | Ga0207674_10362917 | 3300026116 | Bacteria | 1400 |
| 343 | Ga0207674_10402966 | 3300026116 | Bacteria | 1322 |
| 344 | Ga0207674_10434698 | 3300026116 | Bacteria | 1268 |
| 345 | Ga0207675_100032073 | 3300026118 | Bacteria | 4893 |
| 346 | Ga0207675_100384680 | 3300026118 | Bacteria | 1380 |
| 347 | Ga0207683_10031829 | 3300026121 | Bacteria | 4580 |
| 348 | Ga0207683_10276400 | 3300026121 | Bacteria | 1535 |
| 349 | Ga0207698_10044076 | 3300026142 | Bacteria | 3348 |
| 350 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 351 | Ga0209281_1000423 | 3300027111 | Bacteria | 63126 |
| 352 | Ga0209281_1019020 | 3300027111 | Bacteria | 1362 |
| 353 | Ga0209970_1000026 | 3300027614 | Bacteria | 19518 |
| 354 | Ga0209282_1000298 | 3300027666 | Bacteria | 24501 |
| 355 | Ga0209971_1000744 | 3300027682 | Bacteria | 8388 |
| 356 | Ga0209974_10005128 | 3300027876 | Bacteria | 4627 |
| 357 | Ga0209974_10010577 | 3300027876 | Bacteria | 3113 |
| 358 | Ga0209974_10016653 | 3300027876 | Bacteria | 2440 |
| 359 | Ga0268266_10006260 | 3300028379 | Bacteria | 10924 |
| 360 | Ga0268266_10026800 | 3300028379 | Bacteria | 4904 |
| 361 | Ga0268266_10345295 | 3300028379 | Bacteria | 1398 |
| 362 | Ga0268265_10174867 | 3300028380 | Bacteria | 1839 |
| 363 | Ga0268265_10352528 | 3300028380 | Bacteria | 1344 |
| 364 | Ga0268264_10051817 | 3300028381 | Bacteria | 3421 |
| 365 | Ga0307517_10139084 | 3300028786 | Bacteria | 1713 |
| 366 | Ga0307515_10000419 | 3300028794 | Bacteria | 102271 |
| 367 | Ga0307515_10003462 | 3300028794 | Bacteria | 33182 |
| 368 | Ga0307515_10007779 | 3300028794 | Bacteria | 21087 |
| 369 | Ga0307515_10048555 | 3300028794 | Bacteria | 6414 |
| 370 | Ga0307515_10149053 | 3300028794 | Bacteria | 2457 |
| 371 | Ga0307515_10160465 | 3300028794 | Bacteria | 2296 |
| 372 | Ga0307515_10196436 | 3300028794 | Bacteria | 1908 |
| 373 | Ga0307512_10061877 | 3300030522 | Bacteria | 2878 |
| 374 | Ga0316176_1093739 | 3300030732 | Bacteria | 1374 |
| 375 | Ga0314311_1200241 | 3300030733 | Bacteria | 1827 |
| 376 | Ga0316179_1078761 | 3300030734 | Bacteria | 1798 |
| 377 | Ga0316183_1110470 | 3300030742 | Bacteria | 3052 |
| 378 | Ga0265330_10000044 | 3300031235 | Bacteria | 113679 |
| 379 | Ga0265330_10037185 | 3300031235 | Bacteria | 2168 |
| 380 | Ga0265332_10000046 | 3300031238 | Bacteria | 113777 |
| 381 | Ga0265332_10003009 | 3300031238 | Bacteria | 8269 |
| 382 | Ga0265325_10013967 | 3300031241 | Bacteria | 4554 |
| 383 | Ga0265340_10006278 | 3300031247 | Bacteria | 6550 |
| 384 | Ga0265327_10000945 | 3300031251 | Bacteria | 42267 |
| 385 | Ga0265327_10005555 | 3300031251 | Bacteria | 10470 |
| 386 | Ga0265316_10056195 | 3300031344 | Bacteria | 3076 |
| 387 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 388 | Ga0307513_10000316 | 3300031456 | Bacteria | 69426 |
| 389 | Ga0307513_10029422 | 3300031456 | Bacteria | 6263 |
| 390 | Ga0307513_10189360 | 3300031456 | Bacteria | 1911 |
| 391 | Ga0307513_10350444 | 3300031456 | Bacteria | 1224 |
| 392 | Ga0307513_10440379 | 3300031456 | Bacteria | 1029 |
| 393 | Ga0307509_10000904 | 3300031507 | Bacteria | 50711 |
| 394 | Ga0307509_10011898 | 3300031507 | Bacteria | 10462 |
| 395 | Ga0307509_10154799 | 3300031507 | Bacteria | 2200 |
| 396 | Ga0307509_10249323 | 3300031507 | Bacteria | 1561 |
| 397 | Ga0307408_100000229 | 3300031548 | Bacteria | 59103 |
| 398 | Ga0307408_100052417 | 3300031548 | Bacteria | 2942 |
| 399 | Ga0307408_100066336 | 3300031548 | Bacteria | 2650 |
| 400 | Ga0307408_100196146 | 3300031548 | Bacteria | 1630 |
| 401 | Ga0307408_100257436 | 3300031548 | Bacteria | 1442 |
| 402 | Ga0307408_100327357 | 3300031548 | Bacteria | 1293 |
| 403 | Ga0307408_100547679 | 3300031548 | Bacteria | 1020 |
| 404 | Ga0307514_10001645 | 3300031649 | Bacteria | 26056 |
| 405 | Ga0307514_10005374 | 3300031649 | Bacteria | 11477 |
| 406 | Ga0307514_10017019 | 3300031649 | Bacteria | 5984 |
| 407 | Ga0265314_10000130 | 3300031711 | Bacteria | 113776 |
| 408 | Ga0265314_10008127 | 3300031711 | Bacteria | 9029 |
| 409 | Ga0265342_10027415 | 3300031712 | Bacteria | 3561 |
| 410 | Ga0307516_10005347 | 3300031730 | Bacteria | 15436 |
| 411 | Ga0307516_10036692 | 3300031730 | Bacteria | 4905 |
| 412 | Ga0307516_10412981 | 3300031730 | Bacteria | 1008 |
| 413 | Ga0307405_10071808 | 3300031731 | Bacteria | 2228 |
| 414 | Ga0307405_10332780 | 3300031731 | Bacteria | 1164 |
| 415 | Ga0307413_10056778 | 3300031824 | Bacteria | 2390 |
| 416 | Ga0307406_10000319 | 3300031901 | Bacteria | 28062 |
| 417 | Ga0307406_10459303 | 3300031901 | Bacteria | 1023 |
| 418 | Ga0307412_10247479 | 3300031911 | Bacteria | 1382 |
| 419 | Ga0307416_100035902 | 3300032002 | Bacteria | 3793 |
| 420 | Ga0307411_10088171 | 3300032005 | Bacteria | 2157 |
| 421 | Ga0307510_10000122 | 3300033180 | Bacteria | 62024 |
| 422 | Ga0307510_10288971 | 3300033180 | Bacteria | 1106 |
| 423 | Ga0373939_0048742 | 3300035114 | Bacteria | 1307 |
| 424 | Ga0373931_0114117 | 3300035691 | Bacteria | 1536 |
| 425 | Ga0373933_0433548 | 3300035724 | Bacteria | 859 |
| 426 | Ga0373925_0013137 | 3300037068 | Bacteria | 5993 |
| 427 | Ga0395899_0010475 | 3300037312 | Bacteria | 7100 |
| 428 | Ga0395900_0038355 | 3300037418 | Bacteria | 4937 |
| 429 | Ga0395900_0043581 | 3300037418 | Bacteria | 4624 |
| 430 | Ga0395898_0026798 | 3300037466 | Bacteria | 5793 |
| 431 | Ga0395898_0051820 | 3300037466 | Bacteria | 4011 |
| 432 | Ga0395898_0091650 | 3300037466 | Bacteria | 2924 |
| 433 | Ga0395898_0834481 | 3300037466 | Bacteria | 861 |
| 434 | Ga0395905_0011798 | 3300037471 | Bacteria | 8437 |
| 435 | Ga0395905_0014547 | 3300037471 | Bacteria | 7507 |
| 436 | Ga0395905_0066757 | 3300037471 | Bacteria | 3369 |
| 437 | Ga0395905_0081260 | 3300037471 | Bacteria | 3037 |
| 438 | Ga0395905_0084626 | 3300037471 | Bacteria | 2972 |
| 439 | Ga0395905_0177666 | 3300037471 | Bacteria | 1998 |
| 440 | Ga0395905_0354791 | 3300037471 | Bacteria | 1359 |
| 441 | Ga0439436_0008463 | 3300041404 | Bacteria | 3164 |
| 442 | Ga0439439_0010418 | 3300041406 | Bacteria | 2222 |
| 443 | Ga0439439_0011894 | 3300041406 | Bacteria | 2099 |
| 444 | Ga0439465_0004738 | 3300041413 | Bacteria | 4385 |
| 445 | Ga0451853_2883190 | 3300041512 | Bacteria | 1576 |
| 446 | Ga0439431_0042692 | 3300041997 | Bacteria | 1159 |
| 447 | Ga0439433_0011584 | 3300041999 | Bacteria | 1933 |
| 448 | Ga0439442_009514 | 3300042002 | Bacteria | 1967 |
| 449 | Ga0439445_0007498 | 3300042004 | Bacteria | 2533 |
| 450 | Ga0439445_0032908 | 3300042004 | Bacteria | 1353 |
| 451 | Ga0439432_001103 | 3300042006 | Bacteria | 10265 |
| 452 | Ga0439432_008450 | 3300042006 | Bacteria | 3615 |
| 453 | Ga0439449_0000682 | 3300042007 | Bacteria | 12925 |
| 454 | Ga0439449_0002069 | 3300042007 | Bacteria | 7898 |
| 455 | Ga0439452_004403 | 3300042010 | Bacteria | 4727 |
| 456 | Ga0439452_004644 | 3300042010 | Bacteria | 4559 |
| 457 | Ga0439455_0001526 | 3300042012 | Bacteria | 3906 |
| 458 | Ga0439457_040827 | 3300042014 | Bacteria | 1034 |
| 459 | Ga0439462_0005434 | 3300042015 | Bacteria | 3141 |
| 460 | Ga0450919_000440 | 3300042121 | Bacteria | 5139 |
| 461 | Ga0450921_000658 | 3300042123 | Bacteria | 1754 |
| 462 | Ga0450921_001695 | 3300042123 | Bacteria | 1376 |
| 463 | Ga0450898_007415 | 3300042134 | Bacteria | 1708 |
| 464 | Ga0450906_005936 | 3300042145 | Bacteria | 2485 |
| 465 | Ga0439446_0029223 | 3300042156 | Bacteria | 1590 |
| 466 | Ga0439446_0052999 | 3300042156 | Bacteria | 1215 |
| 467 | Ga0439458_0066148 | 3300042157 | Bacteria | 908 |
| 468 | Ga0439434_0001557 | 3300042435 | Bacteria | 6612 |
| 469 | Ga0439434_0017164 | 3300042435 | Bacteria | 2165 |
| 470 | Ga0439434_0054867 | 3300042435 | Bacteria | 1240 |
| 471 | Ga0439460_0063482 | 3300042461 | Bacteria | 1132 |
| 472 | Ga0450918_000195 | 3300042531 | Bacteria | 13613 |
| 473 | Ga0450893_0016345 | 3300042532 | Bacteria | 1256 |
| 474 | Ga0451577_0000340 | 3300042876 | Bacteria | 87523 |
| 475 | Ga0451577_0004391 | 3300042876 | Bacteria | 14903 |
| 476 | Ga0466969_0213469 | 3300044656 | Bacteria | 878 |
| 477 | Ga0453683_0007043 | 3300044673 | Bacteria | 7660 |
| 478 | Ga0466965_0009394 | 3300044683 | Bacteria | 4544 |
| 479 | Ga0466965_0022297 | 3300044683 | Bacteria | 3054 |
| 480 | Ga0466961_0054566 | 3300044693 | Bacteria | 2548 |
| 481 | Ga0466964_0003116 | 3300044706 | Bacteria | 6026 |
| 482 | Ga0453684_0000793 | 3300044712 | Bacteria | 108286 |
| 483 | Ga0453684_0079742 | 3300044712 | Bacteria | 4091 |
| 484 | Ga0466971_0118285 | 3300044719 | Bacteria | 1225 |
| 485 | Ga0466957_0071907 | 3300044842 | Bacteria | 2140 |
| 486 | Ga0466957_0443580 | 3300044842 | Bacteria | 893 |
| 487 | Ga0466960_0050222 | 3300044901 | Bacteria | 2010 |
| 488 | Ga0466959_0109790 | 3300045049 | Bacteria | 1969 |
| 489 | Ga0451576_0020223 | 3300045051 | Bacteria | 7250 |
| 490 | Ga0451576_0023961 | 3300045051 | Bacteria | 6597 |
| 491 | Ga0451576_0126897 | 3300045051 | Bacteria | 2658 |
| 492 | Ga0466958_0342029 | 3300045836 | Bacteria | 962 |
| 493 | Ga0466967_0195272 | 3300045976 | Bacteria | 1914 |
| 494 | Ga0495590_0004862 | 3300046457 | Bacteria | 5373 |
| 495 | Ga0495639_0002239 | 3300046475 | Bacteria | 8498 |
| 496 | Ga0495616_0000288 | 3300046513 | Bacteria | 40663 |
| 497 | Ga0495631_0000187 | 3300046518 | Bacteria | 42155 |
| 498 | Ga0495632_0009885 | 3300046519 | Bacteria | 5703 |
| 499 | Ga0495637_0000830 | 3300046520 | Bacteria | 20412 |
| 500 | Ga0495643_0050204 | 3300046522 | Bacteria | 2247 |
| 501 | Ga0495642_0045448 | 3300046528 | Bacteria | 1795 |
| 502 | Ga0495642_0145725 | 3300046528 | Bacteria | 1023 |
| 503 | Ga0495654_0004560 | 3300046530 | Bacteria | 8192 |
| 504 | Ga0495621_0011136 | 3300046539 | Bacteria | 2773 |
| 505 | Ga0495597_0000721 | 3300046542 | Bacteria | 26390 |
| 506 | Ga0495597_0009303 | 3300046542 | Bacteria | 4864 |
| 507 | Ga0495622_0068598 | 3300046557 | Bacteria | 1638 |
| 508 | Ga0495622_0141931 | 3300046557 | Bacteria | 1090 |
| 509 | Ga0495633_0029065 | 3300046558 | Bacteria | 2690 |
| 510 | Ga0495656_0001085 | 3300046615 | Bacteria | 8809 |
| 511 | Ga0495668_0197976 | 3300046616 | Bacteria | 1100 |
| 512 | Ga0495625_0001236 | 3300046660 | Bacteria | 32273 |
| 513 | Ga0495625_0041071 | 3300046660 | Bacteria | 3368 |
| 514 | Ga0495625_0047397 | 3300046660 | Bacteria | 3098 |
| 515 | Ga0495661_0138377 | 3300046665 | Bacteria | 1327 |
| 516 | Ga0495588_0007292 | 3300046674 | Bacteria | 5026 |
| 517 | Ga0495588_0182152 | 3300046674 | Bacteria | 1110 |
| 518 | Ga0495658_0388872 | 3300046683 | Bacteria | 889 |
| 519 | Ga0495624_0076460 | 3300046690 | Bacteria | 2077 |
| 520 | Ga0495670_0062043 | 3300046691 | Bacteria | 1880 |
| 521 | Ga0495671_0007995 | 3300046692 | Bacteria | 5978 |
| 522 | Ga0495649_0013765 | 3300046694 | Bacteria | 4657 |
| 523 | Ga0495660_0055595 | 3300046810 | Bacteria | 2142 |
| 524 | Ga0495676_0032357 | 3300047321 | Bacteria | 4415 |
| 525 | Ga0495687_000327 | 3300047443 | Bacteria | 61677 |
| 526 | Ga0495677_0013572 | 3300047445 | Bacteria | 2966 |
| 527 | Ga0495681_0087967 | 3300047470 | Bacteria | 1376 |
| 528 | Ga0495593_0008355 | 3300047673 | Bacteria | 6025 |
| 529 | Ga0495593_0168172 | 3300047673 | Bacteria | 1106 |
| 530 | Ga0495626_0027261 | 3300048091 | Bacteria | 2779 |
| 531 | Ga0496100_0025814 | 3300048903 | Bacteria | 3595 |
| 532 | Ga0496101_0001647 | 3300048904 | Bacteria | 13387 |
| 533 | Ga0496101_0013086 | 3300048904 | Bacteria | 5550 |
| 534 | Ga0496102_0071013 | 3300048905 | Bacteria | 3197 |
| 535 | Ga0496103_0159333 | 3300048906 | Bacteria | 1447 |
| 536 | Ga0496104_0024430 | 3300048907 | Bacteria | 5557 |
| 537 | Ga0496105_0011915 | 3300048908 | Bacteria | 6884 |
| 538 | Ga0496109_0210562 | 3300048912 | Bacteria | 1828 |
| 539 | Ga0496109_0341157 | 3300048912 | Bacteria | 1415 |
| 540 | Ga0496110_0076278 | 3300048913 | Bacteria | 2980 |
| 541 | Ga0496113_0115852 | 3300048916 | Bacteria | 2091 |
| 542 | Ga0496116_0122546 | 3300048919 | Bacteria | 1501 |
| 543 | Ga0496121_0071081 | 3300048924 | Bacteria | 2800 |
| 544 | Ga0496122_0000324 | 3300048925 | Bacteria | 104220 |
| 545 | Ga0496123_0000160 | 3300048926 | Bacteria | 135310 |
| 546 | Ga0496123_0124326 | 3300048926 | Bacteria | 1443 |
| 547 | Ga0496124_0073204 | 3300048927 | Bacteria | 2836 |
| 548 | Ga0496125_0010589 | 3300048928 | Bacteria | 9317 |
| 549 | Ga0496125_0013806 | 3300048928 | Bacteria | 7912 |
| 550 | Ga0496125_0078801 | 3300048928 | Bacteria | 2530 |
| 551 | Ga0496126_0246918 | 3300048929 | Bacteria | 1489 |
| 552 | Ga0501031_0033045 | 3300049568 | Bacteria | 3373 |
| 553 | Ga0501034_0313959 | 3300049571 | Bacteria | 1501 |
| 554 | Ga0501257_088789 | 3300049686 | Bacteria | 803 |
| 555 | Ga0501262_003744 | 3300049759 | Bacteria | 1754 |
| 556 | Ga0501044_0680562 | 3300049823 | Bacteria | 915 |
| 557 | nmdc:mga03683_11698_c1 | 3300050489 | Bacteria | 3186 |
| 558 | nmdc:mga03683_17684_c1 | 3300050489 | Bacteria | 2702 |
| 559 | nmdc:mga03683_23445_c1 | 3300050489 | Bacteria | 2404 |
| 560 | nmdc:mga03683_26319_c1 | 3300050489 | Bacteria | 2294 |
| 561 | nmdc:mga03683_451_c1 | 3300050489 | Bacteria | 11851 |
| 562 | nmdc:mga03n38_27152_c1 | 3300050490 | Bacteria | 2372 |
| 563 | nmdc:mga00v17_13181_c1 | 3300050491 | Bacteria | 4581 |
| 564 | nmdc:mga0yw44_10136_c1 | 3300050492 | Bacteria | 4801 |
| 565 | nmdc:mga0yw44_77697_c1 | 3300050492 | Bacteria | 2074 |
| 566 | nmdc:mga0k408_10712_c1 | 3300050493 | Bacteria | 4968 |
| 567 | nmdc:mga0k408_21637_c1 | 3300050493 | Bacteria | 3614 |
| 568 | nmdc:mga0k408_31612_c1 | 3300050493 | Bacteria | 3023 |
| 569 | nmdc:mga0k408_43748_c1 | 3300050493 | Bacteria | 2582 |
| 570 | nmdc:mga0k408_52493_c1 | 3300050493 | Bacteria | 2363 |
| 571 | nmdc:mga0k408_73747_c1 | 3300050493 | Bacteria | 1994 |
| 572 | nmdc:mga06z11_157852_c1 | 3300050494 | Bacteria | 1294 |
| 573 | nmdc:mga07m45_110669_c1 | 3300050496 | Bacteria | 1582 |
| 574 | nmdc:mga07m45_13783_c1 | 3300050496 | Bacteria | 4294 |
| 575 | nmdc:mga07m45_28985_c1 | 3300050496 | Bacteria | 3058 |
| 576 | nmdc:mga0sz30_26342_c1 | 3300050516 | Bacteria | 2383 |
| 577 | nmdc:mga0sz30_55858_c1 | 3300050516 | Bacteria | 1681 |
| 578 | nmdc:mga0sz30_83571_c1 | 3300050516 | Bacteria | 1383 |
| 579 | Ga0500651_0000267 | 3300053093 | Bacteria | 30991 |
| 580 | Ga0500593_000228 | 3300053117 | Bacteria | 23190 |
| 581 | Ga0500607_001572 | 3300053121 | Bacteria | 20173 |
| 582 | Ga0500608_048380 | 3300053122 | Bacteria | 2043 |
| 583 | Ga0500658_0000239 | 3300053134 | Bacteria | 25725 |
| 584 | Ga0500658_0000484 | 3300053134 | Bacteria | 17027 |
| 585 | Ga0500559_0012276 | 3300053136 | Bacteria | 3644 |
| 586 | Ga0500590_051358 | 3300053148 | Bacteria | 2094 |
| 587 | Ga0500627_0040034 | 3300053158 | Bacteria | 2009 |
| 588 | Ga0500645_000574 | 3300053730 | Bacteria | 23829 |
| 589 | Ga0590075_016087 | 3300059424 | Bacteria | 1839 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10053794 | Ga0075366_100537943 | 239 |
| 2 | 3300005338 | Ga0068868_100565144 | Ga0068868_1005651441 | 240 |
| 3 | 3300005355 | Ga0070671_100025509 | Ga0070671_1000255093 | 240 |
| 4 | 3300005548 | Ga0070665_100085161 | Ga0070665_1000851612 | 240 |
| 5 | 3300005617 | Ga0068859_100044987 | Ga0068859_1000449873 | 240 |
| 6 | 3300005841 | Ga0068863_100034397 | Ga0068863_1000343974 | 240 |
| 7 | 3300005843 | Ga0068860_100080422 | Ga0068860_1000804222 | 240 |
| 8 | 3300006931 | Ga0097620_100044987 | Ga0097620_1000449873 | 240 |
| 9 | 3300009098 | Ga0105245_10418446 | Ga0105245_104184462 | 240 |
| 10 | 3300009101 | Ga0105247_10124116 | Ga0105247_101241162 | 240 |
| 11 | 3300013297 | Ga0157378_10271907 | Ga0157378_102719072 | 240 |
| 12 | 3300025900 | Ga0207710_10101190 | Ga0207710_101011902 | 240 |
| 13 | 3300025925 | Ga0207650_10160955 | Ga0207650_101609552 | 240 |
| 14 | 3300025927 | Ga0207687_10120309 | Ga0207687_101203092 | 240 |
| 15 | 3300025931 | Ga0207644_10038729 | Ga0207644_100387292 | 240 |
| 16 | 3300026023 | Ga0207677_10383172 | Ga0207677_103831722 | 240 |
| 17 | 3300026088 | Ga0207641_10008372 | Ga0207641_100083722 | 240 |
| 18 | 3300028379 | Ga0268266_10026800 | Ga0268266_100268003 | 240 |
| 19 | 3300028381 | Ga0268264_10051817 | Ga0268264_100518172 | 240 |
| 20 | 3300031911 | Ga0307412_10247479 | Ga0307412_102474792 | 240 |
| 21 | 3300031507 | Ga0307509_10249323 | Ga0307509_102493232 | 241 |
| 22 | 3300005618 | Ga0068864_100032354 | Ga0068864_1000323543 | 242 |
| 23 | 3300026095 | Ga0207676_10132659 | Ga0207676_101326592 | 242 |
| 24 | 3300005347 | Ga0070668_100249499 | Ga0070668_1002494992 | 244 |
| 25 | 3300005353 | Ga0070669_100148324 | Ga0070669_1001483242 | 244 |
| 26 | 3300025923 | Ga0207681_10176916 | Ga0207681_101769161 | 244 |
| 27 | 3300005618 | Ga0068864_100104975 | Ga0068864_1001049752 | 246 |
| 28 | 3300005841 | Ga0068863_100414650 | Ga0068863_1004146502 | 246 |
| 29 | 3300026095 | Ga0207676_10033357 | Ga0207676_100333575 | 246 |
| 30 | 3300031730 | Ga0307516_10036692 | Ga0307516_100366923 | 246 |
| 31 | 3300014969 | Ga0157376_10175324 | Ga0157376_101753244 | 247 |
| 32 | 3300006058 | Ga0075432_10033726 | Ga0075432_100337262 | 248 |
| 33 | 3300028786 | Ga0307517_10139084 | Ga0307517_101390842 | 251 |
| 34 | 3300049571 | Ga0501034_0313959 | Ga0501034_0313959_380_1153 | 251 |
| 35 | 3300025960 | Ga0207651_10298052 | Ga0207651_102980522 | 252 |
| 36 | 3300046557 | Ga0495622_0141931 | Ga0495622_0141931_11_769 | 252 |
| 37 | 3300009148 | Ga0105243_10122609 | Ga0105243_101226092 | 255 |
| 38 | 3300027682 | Ga0209971_1000744 | Ga0209971_10007447 | 255 |
| 39 | 3300046542 | Ga0495597_0000721 | Ga0495597_0000721_8068_8835 | 255 |
| 40 | iso_pu_bacteria | 2511231002 | 2511243615 | 255 |
| 41 | iso_pu_bacteria | 2513020051 | 2513226969 | 255 |
| 42 | iso_pu_bacteria | 2513020051 | 2513228363 | 255 |
| 43 | iso_pu_bacteria | 2547132374 | 2548497803 | 255 |
| 44 | iso_pu_bacteria | 2599185214 | 2599626235 | 255 |
| 45 | iso_pu_bacteria | 2599185226 | 2599675874 | 255 |
| 46 | iso_pu_bacteria | 2599185227 | 2599682242 | 255 |
| 47 | iso_pu_bacteria | 2599185229 | 2599695893 | 255 |
| 48 | iso_pu_bacteria | 2643221570 | 2643867247 | 255 |
| 49 | iso_pu_bacteria | 2643221596 | 2643990165 | 255 |
| 50 | iso_pu_bacteria | 2643221609 | 2644059297 | 255 |
| 51 | iso_pu_bacteria | 2643221611 | 2644075664 | 255 |
| 52 | iso_pu_bacteria | 2643221628 | 2644164051 | 255 |
| 53 | iso_pu_bacteria | 2643221644 | 2644243975 | 255 |
| 54 | iso_pu_bacteria | 2643221652 | 2644295655 | 255 |
| 55 | iso_pu_bacteria | 2643221654 | 2644302939 | 255 |
| 56 | iso_pu_bacteria | 2643221672 | 2644399911 | 255 |
| 57 | iso_pu_bacteria | 2643221683 | 2644466759 | 255 |
| 58 | iso_pu_bacteria | 2643221717 | 2644645194 | 255 |
| 59 | iso_pu_bacteria | 2721755523 | 2722885628 | 255 |
| 60 | iso_pu_bacteria | 2738541277 | 2738721468 | 255 |
| 61 | iso_pu_bacteria | 2738541307 | 2738880826 | 255 |
| 62 | iso_pu_bacteria | 2738543012 | 2739240792 | 255 |
| 63 | iso_pu_bacteria | 2738543013 | 2739249674 | 255 |
| 64 | iso_pu_bacteria | 2738543019 | 2739281137 | 255 |
| 65 | iso_pu_bacteria | 2816332133 | 2816472130 | 255 |
| 66 | iso_pu_bacteria | 2818991446 | 2819601505 | 255 |
| 67 | iso_pu_bacteria | 2831265667 | 2831272228 | 255 |
| 68 | iso_pu_bacteria | 2838054893 | 2838059392 | 255 |
| 69 | iso_pu_bacteria | 2839138175 | 2839141700 | 255 |
| 70 | iso_pu_bacteria | 2842677519 | 2842678659 | 255 |
| 71 | iso_pu_bacteria | 2842718218 | 2842718407 | 255 |
| 72 | iso_pu_bacteria | 2842733646 | 2842733922 | 255 |
| 73 | iso_pu_bacteria | 2842747753 | 2842752686 | 255 |
| 74 | iso_pu_bacteria | 2881101125 | 2881104960 | 255 |
| 75 | iso_pu_bacteria | 2885192300 | 2885193184 | 255 |
| 76 | iso_pu_bacteria | 2885198086 | 2885202866 | 255 |
| 77 | iso_pu_bacteria | 2885211737 | 2885216737 | 255 |
| 78 | iso_pu_bacteria | 2899924645 | 2899930950 | 255 |
| 79 | iso_pu_bacteria | 2904449895 | 2904452738 | 255 |
| 80 | iso_pu_bacteria | 2904456579 | 2904460234 | 255 |
| 81 | iso_pu_bacteria | 2904541872 | 2904547145 | 255 |
| 82 | iso_pu_bacteria | 2919462493 | 2919463644 | 255 |
| 83 | iso_pu_bacteria | 2928037797 | 2928040815 | 255 |
| 84 | iso_pu_bacteria | 2928044640 | 2928047657 | 255 |
| 85 | iso_pu_bacteria | 2928051484 | 2928055438 | 255 |
| 86 | iso_pu_bacteria | 2928064002 | 2928069543 | 255 |
| 87 | iso_pu_bacteria | 2928070936 | 2928075514 | 255 |
| 88 | iso_pu_bacteria | 2928084124 | 2928089443 | 255 |
| 89 | iso_pu_bacteria | 2928115317 | 2928117941 | 255 |
| 90 | iso_pu_bacteria | 2929160207 | 2929165699 | 255 |
| 91 | iso_pu_bacteria | 2929520902 | 2929525700 | 255 |
| 92 | iso_pu_bacteria | 2945909444 | 2945909647 | 255 |
| 93 | iso_pu_bacteria | 2945945610 | 2945945734 | 255 |
| 94 | iso_pu_bacteria | 2945972063 | 2945975388 | 255 |
| 95 | iso_pu_bacteria | 2945984333 | 2945988379 | 255 |
| 96 | iso_pu_bacteria | 2954767861 | 2954769165 | 255 |
| 97 | iso_pu_bacteria | 2974320154 | 2974320629 | 255 |
| 98 | iso_pu_bacteria | 2990710928 | 2990711115 | 255 |
| 99 | 3300005937 | Ga0081455_10153923 | Ga0081455_101539232 | 256 |
| 100 | 3300025903 | Ga0207680_10353356 | Ga0207680_103533562 | 256 |
| 101 | 3300041997 | Ga0439431_0042692 | Ga0439431_0042692_163_936 | 257 |
| 102 | 3300042156 | Ga0439446_0052999 | Ga0439446_0052999_384_1157 | 257 |
| 103 | 3300050489 | nmdc:mga03683_17684_c1 | nmdc:mga03683_17684_c1_587_1597 | 257 |
| 104 | 3300005841 | Ga0068863_100541600 | Ga0068863_1005416002 | 258 |
| 105 | 3300005843 | Ga0068860_100258559 | Ga0068860_1002585592 | 258 |
| 106 | 3300005844 | Ga0068862_100199483 | Ga0068862_1001994832 | 258 |
| 107 | 3300025907 | Ga0207645_10162906 | Ga0207645_101629063 | 258 |
| 108 | 3300025942 | Ga0207689_10391223 | Ga0207689_103912232 | 258 |
| 109 | 3300025972 | Ga0207668_10058976 | Ga0207668_100589762 | 258 |
| 110 | 3300026095 | Ga0207676_10324649 | Ga0207676_103246492 | 258 |
| 111 | 3300026118 | Ga0207675_100032073 | Ga0207675_1000320733 | 258 |
| 112 | 3300027614 | Ga0209970_1000026 | Ga0209970_100002611 | 258 |
| 113 | 3300027876 | Ga0209974_10010577 | Ga0209974_100105773 | 258 |
| 114 | 3300028380 | Ga0268265_10352528 | Ga0268265_103525282 | 258 |
| 115 | 3300031456 | Ga0307513_10000008 | Ga0307513_10000008261 | 258 |
| 116 | 3300042461 | Ga0439460_0063482 | Ga0439460_0063482_146_922 | 258 |
| 117 | 3300042876 | Ga0451577_0000340 | Ga0451577_0000340_40651_41427 | 258 |
| 118 | 3300044712 | Ga0453684_0000793 | Ga0453684_0000793_66860_67636 | 258 |
| 119 | 3300045051 | Ga0451576_0023961 | Ga0451576_0023961_980_1756 | 258 |
| 120 | 3300048906 | Ga0496103_0159333 | Ga0496103_0159333_470_1348 | 258 |
| 121 | iso_pu_bacteria | 2919704043 | 2919706261 | 258 |
| 122 | 3300001989 | JGI24739J22299_10052958 | JGI24739J22299_100529582 | 259 |
| 123 | 3300002704 | JGI25155J39150_1000029 | JGI25155J39150_100002914 | 259 |
| 124 | 3300002705 | JGI25156J39149_1000272 | JGI25156J39149_100027214 | 259 |
| 125 | 3300002738 | JGI25154J39366_1000053 | JGI25154J39366_100005395 | 259 |
| 126 | 3300002741 | JGI25157J39369_1000046 | JGI25157J39369_100004614 | 259 |
| 127 | 3300002774 | JGI25150J39212_1004866 | JGI25150J39212_10048662 | 259 |
| 128 | 3300002774 | JGI25150J39212_1011896 | JGI25150J39212_10118962 | 259 |
| 129 | 3300002774 | JGI25150J39212_1015851 | JGI25150J39212_10158512 | 259 |
| 130 | 3300002987 | JGI25159J45721_1005232 | JGI25159J45721_10052323 | 259 |
| 131 | 3300002987 | JGI25159J45721_1014942 | JGI25159J45721_10149422 | 259 |
| 132 | 3300003187 | JGI25151J46595_10001446 | JGI25151J46595_1000144611 | 259 |
| 133 | 3300003187 | JGI25151J46595_10003511 | JGI25151J46595_100035117 | 259 |
| 134 | 3300003187 | JGI25151J46595_10008613 | JGI25151J46595_100086131 | 259 |
| 135 | 3300003187 | JGI25151J46595_10011783 | JGI25151J46595_100117833 | 259 |
| 136 | 3300003215 | JGI25153J46596_10002887 | JGI25153J46596_100028878 | 259 |
| 137 | 3300003215 | JGI25153J46596_10026617 | JGI25153J46596_100266172 | 259 |
| 138 | 3300003354 | JGI25160J50197_1008376 | JGI25160J50197_10083763 | 259 |
| 139 | 3300003354 | JGI25160J50197_1010335 | JGI25160J50197_10103353 | 259 |
| 140 | 3300003354 | JGI25160J50197_1030576 | JGI25160J50197_10305762 | 259 |
| 141 | 3300003374 | JGI25161J50226_1000046 | JGI25161J50226_1000046105 | 259 |
| 142 | 3300003374 | JGI25161J50226_1004960 | JGI25161J50226_10049602 | 259 |
| 143 | 3300003578 | Ga0006562J51391_1044074 | Ga0006562J51391_10440742 | 259 |
| 144 | 3300003578 | Ga0006562J51391_1045467 | Ga0006562J51391_10454674 | 259 |
| 145 | 3300003578 | Ga0006562J51391_1045469 | Ga0006562J51391_10454694 | 259 |
| 146 | 3300003761 | Ga0055535_1000289 | Ga0055535_100028932 | 259 |
| 147 | 3300003762 | Ga0055542_1000036 | Ga0055542_1000036121 | 259 |
| 148 | 3300003771 | Ga0055526_1004155 | Ga0055526_10041557 | 259 |
| 149 | 3300003771 | Ga0055526_1005732 | Ga0055526_10057323 | 259 |
| 150 | 3300003773 | Ga0055537_1000623 | Ga0055537_100062310 | 259 |
| 151 | 3300003775 | Ga0055524_1000044 | Ga0055524_100004482 | 259 |
| 152 | 3300003775 | Ga0055524_1000469 | Ga0055524_100046923 | 259 |
| 153 | 3300003775 | Ga0055524_1022088 | Ga0055524_10220881 | 259 |
| 154 | 3300003781 | Ga0055536_1014715 | Ga0055536_10147151 | 259 |
| 155 | 3300003784 | Ga0055534_1000397 | Ga0055534_100039716 | 259 |
| 156 | 3300003790 | Ga0055528_1008275 | Ga0055528_10082753 | 259 |
| 157 | 3300003791 | Ga0055530_10000630 | Ga0055530_1000063022 | 259 |
| 158 | 3300003791 | Ga0055530_10003088 | Ga0055530_100030882 | 259 |
| 159 | 3300003792 | Ga0055540_1000063 | Ga0055540_100006392 | 259 |
| 160 | 3300003792 | Ga0055540_1000173 | Ga0055540_10001738 | 259 |
| 161 | 3300003792 | Ga0055540_1007713 | Ga0055540_10077134 | 259 |
| 162 | 3300003794 | Ga0055531_10000276 | Ga0055531_1000027640 | 259 |
| 163 | 3300003794 | Ga0055531_10014054 | Ga0055531_100140545 | 259 |
| 164 | 3300004625 | Ga0055543_1001803 | Ga0055543_10018033 | 259 |
| 165 | 3300004625 | Ga0055543_1002615 | Ga0055543_10026153 | 259 |
| 166 | 3300005262 | Ga0065165_1056801 | Ga0065165_10568012 | 259 |
| 167 | 3300005289 | Ga0065704_10196713 | Ga0065704_101967131 | 259 |
| 168 | 3300005289 | Ga0065704_10220127 | Ga0065704_102201271 | 259 |
| 169 | 3300005295 | Ga0065707_10152043 | Ga0065707_101520431 | 259 |
| 170 | 3300005327 | Ga0070658_10079968 | Ga0070658_100799683 | 259 |
| 171 | 3300005327 | Ga0070658_10180959 | Ga0070658_101809592 | 259 |
| 172 | 3300005327 | Ga0070658_10209465 | Ga0070658_102094652 | 259 |
| 173 | 3300005331 | Ga0070670_100091617 | Ga0070670_1000916171 | 259 |
| 174 | 3300005344 | Ga0070661_100001470 | Ga0070661_10000147010 | 259 |
| 175 | 3300005347 | Ga0070668_100463328 | Ga0070668_1004633282 | 259 |
| 176 | 3300005353 | Ga0070669_100081971 | Ga0070669_1000819712 | 259 |
| 177 | 3300005353 | Ga0070669_100164412 | Ga0070669_1001644122 | 259 |
| 178 | 3300005354 | Ga0070675_100024440 | Ga0070675_1000244402 | 259 |
| 179 | 3300005355 | Ga0070671_100047940 | Ga0070671_1000479402 | 259 |
| 180 | 3300005364 | Ga0070673_100020985 | Ga0070673_1000209854 | 259 |
| 181 | 3300005366 | Ga0070659_100001712 | Ga0070659_1000017129 | 259 |
| 182 | 3300005366 | Ga0070659_100089034 | Ga0070659_1000890343 | 259 |
| 183 | 3300005367 | Ga0070667_100015275 | Ga0070667_1000152755 | 259 |
| 184 | 3300005445 | Ga0070708_100111340 | Ga0070708_1001113402 | 259 |
| 185 | 3300005455 | Ga0070663_100091088 | Ga0070663_1000910882 | 259 |
| 186 | 3300005456 | Ga0070678_100228320 | Ga0070678_1002283201 | 259 |
| 187 | 3300005457 | Ga0070662_100040739 | Ga0070662_1000407394 | 259 |
| 188 | 3300005459 | Ga0068867_100069959 | Ga0068867_1000699592 | 259 |
| 189 | 3300005459 | Ga0068867_100149273 | Ga0068867_1001492732 | 259 |
| 190 | 3300005466 | Ga0070685_10407842 | Ga0070685_104078421 | 259 |
| 191 | 3300005467 | Ga0070706_100003421 | Ga0070706_10000342115 | 259 |
| 192 | 3300005539 | Ga0068853_100012883 | Ga0068853_1000128834 | 259 |
| 193 | 3300005539 | Ga0068853_100224713 | Ga0068853_1002247132 | 259 |
| 194 | 3300005543 | Ga0070672_100039085 | Ga0070672_1000390853 | 259 |
| 195 | 3300005543 | Ga0070672_100165814 | Ga0070672_1001658142 | 259 |
| 196 | 3300005548 | Ga0070665_100105115 | Ga0070665_1001051152 | 259 |
| 197 | 3300005548 | Ga0070665_100345199 | Ga0070665_1003451992 | 259 |
| 198 | 3300005548 | Ga0070665_100506427 | Ga0070665_1005064271 | 259 |
| 199 | 3300005563 | Ga0068855_100022176 | Ga0068855_1000221769 | 259 |
| 200 | 3300005563 | Ga0068855_100089597 | Ga0068855_1000895973 | 259 |
| 201 | 3300005563 | Ga0068855_100116141 | Ga0068855_1001161414 | 259 |
| 202 | 3300005564 | Ga0070664_100002031 | Ga0070664_10000203110 | 259 |
| 203 | 3300005564 | Ga0070664_100013022 | Ga0070664_1000130227 | 259 |
| 204 | 3300005564 | Ga0070664_100693134 | Ga0070664_1006931341 | 259 |
| 205 | 3300005577 | Ga0068857_100064053 | Ga0068857_1000640533 | 259 |
| 206 | 3300005577 | Ga0068857_100354154 | Ga0068857_1003541542 | 259 |
| 207 | 3300005578 | Ga0068854_100124322 | Ga0068854_1001243222 | 259 |
| 208 | 3300005616 | Ga0068852_100056642 | Ga0068852_1000566424 | 259 |
| 209 | 3300005616 | Ga0068852_100242356 | Ga0068852_1002423562 | 259 |
| 210 | 3300005834 | Ga0068851_10014047 | Ga0068851_100140473 | 259 |
| 211 | 3300006038 | Ga0075365_10003479 | Ga0075365_100034792 | 259 |
| 212 | 3300006038 | Ga0075365_10076520 | Ga0075365_100765202 | 259 |
| 213 | 3300006038 | Ga0075365_10132489 | Ga0075365_101324892 | 259 |
| 214 | 3300006038 | Ga0075365_10138900 | Ga0075365_101389003 | 259 |
| 215 | 3300006042 | Ga0075368_10054797 | Ga0075368_100547972 | 259 |
| 216 | 3300006048 | Ga0075363_100082242 | Ga0075363_1000822422 | 259 |
| 217 | 3300006051 | Ga0075364_10091292 | Ga0075364_100912923 | 259 |
| 218 | 3300006177 | Ga0075362_10003327 | Ga0075362_100033274 | 259 |
| 219 | 3300006177 | Ga0075362_10015585 | Ga0075362_100155853 | 259 |
| 220 | 3300006177 | Ga0075362_10017376 | Ga0075362_100173762 | 259 |
| 221 | 3300006177 | Ga0075362_10024283 | Ga0075362_100242832 | 259 |
| 222 | 3300006177 | Ga0075362_10099598 | Ga0075362_100995982 | 259 |
| 223 | 3300006178 | Ga0075367_10028530 | Ga0075367_100285302 | 259 |
| 224 | 3300006178 | Ga0075367_10045067 | Ga0075367_100450672 | 259 |
| 225 | 3300006178 | Ga0075367_10083729 | Ga0075367_100837292 | 259 |
| 226 | 3300006195 | Ga0075366_10001341 | Ga0075366_100013414 | 259 |
| 227 | 3300006195 | Ga0075366_10007913 | Ga0075366_100079136 | 259 |
| 228 | 3300006195 | Ga0075366_10022118 | Ga0075366_100221182 | 259 |
| 229 | 3300006195 | Ga0075366_10061318 | Ga0075366_100613181 | 259 |
| 230 | 3300006195 | Ga0075366_10065134 | Ga0075366_100651342 | 259 |
| 231 | 3300006195 | Ga0075366_10102128 | Ga0075366_101021282 | 259 |
| 232 | 3300006195 | Ga0075366_10105054 | Ga0075366_101050542 | 259 |
| 233 | 3300006195 | Ga0075366_10131971 | Ga0075366_101319712 | 259 |
| 234 | 3300006237 | Ga0097621_100111445 | Ga0097621_1001114452 | 259 |
| 235 | 3300006353 | Ga0075370_10001058 | Ga0075370_100010588 | 259 |
| 236 | 3300006353 | Ga0075370_10009223 | Ga0075370_100092231 | 259 |
| 237 | 3300006353 | Ga0075370_10033362 | Ga0075370_100333621 | 259 |
| 238 | 3300006353 | Ga0075370_10161389 | Ga0075370_101613891 | 259 |
| 239 | 3300006358 | Ga0068871_100151985 | Ga0068871_1001519852 | 259 |
| 240 | 3300006946 | Ga0079104_1000037 | Ga0079104_1000037101 | 259 |
| 241 | 3300006946 | Ga0079104_1000294 | Ga0079104_10002949 | 259 |
| 242 | 3300006946 | Ga0079104_1008514 | Ga0079104_10085143 | 259 |
| 243 | 3300006946 | Ga0079104_1026331 | Ga0079104_10263312 | 259 |
| 244 | 3300009093 | Ga0105240_10001543 | Ga0105240_1000154343 | 259 |
| 245 | 3300009093 | Ga0105240_10002814 | Ga0105240_100028148 | 259 |
| 246 | 3300009093 | Ga0105240_10351882 | Ga0105240_103518821 | 259 |
| 247 | 3300009098 | Ga0105245_10182584 | Ga0105245_101825842 | 259 |
| 248 | 3300009148 | Ga0105243_10015400 | Ga0105243_100154002 | 259 |
| 249 | 3300009148 | Ga0105243_10054766 | Ga0105243_100547663 | 259 |
| 250 | 3300009174 | Ga0105241_10381380 | Ga0105241_103813802 | 259 |
| 251 | 3300009545 | Ga0105237_10002372 | Ga0105237_100023729 | 259 |
| 252 | 3300009545 | Ga0105237_10014572 | Ga0105237_100145724 | 259 |
| 253 | 3300009545 | Ga0105237_10053518 | Ga0105237_100535183 | 259 |
| 254 | 3300009551 | Ga0105238_10027529 | Ga0105238_100275293 | 259 |
| 255 | 3300009551 | Ga0105238_10508411 | Ga0105238_105084112 | 259 |
| 256 | 3300009551 | Ga0105238_10596867 | Ga0105238_105968672 | 259 |
| 257 | 3300010375 | Ga0105239_10001168 | Ga0105239_1000116820 | 259 |
| 258 | 3300010375 | Ga0105239_10016215 | Ga0105239_100162157 | 259 |
| 259 | 3300012502 | Ga0157347_1005573 | Ga0157347_10055732 | 259 |
| 260 | 3300012502 | Ga0157347_1009747 | Ga0157347_10097472 | 259 |
| 261 | 3300013100 | Ga0157373_10003982 | Ga0157373_1000398210 | 259 |
| 262 | 3300013102 | Ga0157371_10108489 | Ga0157371_101084892 | 259 |
| 263 | 3300013104 | Ga0157370_10007530 | Ga0157370_1000753013 | 259 |
| 264 | 3300013104 | Ga0157370_10374199 | Ga0157370_103741992 | 259 |
| 265 | 3300013105 | Ga0157369_10050951 | Ga0157369_100509514 | 259 |
| 266 | 3300013306 | Ga0163162_10021978 | Ga0163162_100219784 | 259 |
| 267 | 3300013307 | Ga0157372_10804912 | Ga0157372_108049121 | 259 |
| 268 | 3300013308 | Ga0157375_10192299 | Ga0157375_101922992 | 259 |
| 269 | 3300013308 | Ga0157375_10295556 | Ga0157375_102955562 | 259 |
| 270 | 3300014497 | Ga0182008_10000191 | Ga0182008_1000019110 | 259 |
| 271 | 3300014497 | Ga0182008_10003941 | Ga0182008_100039419 | 259 |
| 272 | 3300014497 | Ga0182008_10005474 | Ga0182008_100054742 | 259 |
| 273 | 3300014497 | Ga0182008_10006656 | Ga0182008_100066562 | 259 |
| 274 | 3300014497 | Ga0182008_10026178 | Ga0182008_100261783 | 259 |
| 275 | 3300014969 | Ga0157376_10708669 | Ga0157376_107086692 | 259 |
| 276 | 3300015261 | Ga0182006_1001724 | Ga0182006_100172412 | 259 |
| 277 | 3300015261 | Ga0182006_1058840 | Ga0182006_10588402 | 259 |
| 278 | 3300015262 | Ga0182007_10002842 | Ga0182007_100028425 | 259 |
| 279 | 3300015265 | Ga0182005_1025809 | Ga0182005_10258092 | 259 |
| 280 | 3300015683 | Ga0183362_10005 | Ga0183362_10005153 | 259 |
| 281 | 3300017792 | Ga0163161_10000244 | Ga0163161_1000024437 | 259 |
| 282 | 3300017792 | Ga0163161_10128426 | Ga0163161_101284262 | 259 |
| 283 | 3300017792 | Ga0163161_10131556 | Ga0163161_101315562 | 259 |
| 284 | 3300017792 | Ga0163161_10181282 | Ga0163161_101812822 | 259 |
| 285 | 3300025206 | Ga0209435_100003 | Ga0209435_100003266 | 259 |
| 286 | 3300025208 | Ga0209436_106712 | Ga0209436_1067121 | 259 |
| 287 | 3300025228 | Ga0209672_101200 | Ga0209672_1012002 | 259 |
| 288 | 3300025229 | Ga0209147_100961 | Ga0209147_1009619 | 259 |
| 289 | 3300025242 | Ga0209258_100091 | Ga0209258_100091121 | 259 |
| 290 | 3300025245 | Ga0207425_1000183 | Ga0207425_100018331 | 259 |
| 291 | 3300025245 | Ga0207425_1000933 | Ga0207425_10009338 | 259 |
| 292 | 3300025245 | Ga0207425_1009626 | Ga0207425_10096263 | 259 |
| 293 | 3300025245 | Ga0207425_1033787 | Ga0207425_10337871 | 259 |
| 294 | 3300025246 | Ga0209646_1000008 | Ga0209646_1000008266 | 259 |
| 295 | 3300025250 | Ga0209026_1000007 | Ga0209026_1000007266 | 259 |
| 296 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033363 | 259 |
| 297 | 3300025256 | Ga0209759_1000026 | Ga0209759_100002614 | 259 |
| 298 | 3300025258 | Ga0209129_1000091 | Ga0209129_100009170 | 259 |
| 299 | 3300025258 | Ga0209129_1004863 | Ga0209129_10048634 | 259 |
| 300 | 3300025263 | Ga0209565_1000020 | Ga0209565_1000020107 | 259 |
| 301 | 3300025263 | Ga0209565_1000200 | Ga0209565_100020020 | 259 |
| 302 | 3300025263 | Ga0209565_1000270 | Ga0209565_100027020 | 259 |
| 303 | 3300025263 | Ga0209565_1000507 | Ga0209565_100050713 | 259 |
| 304 | 3300025263 | Ga0209565_1001022 | Ga0209565_10010228 | 259 |
| 305 | 3300025263 | Ga0209565_1027612 | Ga0209565_10276122 | 259 |
| 306 | 3300025263 | Ga0209565_1028856 | Ga0209565_10288561 | 259 |
| 307 | 3300025273 | Ga0209673_1000009 | Ga0209673_1000009489 | 259 |
| 308 | 3300025273 | Ga0209673_1000012 | Ga0209673_1000012390 | 259 |
| 309 | 3300025273 | Ga0209673_1000072 | Ga0209673_100007293 | 259 |
| 310 | 3300025273 | Ga0209673_1000154 | Ga0209673_100015482 | 259 |
| 311 | 3300025273 | Ga0209673_1000772 | Ga0209673_100077231 | 259 |
| 312 | 3300025273 | Ga0209673_1007609 | Ga0209673_10076095 | 259 |
| 313 | 3300025284 | Ga0209130_1000064 | Ga0209130_1000064105 | 259 |
| 314 | 3300025284 | Ga0209130_1000140 | Ga0209130_100014022 | 259 |
| 315 | 3300025284 | Ga0209130_1000203 | Ga0209130_100020327 | 259 |
| 316 | 3300025284 | Ga0209130_1000225 | Ga0209130_100022550 | 259 |
| 317 | 3300025291 | Ga0209675_1000014 | Ga0209675_100001495 | 259 |
| 318 | 3300025291 | Ga0209675_1000144 | Ga0209675_100014454 | 259 |
| 319 | 3300025291 | Ga0209675_1000447 | Ga0209675_100044711 | 259 |
| 320 | 3300025291 | Ga0209675_1001399 | Ga0209675_100139910 | 259 |
| 321 | 3300025292 | Ga0209676_1000051 | Ga0209676_1000051254 | 259 |
| 322 | 3300025292 | Ga0209676_1000088 | Ga0209676_100008867 | 259 |
| 323 | 3300025292 | Ga0209676_1000267 | Ga0209676_100026790 | 259 |
| 324 | 3300025292 | Ga0209676_1000966 | Ga0209676_100096623 | 259 |
| 325 | 3300025292 | Ga0209676_1002156 | Ga0209676_100215614 | 259 |
| 326 | 3300025292 | Ga0209676_1009167 | Ga0209676_10091674 | 259 |
| 327 | 3300025294 | Ga0209025_1000207 | Ga0209025_100020726 | 259 |
| 328 | 3300025294 | Ga0209025_1000356 | Ga0209025_100035624 | 259 |
| 329 | 3300025294 | Ga0209025_1001327 | Ga0209025_100132712 | 259 |
| 330 | 3300025294 | Ga0209025_1001509 | Ga0209025_10015097 | 259 |
| 331 | 3300025294 | Ga0209025_1007756 | Ga0209025_10077563 | 259 |
| 332 | 3300025294 | Ga0209025_1008400 | Ga0209025_10084007 | 259 |
| 333 | 3300025294 | Ga0209025_1013276 | Ga0209025_10132763 | 259 |
| 334 | 3300025295 | Ga0209564_1000103 | Ga0209564_100010388 | 259 |
| 335 | 3300025295 | Ga0209564_1000530 | Ga0209564_100053053 | 259 |
| 336 | 3300025295 | Ga0209564_1000797 | Ga0209564_100079716 | 259 |
| 337 | 3300025295 | Ga0209564_1000945 | Ga0209564_100094516 | 259 |
| 338 | 3300025295 | Ga0209564_1001673 | Ga0209564_100167314 | 259 |
| 339 | 3300025297 | Ga0209758_1000092 | Ga0209758_100009278 | 259 |
| 340 | 3300025297 | Ga0209758_1000327 | Ga0209758_100032726 | 259 |
| 341 | 3300025297 | Ga0209758_1010345 | Ga0209758_10103456 | 259 |
| 342 | 3300025297 | Ga0209758_1010394 | Ga0209758_10103945 | 259 |
| 343 | 3300025297 | Ga0209758_1015192 | Ga0209758_10151925 | 259 |
| 344 | 3300025298 | Ga0209050_1000044 | Ga0209050_100004492 | 259 |
| 345 | 3300025298 | Ga0209050_1000110 | Ga0209050_1000110176 | 259 |
| 346 | 3300025298 | Ga0209050_1000916 | Ga0209050_100091627 | 259 |
| 347 | 3300025298 | Ga0209050_1000983 | Ga0209050_100098325 | 259 |
| 348 | 3300025298 | Ga0209050_1005037 | Ga0209050_10050379 | 259 |
| 349 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003644 | 259 |
| 350 | 3300025299 | Ga0209256_1000036 | Ga0209256_1000036353 | 259 |
| 351 | 3300025299 | Ga0209256_1000065 | Ga0209256_100006558 | 259 |
| 352 | 3300025299 | Ga0209256_1000094 | Ga0209256_100009448 | 259 |
| 353 | 3300025302 | Ga0207426_1000084 | Ga0207426_1000084181 | 259 |
| 354 | 3300025302 | Ga0207426_1000116 | Ga0207426_100011682 | 259 |
| 355 | 3300025302 | Ga0207426_1000124 | Ga0207426_100012431 | 259 |
| 356 | 3300025302 | Ga0207426_1001529 | Ga0207426_100152911 | 259 |
| 357 | 3300025303 | Ga0209051_1000031 | Ga0209051_100003192 | 259 |
| 358 | 3300025303 | Ga0209051_1000069 | Ga0209051_1000069135 | 259 |
| 359 | 3300025303 | Ga0209051_1000114 | Ga0209051_100011487 | 259 |
| 360 | 3300025303 | Ga0209051_1000230 | Ga0209051_10002303 | 259 |
| 361 | 3300025303 | Ga0209051_1000379 | Ga0209051_100037946 | 259 |
| 362 | 3300025303 | Ga0209051_1000685 | Ga0209051_100068523 | 259 |
| 363 | 3300025303 | Ga0209051_1001139 | Ga0209051_100113919 | 259 |
| 364 | 3300025303 | Ga0209051_1001228 | Ga0209051_100122811 | 259 |
| 365 | 3300025303 | Ga0209051_1002160 | Ga0209051_100216014 | 259 |
| 366 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015714 | 259 |
| 367 | 3300025304 | Ga0209257_1000058 | Ga0209257_100005886 | 259 |
| 368 | 3300025304 | Ga0209257_1000093 | Ga0209257_1000093177 | 259 |
| 369 | 3300025304 | Ga0209257_1000141 | Ga0209257_1000141140 | 259 |
| 370 | 3300025304 | Ga0209257_1000575 | Ga0209257_100057543 | 259 |
| 371 | 3300025321 | Ga0207656_10007635 | Ga0207656_100076353 | 259 |
| 372 | 3300025728 | Ga0207655_1001961 | Ga0207655_100196117 | 259 |
| 373 | 3300025899 | Ga0207642_10169774 | Ga0207642_101697741 | 259 |
| 374 | 3300025907 | Ga0207645_10265362 | Ga0207645_102653621 | 259 |
| 375 | 3300025909 | Ga0207705_10352441 | Ga0207705_103524411 | 259 |
| 376 | 3300025909 | Ga0207705_10400712 | Ga0207705_104007121 | 259 |
| 377 | 3300025910 | Ga0207684_10053942 | Ga0207684_100539422 | 259 |
| 378 | 3300025911 | Ga0207654_10291750 | Ga0207654_102917502 | 259 |
| 379 | 3300025913 | Ga0207695_10005159 | Ga0207695_100051599 | 259 |
| 380 | 3300025913 | Ga0207695_10068733 | Ga0207695_100687334 | 259 |
| 381 | 3300025913 | Ga0207695_10163527 | Ga0207695_101635272 | 259 |
| 382 | 3300025913 | Ga0207695_10256385 | Ga0207695_102563851 | 259 |
| 383 | 3300025914 | Ga0207671_10013375 | Ga0207671_100133753 | 259 |
| 384 | 3300025914 | Ga0207671_10044087 | Ga0207671_100440873 | 259 |
| 385 | 3300025914 | Ga0207671_10252773 | Ga0207671_102527732 | 259 |
| 386 | 3300025919 | Ga0207657_10031330 | Ga0207657_100313304 | 259 |
| 387 | 3300025919 | Ga0207657_10186173 | Ga0207657_101861731 | 259 |
| 388 | 3300025920 | Ga0207649_10010410 | Ga0207649_100104103 | 259 |
| 389 | 3300025920 | Ga0207649_10136167 | Ga0207649_101361671 | 259 |
| 390 | 3300025921 | Ga0207652_10382497 | Ga0207652_103824972 | 259 |
| 391 | 3300025923 | Ga0207681_10002439 | Ga0207681_1000243912 | 259 |
| 392 | 3300025923 | Ga0207681_10170720 | Ga0207681_101707201 | 259 |
| 393 | 3300025924 | Ga0207694_10042635 | Ga0207694_100426352 | 259 |
| 394 | 3300025931 | Ga0207644_10186148 | Ga0207644_101861481 | 259 |
| 395 | 3300025932 | Ga0207690_10002101 | Ga0207690_100021017 | 259 |
| 396 | 3300025932 | Ga0207690_10022892 | Ga0207690_100228923 | 259 |
| 397 | 3300025933 | Ga0207706_10042818 | Ga0207706_100428184 | 259 |
| 398 | 3300025934 | Ga0207686_10011859 | Ga0207686_100118595 | 259 |
| 399 | 3300025935 | Ga0207709_10000076 | Ga0207709_10000076132 | 259 |
| 400 | 3300025935 | Ga0207709_10000472 | Ga0207709_1000047223 | 259 |
| 401 | 3300025935 | Ga0207709_10002379 | Ga0207709_1000237910 | 259 |
| 402 | 3300025935 | Ga0207709_10042383 | Ga0207709_100423833 | 259 |
| 403 | 3300025940 | Ga0207691_10015393 | Ga0207691_100153935 | 259 |
| 404 | 3300025940 | Ga0207691_10223290 | Ga0207691_102232901 | 259 |
| 405 | 3300025942 | Ga0207689_10137037 | Ga0207689_101370372 | 259 |
| 406 | 3300025942 | Ga0207689_10347778 | Ga0207689_103477782 | 259 |
| 407 | 3300025945 | Ga0207679_10000088 | Ga0207679_100000887 | 259 |
| 408 | 3300025945 | Ga0207679_10027321 | Ga0207679_100273212 | 259 |
| 409 | 3300025949 | Ga0207667_10039365 | Ga0207667_100393656 | 259 |
| 410 | 3300025949 | Ga0207667_10117417 | Ga0207667_101174173 | 259 |
| 411 | 3300025960 | Ga0207651_10013397 | Ga0207651_100133973 | 259 |
| 412 | 3300025960 | Ga0207651_10266560 | Ga0207651_102665602 | 259 |
| 413 | 3300025981 | Ga0207640_10320841 | Ga0207640_103208411 | 259 |
| 414 | 3300026023 | Ga0207677_10010744 | Ga0207677_100107444 | 259 |
| 415 | 3300026023 | Ga0207677_10014817 | Ga0207677_100148174 | 259 |
| 416 | 3300026041 | Ga0207639_10019378 | Ga0207639_100193784 | 259 |
| 417 | 3300026041 | Ga0207639_10139927 | Ga0207639_101399272 | 259 |
| 418 | 3300026067 | Ga0207678_10026992 | Ga0207678_100269924 | 259 |
| 419 | 3300026088 | Ga0207641_10523579 | Ga0207641_105235791 | 259 |
| 420 | 3300026089 | Ga0207648_10013164 | Ga0207648_100131644 | 259 |
| 421 | 3300026089 | Ga0207648_10065424 | Ga0207648_100654242 | 259 |
| 422 | 3300026089 | Ga0207648_10502337 | Ga0207648_105023372 | 259 |
| 423 | 3300026116 | Ga0207674_10016085 | Ga0207674_100160857 | 259 |
| 424 | 3300026116 | Ga0207674_10034413 | Ga0207674_100344134 | 259 |
| 425 | 3300026116 | Ga0207674_10362917 | Ga0207674_103629172 | 259 |
| 426 | 3300026116 | Ga0207674_10402966 | Ga0207674_104029661 | 259 |
| 427 | 3300026116 | Ga0207674_10434698 | Ga0207674_104346982 | 259 |
| 428 | 3300026118 | Ga0207675_100384680 | Ga0207675_1003846802 | 259 |
| 429 | 3300026121 | Ga0207683_10031829 | Ga0207683_100318297 | 259 |
| 430 | 3300026121 | Ga0207683_10276400 | Ga0207683_102764003 | 259 |
| 431 | 3300026142 | Ga0207698_10044076 | Ga0207698_100440764 | 259 |
| 432 | 3300027111 | Ga0209281_1000002 | Ga0209281_1000002883 | 259 |
| 433 | 3300027111 | Ga0209281_1000423 | Ga0209281_100042345 | 259 |
| 434 | 3300027111 | Ga0209281_1019020 | Ga0209281_10190202 | 259 |
| 435 | 3300027666 | Ga0209282_1000298 | Ga0209282_100029825 | 259 |
| 436 | 3300027876 | Ga0209974_10005128 | Ga0209974_100051283 | 259 |
| 437 | 3300027876 | Ga0209974_10016653 | Ga0209974_100166532 | 259 |
| 438 | 3300028379 | Ga0268266_10006260 | Ga0268266_1000626014 | 259 |
| 439 | 3300028379 | Ga0268266_10345295 | Ga0268266_103452952 | 259 |
| 440 | 3300028380 | Ga0268265_10174867 | Ga0268265_101748672 | 259 |
| 441 | 3300028794 | Ga0307515_10000419 | Ga0307515_1000041934 | 259 |
| 442 | 3300028794 | Ga0307515_10003462 | Ga0307515_1000346224 | 259 |
| 443 | 3300028794 | Ga0307515_10007779 | Ga0307515_1000777910 | 259 |
| 444 | 3300028794 | Ga0307515_10048555 | Ga0307515_100485552 | 259 |
| 445 | 3300028794 | Ga0307515_10149053 | Ga0307515_101490532 | 259 |
| 446 | 3300028794 | Ga0307515_10160465 | Ga0307515_101604652 | 259 |
| 447 | 3300028794 | Ga0307515_10196436 | Ga0307515_101964363 | 259 |
| 448 | 3300030522 | Ga0307512_10061877 | Ga0307512_100618771 | 259 |
| 449 | 3300030732 | Ga0316176_1093739 | Ga0316176_10937392 | 259 |
| 450 | 3300030733 | Ga0314311_1200241 | Ga0314311_12002412 | 259 |
| 451 | 3300030734 | Ga0316179_1078761 | Ga0316179_10787613 | 259 |
| 452 | 3300030742 | Ga0316183_1110470 | Ga0316183_11104703 | 259 |
| 453 | 3300031235 | Ga0265330_10000044 | Ga0265330_1000004424 | 259 |
| 454 | 3300031235 | Ga0265330_10037185 | Ga0265330_100371852 | 259 |
| 455 | 3300031238 | Ga0265332_10000046 | Ga0265332_1000004672 | 259 |
| 456 | 3300031238 | Ga0265332_10003009 | Ga0265332_100030096 | 259 |
| 457 | 3300031241 | Ga0265325_10013967 | Ga0265325_100139673 | 259 |
| 458 | 3300031247 | Ga0265340_10006278 | Ga0265340_100062785 | 259 |
| 459 | 3300031251 | Ga0265327_10000945 | Ga0265327_100009453 | 259 |
| 460 | 3300031251 | Ga0265327_10005555 | Ga0265327_1000555511 | 259 |
| 461 | 3300031344 | Ga0265316_10056195 | Ga0265316_100561954 | 259 |
| 462 | 3300031456 | Ga0307513_10000316 | Ga0307513_1000031617 | 259 |
| 463 | 3300031456 | Ga0307513_10029422 | Ga0307513_100294227 | 259 |
| 464 | 3300031456 | Ga0307513_10189360 | Ga0307513_101893602 | 259 |
| 465 | 3300031456 | Ga0307513_10350444 | Ga0307513_103504441 | 259 |
| 466 | 3300031456 | Ga0307513_10440379 | Ga0307513_104403791 | 259 |
| 467 | 3300031507 | Ga0307509_10000904 | Ga0307509_100009049 | 259 |
| 468 | 3300031507 | Ga0307509_10011898 | Ga0307509_100118987 | 259 |
| 469 | 3300031507 | Ga0307509_10154799 | Ga0307509_101547992 | 259 |
| 470 | 3300031548 | Ga0307408_100000229 | Ga0307408_10000022941 | 259 |
| 471 | 3300031548 | Ga0307408_100052417 | Ga0307408_1000524172 | 259 |
| 472 | 3300031548 | Ga0307408_100066336 | Ga0307408_1000663362 | 259 |
| 473 | 3300031548 | Ga0307408_100196146 | Ga0307408_1001961462 | 259 |
| 474 | 3300031548 | Ga0307408_100257436 | Ga0307408_1002574362 | 259 |
| 475 | 3300031548 | Ga0307408_100327357 | Ga0307408_1003273572 | 259 |
| 476 | 3300031548 | Ga0307408_100547679 | Ga0307408_1005476791 | 259 |
| 477 | 3300031649 | Ga0307514_10001645 | Ga0307514_100016457 | 259 |
| 478 | 3300031649 | Ga0307514_10005374 | Ga0307514_1000537414 | 259 |
| 479 | 3300031649 | Ga0307514_10017019 | Ga0307514_100170192 | 259 |
| 480 | 3300031711 | Ga0265314_10000130 | Ga0265314_1000013024 | 259 |
| 481 | 3300031711 | Ga0265314_10008127 | Ga0265314_100081278 | 259 |
| 482 | 3300031712 | Ga0265342_10027415 | Ga0265342_100274152 | 259 |
| 483 | 3300031730 | Ga0307516_10005347 | Ga0307516_1000534711 | 259 |
| 484 | 3300031730 | Ga0307516_10412981 | Ga0307516_104129811 | 259 |
| 485 | 3300031731 | Ga0307405_10071808 | Ga0307405_100718082 | 259 |
| 486 | 3300031731 | Ga0307405_10332780 | Ga0307405_103327802 | 259 |
| 487 | 3300031824 | Ga0307413_10056778 | Ga0307413_100567781 | 259 |
| 488 | 3300031901 | Ga0307406_10000319 | Ga0307406_1000031921 | 259 |
| 489 | 3300031901 | Ga0307406_10459303 | Ga0307406_104593032 | 259 |
| 490 | 3300032002 | Ga0307416_100035902 | Ga0307416_1000359023 | 259 |
| 491 | 3300032005 | Ga0307411_10088171 | Ga0307411_100881712 | 259 |
| 492 | 3300033180 | Ga0307510_10000122 | Ga0307510_1000012221 | 259 |
| 493 | 3300033180 | Ga0307510_10288971 | Ga0307510_102889712 | 259 |
| 494 | 3300035114 | Ga0373939_0048742 | Ga0373939_0048742_130_918 | 259 |
| 495 | 3300035691 | Ga0373931_0114117 | Ga0373931_0114117_372_1160 | 259 |
| 496 | 3300035724 | Ga0373933_0433548 | Ga0373933_0433548_52_831 | 259 |
| 497 | 3300037068 | Ga0373925_0013137 | Ga0373925_0013137_4016_4804 | 259 |
| 498 | 3300037312 | Ga0395899_0010475 | Ga0395899_0010475_4320_5099 | 259 |
| 499 | 3300037418 | Ga0395900_0038355 | Ga0395900_0038355_4099_4878 | 259 |
| 500 | 3300037418 | Ga0395900_0043581 | Ga0395900_0043581_896_1675 | 259 |
| 501 | 3300037466 | Ga0395898_0026798 | Ga0395898_0026798_2830_3609 | 259 |
| 502 | 3300037466 | Ga0395898_0051820 | Ga0395898_0051820_2392_3171 | 259 |
| 503 | 3300037466 | Ga0395898_0091650 | Ga0395898_0091650_103_882 | 259 |
| 504 | 3300037466 | Ga0395898_0834481 | Ga0395898_0834481_37_831 | 259 |
| 505 | 3300037471 | Ga0395905_0011798 | Ga0395905_0011798_5858_6637 | 259 |
| 506 | 3300037471 | Ga0395905_0014547 | Ga0395905_0014547_1034_1828 | 259 |
| 507 | 3300037471 | Ga0395905_0066757 | Ga0395905_0066757_1562_2341 | 259 |
| 508 | 3300037471 | Ga0395905_0081260 | Ga0395905_0081260_90_869 | 259 |
| 509 | 3300037471 | Ga0395905_0084626 | Ga0395905_0084626_1205_1984 | 259 |
| 510 | 3300037471 | Ga0395905_0177666 | Ga0395905_0177666_1084_1878 | 259 |
| 511 | 3300037471 | Ga0395905_0354791 | Ga0395905_0354791_393_1172 | 259 |
| 512 | 3300041404 | Ga0439436_0008463 | Ga0439436_0008463_1174_1953 | 259 |
| 513 | 3300041406 | Ga0439439_0010418 | Ga0439439_0010418_904_1683 | 259 |
| 514 | 3300041406 | Ga0439439_0011894 | Ga0439439_0011894_682_1461 | 259 |
| 515 | 3300041413 | Ga0439465_0004738 | Ga0439465_0004738_1005_1784 | 259 |
| 516 | 3300041512 | Ga0451853_2883190 | Ga0451853_2883190_661_1458 | 259 |
| 517 | 3300041999 | Ga0439433_0011584 | Ga0439433_0011584_222_1001 | 259 |
| 518 | 3300042002 | Ga0439442_009514 | Ga0439442_009514_349_1128 | 259 |
| 519 | 3300042004 | Ga0439445_0007498 | Ga0439445_0007498_513_1292 | 259 |
| 520 | 3300042004 | Ga0439445_0032908 | Ga0439445_0032908_302_1108 | 259 |
| 521 | 3300042006 | Ga0439432_001103 | Ga0439432_001103_1616_2395 | 259 |
| 522 | 3300042006 | Ga0439432_008450 | Ga0439432_008450_2513_3292 | 259 |
| 523 | 3300042007 | Ga0439449_0000682 | Ga0439449_0000682_3969_4748 | 259 |
| 524 | 3300042007 | Ga0439449_0002069 | Ga0439449_0002069_6297_7076 | 259 |
| 525 | 3300042010 | Ga0439452_004403 | Ga0439452_004403_3535_4314 | 259 |
| 526 | 3300042010 | Ga0439452_004644 | Ga0439452_004644_3401_4180 | 259 |
| 527 | 3300042012 | Ga0439455_0001526 | Ga0439455_0001526_2553_3341 | 259 |
| 528 | 3300042014 | Ga0439457_040827 | Ga0439457_040827_193_972 | 259 |
| 529 | 3300042015 | Ga0439462_0005434 | Ga0439462_0005434_2057_2836 | 259 |
| 530 | 3300042121 | Ga0450919_000440 | Ga0450919_000440_2714_3493 | 259 |
| 531 | 3300042123 | Ga0450921_000658 | Ga0450921_000658_379_1158 | 259 |
| 532 | 3300042123 | Ga0450921_001695 | Ga0450921_001695_565_1344 | 259 |
| 533 | 3300042134 | Ga0450898_007415 | Ga0450898_007415_801_1580 | 259 |
| 534 | 3300042145 | Ga0450906_005936 | Ga0450906_005936_1457_2236 | 259 |
| 535 | 3300042156 | Ga0439446_0029223 | Ga0439446_0029223_777_1556 | 259 |
| 536 | 3300042157 | Ga0439458_0066148 | Ga0439458_0066148_29_808 | 259 |
| 537 | 3300042435 | Ga0439434_0001557 | Ga0439434_0001557_885_1664 | 259 |
| 538 | 3300042435 | Ga0439434_0017164 | Ga0439434_0017164_891_1670 | 259 |
| 539 | 3300042435 | Ga0439434_0054867 | Ga0439434_0054867_37_816 | 259 |
| 540 | 3300042531 | Ga0450918_000195 | Ga0450918_000195_11573_12352 | 259 |
| 541 | 3300042532 | Ga0450893_0016345 | Ga0450893_0016345_126_905 | 259 |
| 542 | 3300042876 | Ga0451577_0004391 | Ga0451577_0004391_5061_5840 | 259 |
| 543 | 3300044656 | Ga0466969_0213469 | Ga0466969_0213469_73_861 | 259 |
| 544 | 3300044673 | Ga0453683_0007043 | Ga0453683_0007043_2360_3139 | 259 |
| 545 | 3300044683 | Ga0466965_0009394 | Ga0466965_0009394_3216_4004 | 259 |
| 546 | 3300044683 | Ga0466965_0022297 | Ga0466965_0022297_2199_2978 | 259 |
| 547 | 3300044693 | Ga0466961_0054566 | Ga0466961_0054566_1327_2115 | 259 |
| 548 | 3300044706 | Ga0466964_0003116 | Ga0466964_0003116_944_1732 | 259 |
| 549 | 3300044712 | Ga0453684_0079742 | Ga0453684_0079742_2895_3674 | 259 |
| 550 | 3300044719 | Ga0466971_0118285 | Ga0466971_0118285_16_804 | 259 |
| 551 | 3300044842 | Ga0466957_0071907 | Ga0466957_0071907_1228_2016 | 259 |
| 552 | 3300044842 | Ga0466957_0443580 | Ga0466957_0443580_49_837 | 259 |
| 553 | 3300044901 | Ga0466960_0050222 | Ga0466960_0050222_88_876 | 259 |
| 554 | 3300045049 | Ga0466959_0109790 | Ga0466959_0109790_187_975 | 259 |
| 555 | 3300045051 | Ga0451576_0020223 | Ga0451576_0020223_1631_2410 | 259 |
| 556 | 3300045051 | Ga0451576_0126897 | Ga0451576_0126897_1438_2217 | 259 |
| 557 | 3300045836 | Ga0466958_0342029 | Ga0466958_0342029_94_882 | 259 |
| 558 | 3300045976 | Ga0466967_0195272 | Ga0466967_0195272_238_1026 | 259 |
| 559 | 3300046457 | Ga0495590_0004862 | Ga0495590_0004862_706_1500 | 259 |
| 560 | 3300046475 | Ga0495639_0002239 | Ga0495639_0002239_3991_4770 | 259 |
| 561 | 3300046513 | Ga0495616_0000288 | Ga0495616_0000288_31682_32461 | 259 |
| 562 | 3300046518 | Ga0495631_0000187 | Ga0495631_0000187_11797_12576 | 259 |
| 563 | 3300046519 | Ga0495632_0009885 | Ga0495632_0009885_4801_5589 | 259 |
| 564 | 3300046520 | Ga0495637_0000830 | Ga0495637_0000830_10942_11721 | 259 |
| 565 | 3300046522 | Ga0495643_0050204 | Ga0495643_0050204_356_1144 | 259 |
| 566 | 3300046528 | Ga0495642_0045448 | Ga0495642_0045448_154_933 | 259 |
| 567 | 3300046528 | Ga0495642_0145725 | Ga0495642_0145725_170_949 | 259 |
| 568 | 3300046530 | Ga0495654_0004560 | Ga0495654_0004560_3466_4245 | 259 |
| 569 | 3300046539 | Ga0495621_0011136 | Ga0495621_0011136_756_1535 | 259 |
| 570 | 3300046542 | Ga0495597_0009303 | Ga0495597_0009303_1345_2133 | 259 |
| 571 | 3300046557 | Ga0495622_0068598 | Ga0495622_0068598_336_1124 | 259 |
| 572 | 3300046558 | Ga0495633_0029065 | Ga0495633_0029065_669_1448 | 259 |
| 573 | 3300046615 | Ga0495656_0001085 | Ga0495656_0001085_4418_5197 | 259 |
| 574 | 3300046616 | Ga0495668_0197976 | Ga0495668_0197976_194_982 | 259 |
| 575 | 3300046660 | Ga0495625_0001236 | Ga0495625_0001236_8088_8867 | 259 |
| 576 | 3300046660 | Ga0495625_0041071 | Ga0495625_0041071_1693_2481 | 259 |
| 577 | 3300046660 | Ga0495625_0047397 | Ga0495625_0047397_1631_2410 | 259 |
| 578 | 3300046665 | Ga0495661_0138377 | Ga0495661_0138377_477_1256 | 259 |
| 579 | 3300046674 | Ga0495588_0007292 | Ga0495588_0007292_1209_1988 | 259 |
| 580 | 3300046674 | Ga0495588_0182152 | Ga0495588_0182152_206_985 | 259 |
| 581 | 3300046683 | Ga0495658_0388872 | Ga0495658_0388872_84_872 | 259 |
| 582 | 3300046690 | Ga0495624_0076460 | Ga0495624_0076460_413_1201 | 259 |
| 583 | 3300046691 | Ga0495670_0062043 | Ga0495670_0062043_980_1759 | 259 |
| 584 | 3300046692 | Ga0495671_0007995 | Ga0495671_0007995_4908_5687 | 259 |
| 585 | 3300046694 | Ga0495649_0013765 | Ga0495649_0013765_1182_1970 | 259 |
| 586 | 3300046810 | Ga0495660_0055595 | Ga0495660_0055595_544_1332 | 259 |
| 587 | 3300047321 | Ga0495676_0032357 | Ga0495676_0032357_3528_4307 | 259 |
| 588 | 3300047443 | Ga0495687_000327 | Ga0495687_000327_55128_55916 | 259 |
| 589 | 3300047445 | Ga0495677_0013572 | Ga0495677_0013572_826_1605 | 259 |
| 590 | 3300047470 | Ga0495681_0087967 | Ga0495681_0087967_301_1080 | 259 |
| 591 | 3300047673 | Ga0495593_0008355 | Ga0495593_0008355_3846_4625 | 259 |
| 592 | 3300047673 | Ga0495593_0168172 | Ga0495593_0168172_115_894 | 259 |
| 593 | 3300048091 | Ga0495626_0027261 | Ga0495626_0027261_1675_2463 | 259 |
| 594 | 3300048903 | Ga0496100_0025814 | Ga0496100_0025814_2774_3553 | 259 |
| 595 | 3300048904 | Ga0496101_0001647 | Ga0496101_0001647_5931_6710 | 259 |
| 596 | 3300048904 | Ga0496101_0013086 | Ga0496101_0013086_1006_1785 | 259 |
| 597 | 3300048905 | Ga0496102_0071013 | Ga0496102_0071013_235_1014 | 259 |
| 598 | 3300048907 | Ga0496104_0024430 | Ga0496104_0024430_2895_3674 | 259 |
| 599 | 3300048908 | Ga0496105_0011915 | Ga0496105_0011915_2121_2900 | 259 |
| 600 | 3300048912 | Ga0496109_0210562 | Ga0496109_0210562_640_1419 | 259 |
| 601 | 3300048912 | Ga0496109_0341157 | Ga0496109_0341157_132_920 | 259 |
| 602 | 3300048913 | Ga0496110_0076278 | Ga0496110_0076278_64_843 | 259 |
| 603 | 3300048916 | Ga0496113_0115852 | Ga0496113_0115852_710_1489 | 259 |
| 604 | 3300048919 | Ga0496116_0122546 | Ga0496116_0122546_634_1413 | 259 |
| 605 | 3300048924 | Ga0496121_0071081 | Ga0496121_0071081_883_1662 | 259 |
| 606 | 3300048925 | Ga0496122_0000324 | Ga0496122_0000324_76882_77661 | 259 |
| 607 | 3300048926 | Ga0496123_0000160 | Ga0496123_0000160_64493_65272 | 259 |
| 608 | 3300048926 | Ga0496123_0124326 | Ga0496123_0124326_602_1381 | 259 |
| 609 | 3300048927 | Ga0496124_0073204 | Ga0496124_0073204_1401_2189 | 259 |
| 610 | 3300048928 | Ga0496125_0010589 | Ga0496125_0010589_7724_8530 | 259 |
| 611 | 3300048928 | Ga0496125_0013806 | Ga0496125_0013806_5882_6661 | 259 |
| 612 | 3300048928 | Ga0496125_0078801 | Ga0496125_0078801_739_1518 | 259 |
| 613 | 3300048929 | Ga0496126_0246918 | Ga0496126_0246918_89_868 | 259 |
| 614 | 3300049568 | Ga0501031_0033045 | Ga0501031_0033045_1720_2529 | 259 |
| 615 | 3300049686 | Ga0501257_088789 | Ga0501257_088789_11_790 | 259 |
| 616 | 3300049759 | Ga0501262_003744 | Ga0501262_003744_191_970 | 259 |
| 617 | 3300049823 | Ga0501044_0680562 | Ga0501044_0680562_75_854 | 259 |
| 618 | 3300050489 | nmdc:mga03683_11698_c1 | nmdc:mga03683_11698_c1_2027_2806 | 259 |
| 619 | 3300050489 | nmdc:mga03683_23445_c1 | nmdc:mga03683_23445_c1_1005_1820 | 259 |
| 620 | 3300050489 | nmdc:mga03683_26319_c1 | nmdc:mga03683_26319_c1_475_1263 | 259 |
| 621 | 3300050489 | nmdc:mga03683_451_c1 | nmdc:mga03683_451_c1_3072_3851 | 259 |
| 622 | 3300050490 | nmdc:mga03n38_27152_c1 | nmdc:mga03n38_27152_c1_475_1263 | 259 |
| 623 | 3300050491 | nmdc:mga00v17_13181_c1 | nmdc:mga00v17_13181_c1_1075_1863 | 259 |
| 624 | 3300050492 | nmdc:mga0yw44_10136_c1 | nmdc:mga0yw44_10136_c1_2417_3196 | 259 |
| 625 | 3300050492 | nmdc:mga0yw44_77697_c1 | nmdc:mga0yw44_77697_c1_279_1067 | 259 |
| 626 | 3300050493 | nmdc:mga0k408_10712_c1 | nmdc:mga0k408_10712_c1_3617_4405 | 259 |
| 627 | 3300050493 | nmdc:mga0k408_21637_c1 | nmdc:mga0k408_21637_c1_361_1140 | 259 |
| 628 | 3300050493 | nmdc:mga0k408_31612_c1 | nmdc:mga0k408_31612_c1_1431_2219 | 259 |
| 629 | 3300050493 | nmdc:mga0k408_43748_c1 | nmdc:mga0k408_43748_c1_538_1326 | 259 |
| 630 | 3300050493 | nmdc:mga0k408_52493_c1 | nmdc:mga0k408_52493_c1_721_1509 | 259 |
| 631 | 3300050493 | nmdc:mga0k408_73747_c1 | nmdc:mga0k408_73747_c1_800_1588 | 259 |
| 632 | 3300050494 | nmdc:mga06z11_157852_c1 | nmdc:mga06z11_157852_c1_448_1227 | 259 |
| 633 | 3300050496 | nmdc:mga07m45_110669_c1 | nmdc:mga07m45_110669_c1_223_1011 | 259 |
| 634 | 3300050496 | nmdc:mga07m45_13783_c1 | nmdc:mga07m45_13783_c1_2608_3387 | 259 |
| 635 | 3300050496 | nmdc:mga07m45_13783_c1 | nmdc:mga07m45_13783_c1_908_1687 | 259 |
| 636 | 3300050496 | nmdc:mga07m45_28985_c1 | nmdc:mga07m45_28985_c1_1168_1947 | 259 |
| 637 | 3300050516 | nmdc:mga0sz30_26342_c1 | nmdc:mga0sz30_26342_c1_583_1371 | 259 |
| 638 | 3300050516 | nmdc:mga0sz30_55858_c1 | nmdc:mga0sz30_55858_c1_285_1100 | 259 |
| 639 | 3300050516 | nmdc:mga0sz30_83571_c1 | nmdc:mga0sz30_83571_c1_388_1167 | 259 |
| 640 | 3300053093 | Ga0500651_0000267 | Ga0500651_0000267_27297_28076 | 259 |
| 641 | 3300053117 | Ga0500593_000228 | Ga0500593_000228_1473_2252 | 259 |
| 642 | 3300053121 | Ga0500607_001572 | Ga0500607_001572_8593_9372 | 259 |
| 643 | 3300053122 | Ga0500608_048380 | Ga0500608_048380_1022_1801 | 259 |
| 644 | 3300053134 | Ga0500658_0000239 | Ga0500658_0000239_11189_11968 | 259 |
| 645 | 3300053134 | Ga0500658_0000484 | Ga0500658_0000484_2636_3415 | 259 |
| 646 | 3300053136 | Ga0500559_0012276 | Ga0500559_0012276_526_1305 | 259 |
| 647 | 3300053148 | Ga0500590_051358 | Ga0500590_051358_708_1496 | 259 |
| 648 | 3300053158 | Ga0500627_0040034 | Ga0500627_0040034_1213_1992 | 259 |
| 649 | 3300053730 | Ga0500645_000574 | Ga0500645_000574_17290_18084 | 259 |
| 650 | 3300059424 | Ga0590075_016087 | Ga0590075_016087_413_1192 | 259 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xzd-assembly1.cif.gz_F | structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism | 0.9708 | 3 | 235 |
| 3moy-assembly1.cif.gz_A | crystal structure of probable enoyl-coa hydratase from mycobacterium smegmatis | 0.9693 | 1 | 255 |
| 5xzd-assembly1.cif.gz_F | structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism | 0.9664 | 3 | 235 |
| 4fjw-assembly1.cif.gz_D | crystal structure of the apo form of the e131q mtb crotonase | 0.9663 | 1 | 256 |
| 3h81-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis | 0.9637 | 2 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7ZZ04_32_233_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.972 | 1 | 199 | 3.90.226.10 |
| af_Q54BX7_16_236_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9714 | 2 | 194 | 3.90.226.10 |
| 4fzwB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9645 | 2 | 197 | 3.90.226.10 |
| 2qq3L01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9599 | 3 | 198 | 3.90.226.10 |
| af_Q7ZZ04_32_233_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9532 | 1 | 199 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0L0DKA5-F1-model_v4 | Enoyl-CoA hydratase | 0.9795 | 2 | 211 |
GO:0005739
GO:0006635 GO:0016836 |
| AF-A0A640JBL3-F1-model_v4 | deleted | 0.979 | 1 | 258 |
|
| AF-A0A7S3ZB57-F1-model_v4 | Enoyl-CoA hydratase | 0.9785 | 1 | 205 |
GO:0005739
GO:0006635 GO:0016836 |
| AF-A0A7J7AMY3-F1-model_v4 | deleted | 0.9776 | 1 | 216 |
|
| AF-A0A6V7GZV5-F1-model_v4 | Enoyl-CoA hydratase | 0.9775 | 1 | 213 |
GO:0005739
GO:0006635 GO:0016836 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar