F472525

General Info

Members Datasets Scaffolds Average Seq Length
650 370 589 259

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10000076|Ga0207709_10000076132
Length 300
Sequence MAAILDENNSQMKHPRVSGPEAWLGIVGRVFFPTSPGDSDTMSYENIDVRTEAGKVGIITLNRPKALNALNDALMTELGQALKAFDADDAIGCIILTGSERAFAAGADIAAMAKYSFIDTYKGDYITRNWETIRSIRKPVIAAVSGFALGGGCELAMMCDFIIAADNAKFGQPEIKIGVIPGAGGTQRLPRAVGKSKAMDMALTARMMDAAEAERAGLVSRVVPFEKLADEALGAALIIAGFSQIAVMAAKESVNRAFESGLSDGVMFERRLFHALFATQDQKEGMDAFLAKRQPDFKNA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
14 2643221652 Acidovorax sp. Root402 Isolate Unclassified
15 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2643221683 Variovorax sp. Root473 Isolate Unclassified
18 2643221717 Acidovorax sp. Root267 Isolate Unclassified
19 2721755523 Delftia sp. HK171 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2738543013 Variovorax sp. BT01 Isolate Unclassified
24 2738543019 Variovorax sp. GV040 Isolate Unclassified
25 2816332133 Acidovorax radicis 2721A Isolate Unclassified
26 2818991446 Variovorax sp. 1180 Isolate Unclassified
27 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
28 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
29 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
30 2842677519 Variovorax sp. R-72495 Isolate Unclassified
31 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
32 2842733646 Variovorax sp. R-72446 Isolate Unclassified
33 2842747753 Variovorax sp. R-72060 Isolate Unclassified
34 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
35 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
36 2885198086 Variovorax sp. 679 Isolate Unclassified
37 2885211737 Variovorax sp. 553 Isolate Unclassified
38 2899924645 Variovorax sp. 369 Isolate Unclassified
39 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
40 2904456579 Variovorax sp. 2002 Isolate Unclassified
41 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
42 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
43 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
44 2928037797 Variovorax sp. 1126 Isolate Unclassified
45 2928044640 Variovorax sp. 1128 Isolate Unclassified
46 2928051484 Variovorax sp. 1133 Isolate Unclassified
47 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
48 2928070936 Variovorax gossypii 1167 Isolate Unclassified
49 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
50 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
51 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
52 2929520902 Variovorax beijingensis 502 Isolate Unclassified
53 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
54 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
55 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
56 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
57 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
58 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
59 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
60 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
61 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
62 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
63 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
64 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
65 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
66 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
67 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
68 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
69 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
70 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
71 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
75 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
76 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
77 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
78 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
79 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
82 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
83 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
86 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
87 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
88 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
89 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
90 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
91 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
92 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
93 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
94 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
95 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
96 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
97 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
98 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
99 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
100 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
101 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
102 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
103 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
104 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
107 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
122 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
123 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
124 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
153 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
154 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
155 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
158 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
222 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
224 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
232 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
233 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
234 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
235 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
236 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
237 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
238 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
241 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
248 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
249 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
250 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
255 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
256 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
265 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
266 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
269 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
270 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
271 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
272 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
275 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
276 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
277 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
278 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
279 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
280 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
281 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
282 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
283 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
284 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
285 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
286 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
287 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
288 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
289 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
290 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
291 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
292 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
293 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
294 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
295 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
296 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
297 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
298 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
299 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
300 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
303 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
304 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
305 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
306 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
307 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
308 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
309 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
310 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
311 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
312 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
316 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
328 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
329 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
344 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
351 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
354 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
361 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
362 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
363 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
364 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
365 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
368 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
369 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
370 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.31
Metatranscriptomes 0.46
Isolates 9.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.85
Nodule 1.38
Rhizoplane 2.15
Rhizosphere 55.38
Stem 0
Stem Tuber 0
Unclassified 13.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10052958 3300001989 Bacteria 1304
2 JGI25155J39150_1000029 3300002704 Bacteria 118964
3 JGI25156J39149_1000272 3300002705 Bacteria 35071
4 JGI25154J39366_1000053 3300002738 Bacteria 119466
5 JGI25157J39369_1000046 3300002741 Bacteria 119470
6 JGI25150J39212_1004866 3300002774 Bacteria 2928
7 JGI25150J39212_1011896 3300002774 Bacteria 1560
8 JGI25150J39212_1015851 3300002774 Bacteria 1247
9 JGI25159J45721_1005232 3300002987 Bacteria 4107
10 JGI25159J45721_1014942 3300002987 Bacteria 1723
11 JGI25151J46595_10001446 3300003187 Bacteria 16098
12 JGI25151J46595_10003511 3300003187 Bacteria 8633
13 JGI25151J46595_10008613 3300003187 Bacteria 4889
14 JGI25151J46595_10011783 3300003187 Bacteria 4006
15 JGI25153J46596_10002887 3300003215 Bacteria 9753
16 JGI25153J46596_10026617 3300003215 Bacteria 2043
17 JGI25160J50197_1008376 3300003354 Bacteria 3946
18 JGI25160J50197_1010335 3300003354 Bacteria 3382
19 JGI25160J50197_1030576 3300003354 Bacteria 1400
20 JGI25161J50226_1000046 3300003374 Bacteria 116165
21 JGI25161J50226_1004960 3300003374 Bacteria 2692
22 Ga0006562J51391_1044074 3300003578 Bacteria 1655
23 Ga0006562J51391_1045467 3300003578 Bacteria 6752
24 Ga0006562J51391_1045469 3300003578 Bacteria 3632
25 Ga0055535_1000289 3300003761 Bacteria 53058
26 Ga0055542_1000036 3300003762 Bacteria 227346
27 Ga0055526_1004155 3300003771 Bacteria 8815
28 Ga0055526_1005732 3300003771 Bacteria 7017
29 Ga0055537_1000623 3300003773 Bacteria 19351
30 Ga0055524_1000044 3300003775 Bacteria 151631
31 Ga0055524_1000469 3300003775 Bacteria 32369
32 Ga0055524_1022088 3300003775 Bacteria 2088
33 Ga0055536_1014715 3300003781 Bacteria 2723
34 Ga0055534_1000397 3300003784 Bacteria 26870
35 Ga0055528_1008275 3300003790 Bacteria 4486
36 Ga0055530_10000630 3300003791 Bacteria 30400
37 Ga0055530_10003088 3300003791 Bacteria 9896
38 Ga0055540_1000063 3300003792 Bacteria 127901
39 Ga0055540_1000173 3300003792 Bacteria 63434
40 Ga0055540_1007713 3300003792 Bacteria 4007
41 Ga0055531_10000276 3300003794 Bacteria 52882
42 Ga0055531_10014054 3300003794 Bacteria 3637
43 Ga0055543_1001803 3300004625 Bacteria 7904
44 Ga0055543_1002615 3300004625 Bacteria 5812
45 Ga0065165_1056801 3300005262 Bacteria 1086
46 Ga0065704_10196713 3300005289 Bacteria 1164
47 Ga0065704_10220127 3300005289 Bacteria 1077
48 Ga0065707_10152043 3300005295 Bacteria 1648
49 Ga0070658_10079968 3300005327 Bacteria 2684
50 Ga0070658_10180959 3300005327 Bacteria 1774
51 Ga0070658_10209465 3300005327 Bacteria 1647
52 Ga0070670_100091617 3300005331 Bacteria 2613
53 Ga0068868_100565144 3300005338 Bacteria 1004
54 Ga0070661_100001470 3300005344 Bacteria 16360
55 Ga0070668_100249499 3300005347 Bacteria 1473
56 Ga0070668_100463328 3300005347 Bacteria 1092
57 Ga0070669_100081971 3300005353 Bacteria 2404
58 Ga0070669_100148324 3300005353 Bacteria 1814
59 Ga0070669_100164412 3300005353 Bacteria 1727
60 Ga0070675_100024440 3300005354 Bacteria 4838
61 Ga0070671_100025509 3300005355 Bacteria 4851
62 Ga0070671_100047940 3300005355 Bacteria 3552
63 Ga0070673_100020985 3300005364 Bacteria 4723
64 Ga0070659_100001712 3300005366 Bacteria 15775
65 Ga0070659_100089034 3300005366 Bacteria 2472
66 Ga0070667_100015275 3300005367 Bacteria 6346
67 Ga0070708_100111340 3300005445 Bacteria 2517
68 Ga0070663_100091088 3300005455 Bacteria 2259
69 Ga0070678_100228320 3300005456 Bacteria 1551
70 Ga0070662_100040739 3300005457 Bacteria 3309
71 Ga0068867_100069959 3300005459 Bacteria 2622
72 Ga0068867_100149273 3300005459 Bacteria 1835
73 Ga0070685_10407842 3300005466 Bacteria 943
74 Ga0070706_100003421 3300005467 Bacteria 15654
75 Ga0068853_100012883 3300005539 Bacteria 6814
76 Ga0068853_100224713 3300005539 Bacteria 1716
77 Ga0070672_100039085 3300005543 Bacteria 3632
78 Ga0070672_100165814 3300005543 Bacteria 1835
79 Ga0070665_100085161 3300005548 Bacteria 3166
80 Ga0070665_100105115 3300005548 Bacteria 2825
81 Ga0070665_100345199 3300005548 Bacteria 1494
82 Ga0070665_100506427 3300005548 Bacteria 1219
83 Ga0068855_100022176 3300005563 Bacteria 7609
84 Ga0068855_100089597 3300005563 Bacteria 3552
85 Ga0068855_100116141 3300005563 Bacteria 3067
86 Ga0070664_100002031 3300005564 Bacteria 16231
87 Ga0070664_100013022 3300005564 Bacteria 6767
88 Ga0070664_100693134 3300005564 Bacteria 949
89 Ga0068857_100064053 3300005577 Bacteria 3269
90 Ga0068857_100354154 3300005577 Bacteria 1360
91 Ga0068854_100124322 3300005578 Bacteria 1963
92 Ga0068852_100056642 3300005616 Bacteria 3389
93 Ga0068852_100242356 3300005616 Bacteria 1724
94 Ga0068859_100044987 3300005617 Bacteria 4435
95 Ga0068864_100032354 3300005618 Bacteria 4444
96 Ga0068864_100104975 3300005618 Bacteria 2511
97 Ga0068851_10014047 3300005834 Bacteria 3797
98 Ga0068863_100034397 3300005841 Bacteria 4827
99 Ga0068863_100414650 3300005841 Bacteria 1319
100 Ga0068863_100541600 3300005841 Bacteria 1149
101 Ga0068860_100080422 3300005843 Bacteria 3099
102 Ga0068860_100258559 3300005843 Bacteria 1697
103 Ga0068862_100199483 3300005844 Bacteria 1804
104 Ga0081455_10153923 3300005937 Bacteria 1770
105 Ga0075365_10003479 3300006038 Bacteria 8122
106 Ga0075365_10076520 3300006038 Bacteria 2259
107 Ga0075365_10132489 3300006038 Bacteria 1726
108 Ga0075365_10138900 3300006038 Bacteria 1686
109 Ga0075368_10054797 3300006042 Bacteria 1589
110 Ga0075363_100082242 3300006048 Bacteria 1762
111 Ga0075364_10091292 3300006051 Bacteria 2021
112 Ga0075432_10033726 3300006058 Bacteria 1776
113 Ga0075362_10003327 3300006177 Bacteria 5602
114 Ga0075362_10015585 3300006177 Bacteria 3094
115 Ga0075362_10017376 3300006177 Bacteria 2963
116 Ga0075362_10024283 3300006177 Bacteria 2570
117 Ga0075362_10099598 3300006177 Bacteria 1357
118 Ga0075367_10028530 3300006178 Bacteria 3185
119 Ga0075367_10045067 3300006178 Bacteria 2587
120 Ga0075367_10083729 3300006178 Bacteria 1933
121 Ga0075366_10001341 3300006195 Bacteria 12307
122 Ga0075366_10007913 3300006195 Bacteria 5880
123 Ga0075366_10022118 3300006195 Bacteria 3698
124 Ga0075366_10053794 3300006195 Bacteria 2392
125 Ga0075366_10061318 3300006195 Bacteria 2235
126 Ga0075366_10065134 3300006195 Bacteria 2167
127 Ga0075366_10102128 3300006195 Bacteria 1721
128 Ga0075366_10105054 3300006195 Bacteria 1697
129 Ga0075366_10131971 3300006195 Bacteria 1507
130 Ga0097621_100111445 3300006237 Bacteria 2312
131 Ga0075370_10001058 3300006353 Bacteria 11460
132 Ga0075370_10009223 3300006353 Bacteria 5112
133 Ga0075370_10033362 3300006353 Bacteria 2882
134 Ga0075370_10161389 3300006353 Bacteria 1315
135 Ga0068871_100151985 3300006358 Bacteria 1975
136 Ga0097620_100044987 3300006931 Bacteria 4435
137 Ga0079104_1000037 3300006946 Bacteria 189207
138 Ga0079104_1000294 3300006946 Bacteria 63150
139 Ga0079104_1008514 3300006946 Bacteria 3581
140 Ga0079104_1026331 3300006946 Bacteria 1504
141 Ga0105240_10001543 3300009093 Bacteria 39121
142 Ga0105240_10002814 3300009093 Bacteria 27490
143 Ga0105240_10351882 3300009093 Bacteria 1671
144 Ga0105245_10182584 3300009098 Bacteria 2005
145 Ga0105245_10418446 3300009098 Bacteria 1343
146 Ga0105247_10124116 3300009101 Bacteria 1676
147 Ga0105243_10015400 3300009148 Bacteria 5782
148 Ga0105243_10054766 3300009148 Bacteria 3167
149 Ga0105243_10122609 3300009148 Bacteria 2194
150 Ga0105241_10381380 3300009174 Bacteria 1232
151 Ga0105237_10002372 3300009545 Bacteria 23375
152 Ga0105237_10014572 3300009545 Bacteria 8216
153 Ga0105237_10053518 3300009545 Bacteria 4048
154 Ga0105238_10027529 3300009551 Bacteria 5794
155 Ga0105238_10508411 3300009551 Bacteria 1206
156 Ga0105238_10596867 3300009551 Bacteria 1112
157 Ga0105239_10001168 3300010375 Bacteria 36102
158 Ga0105239_10016215 3300010375 Bacteria 8242
159 Ga0157347_1005573 3300012502 Bacteria 1208
160 Ga0157347_1009747 3300012502 Bacteria 999
161 Ga0157373_10003982 3300013100 Bacteria 11140
162 Ga0157371_10108489 3300013102 Bacteria 1970
163 Ga0157370_10007530 3300013104 Bacteria 11828
164 Ga0157370_10374199 3300013104 Bacteria 1312
165 Ga0157369_10050951 3300013105 Bacteria 4482
166 Ga0157378_10271907 3300013297 Bacteria 1630
167 Ga0163162_10021978 3300013306 Bacteria 6286
168 Ga0157372_10804912 3300013307 Bacteria 1092
169 Ga0157375_10192299 3300013308 Bacteria 2196
170 Ga0157375_10295556 3300013308 Bacteria 1783
171 Ga0182008_10000191 3300014497 Bacteria 48580
172 Ga0182008_10003941 3300014497 Bacteria 8786
173 Ga0182008_10005474 3300014497 Bacteria 7230
174 Ga0182008_10006656 3300014497 Bacteria 6434
175 Ga0182008_10026178 3300014497 Bacteria 2959
176 Ga0157376_10175324 3300014969 Bacteria 1955
177 Ga0157376_10708669 3300014969 Bacteria 1012
178 Ga0182006_1001724 3300015261 Bacteria 12705
179 Ga0182006_1058840 3300015261 Bacteria 1456
180 Ga0182007_10002842 3300015262 Bacteria 8423
181 Ga0182005_1025809 3300015265 Bacteria 1604
182 Ga0183362_10005 3300015683 Bacteria 437616
183 Ga0163161_10000244 3300017792 Bacteria 49165
184 Ga0163161_10128426 3300017792 Bacteria 1910
185 Ga0163161_10131556 3300017792 Bacteria 1888
186 Ga0163161_10181282 3300017792 Bacteria 1615
187 Ga0209435_100003 3300025206 Bacteria 669534
188 Ga0209436_106712 3300025208 Bacteria 2488
189 Ga0209672_101200 3300025228 Bacteria 10518
190 Ga0209147_100961 3300025229 Bacteria 12646
191 Ga0209258_100091 3300025242 Bacteria 227454
192 Ga0207425_1000183 3300025245 Bacteria 51638
193 Ga0207425_1000933 3300025245 Bacteria 13901
194 Ga0207425_1009626 3300025245 Bacteria 2394
195 Ga0207425_1033787 3300025245 Bacteria 1006
196 Ga0209646_1000008 3300025246 Bacteria 669534
197 Ga0209026_1000007 3300025250 Bacteria 669534
198 Ga0209148_1000033 3300025254 Bacteria 555508
199 Ga0209759_1000026 3300025256 Bacteria 311743
200 Ga0209129_1000091 3300025258 Bacteria 175716
201 Ga0209129_1004863 3300025258 Bacteria 5026
202 Ga0209565_1000020 3300025263 Bacteria 432627
203 Ga0209565_1000200 3300025263 Bacteria 71490
204 Ga0209565_1000270 3300025263 Bacteria 52764
205 Ga0209565_1000507 3300025263 Bacteria 28238
206 Ga0209565_1001022 3300025263 Bacteria 14301
207 Ga0209565_1027612 3300025263 Bacteria 1128
208 Ga0209565_1028856 3300025263 Bacteria 1093
209 Ga0209673_1000009 3300025273 Bacteria 620735
210 Ga0209673_1000012 3300025273 Bacteria 579480
211 Ga0209673_1000072 3300025273 Bacteria 236935
212 Ga0209673_1000154 3300025273 Bacteria 146394
213 Ga0209673_1000772 3300025273 Bacteria 43167
214 Ga0209673_1007609 3300025273 Bacteria 4951
215 Ga0209130_1000064 3300025284 Bacteria 196568
216 Ga0209130_1000140 3300025284 Bacteria 115434
217 Ga0209130_1000203 3300025284 Bacteria 80023
218 Ga0209130_1000225 3300025284 Bacteria 74120
219 Ga0209675_1000014 3300025291 Bacteria 421902
220 Ga0209675_1000144 3300025291 Bacteria 94908
221 Ga0209675_1000447 3300025291 Bacteria 32004
222 Ga0209675_1001399 3300025291 Bacteria 14004
223 Ga0209676_1000051 3300025292 Bacteria 389016
224 Ga0209676_1000088 3300025292 Bacteria 263010
225 Ga0209676_1000267 3300025292 Bacteria 109237
226 Ga0209676_1000966 3300025292 Bacteria 34669
227 Ga0209676_1002156 3300025292 Bacteria 14892
228 Ga0209676_1009167 3300025292 Bacteria 4305
229 Ga0209025_1000207 3300025294 Bacteria 140774
230 Ga0209025_1000356 3300025294 Bacteria 98547
231 Ga0209025_1001327 3300025294 Bacteria 33484
232 Ga0209025_1001509 3300025294 Bacteria 29944
233 Ga0209025_1007756 3300025294 Bacteria 7907
234 Ga0209025_1008400 3300025294 Bacteria 7443
235 Ga0209025_1013276 3300025294 Bacteria 5193
236 Ga0209564_1000103 3300025295 Bacteria 221166
237 Ga0209564_1000530 3300025295 Bacteria 62121
238 Ga0209564_1000797 3300025295 Bacteria 43362
239 Ga0209564_1000945 3300025295 Bacteria 37432
240 Ga0209564_1001673 3300025295 Bacteria 21213
241 Ga0209758_1000092 3300025297 Bacteria 241910
242 Ga0209758_1000327 3300025297 Bacteria 89663
243 Ga0209758_1010345 3300025297 Bacteria 5599
244 Ga0209758_1010394 3300025297 Bacteria 5577
245 Ga0209758_1015192 3300025297 Bacteria 4013
246 Ga0209050_1000044 3300025298 Bacteria 391114
247 Ga0209050_1000110 3300025298 Bacteria 216664
248 Ga0209050_1000916 3300025298 Bacteria 38869
249 Ga0209050_1000983 3300025298 Bacteria 36304
250 Ga0209050_1005037 3300025298 Bacteria 8559
251 Ga0209256_1000003 3300025299 Bacteria 1661127
252 Ga0209256_1000036 3300025299 Bacteria 386664
253 Ga0209256_1000065 3300025299 Bacteria 248104
254 Ga0209256_1000094 3300025299 Bacteria 208177
255 Ga0207426_1000084 3300025302 Bacteria 298123
256 Ga0207426_1000116 3300025302 Bacteria 225245
257 Ga0207426_1000124 3300025302 Bacteria 218145
258 Ga0207426_1001529 3300025302 Bacteria 18859
259 Ga0209051_1000031 3300025303 Bacteria 391114
260 Ga0209051_1000069 3300025303 Bacteria 219208
261 Ga0209051_1000114 3300025303 Bacteria 152303
262 Ga0209051_1000230 3300025303 Bacteria 94027
263 Ga0209051_1000379 3300025303 Bacteria 63486
264 Ga0209051_1000685 3300025303 Bacteria 37585
265 Ga0209051_1001139 3300025303 Bacteria 24282
266 Ga0209051_1001228 3300025303 Bacteria 23035
267 Ga0209051_1002160 3300025303 Bacteria 14589
268 Ga0209257_1000015 3300025304 Bacteria 908141
269 Ga0209257_1000058 3300025304 Bacteria 381686
270 Ga0209257_1000093 3300025304 Bacteria 263088
271 Ga0209257_1000141 3300025304 Bacteria 201130
272 Ga0209257_1000575 3300025304 Bacteria 61759
273 Ga0207656_10007635 3300025321 Bacteria 3948
274 Ga0207655_1001961 3300025728 Bacteria 17580
275 Ga0207642_10169774 3300025899 Bacteria 1179
276 Ga0207710_10101190 3300025900 Bacteria 1359
277 Ga0207680_10353356 3300025903 Bacteria 1033
278 Ga0207645_10162906 3300025907 Bacteria 1459
279 Ga0207645_10265362 3300025907 Bacteria 1138
280 Ga0207705_10352441 3300025909 Bacteria 1134
281 Ga0207705_10400712 3300025909 Bacteria 1061
282 Ga0207684_10053942 3300025910 Bacteria 3411
283 Ga0207654_10291750 3300025911 Bacteria 1106
284 Ga0207695_10005159 3300025913 Bacteria 17488
285 Ga0207695_10068733 3300025913 Bacteria 3629
286 Ga0207695_10163527 3300025913 Bacteria 2155
287 Ga0207695_10256385 3300025913 Bacteria 1648
288 Ga0207671_10013375 3300025914 Bacteria 6538
289 Ga0207671_10044087 3300025914 Bacteria 3298
290 Ga0207671_10252773 3300025914 Bacteria 1386
291 Ga0207657_10031330 3300025919 Bacteria 4818
292 Ga0207657_10186173 3300025919 Bacteria 1677
293 Ga0207649_10010410 3300025920 Bacteria 5110
294 Ga0207649_10136167 3300025920 Bacteria 1675
295 Ga0207652_10382497 3300025921 Bacteria 1270
296 Ga0207681_10002439 3300025923 Bacteria 11796
297 Ga0207681_10170720 3300025923 Bacteria 1648
298 Ga0207681_10176916 3300025923 Bacteria 1622
299 Ga0207694_10042635 3300025924 Bacteria 3500
300 Ga0207650_10160955 3300025925 Bacteria 1778
301 Ga0207687_10120309 3300025927 Bacteria 1963
302 Ga0207644_10038729 3300025931 Bacteria 3361
303 Ga0207644_10186148 3300025931 Bacteria 1630
304 Ga0207690_10002101 3300025932 Bacteria 12197
305 Ga0207690_10022892 3300025932 Bacteria 3892
306 Ga0207706_10042818 3300025933 Bacteria 4012
307 Ga0207686_10011859 3300025934 Bacteria 4782
308 Ga0207709_10000076 3300025935 Bacteria 173292
309 Ga0207709_10000472 3300025935 Bacteria 36896
310 Ga0207709_10002379 3300025935 Bacteria 11866
311 Ga0207709_10042383 3300025935 Bacteria 2737
312 Ga0207691_10015393 3300025940 Bacteria 7277
313 Ga0207691_10223290 3300025940 Bacteria 1633
314 Ga0207689_10137037 3300025942 Bacteria 2015
315 Ga0207689_10347778 3300025942 Bacteria 1232
316 Ga0207689_10391223 3300025942 Bacteria 1158
317 Ga0207679_10000088 3300025945 Bacteria 79836
318 Ga0207679_10027321 3300025945 Bacteria 3945
319 Ga0207667_10039365 3300025949 Bacteria 5039
320 Ga0207667_10117417 3300025949 Bacteria 2742
321 Ga0207651_10013397 3300025960 Bacteria 4692
322 Ga0207651_10266560 3300025960 Bacteria 1409
323 Ga0207651_10298052 3300025960 Bacteria 1340
324 Ga0207668_10058976 3300025972 Bacteria 2686
325 Ga0207640_10320841 3300025981 Bacteria 1233
326 Ga0207677_10010744 3300026023 Bacteria 5190
327 Ga0207677_10014817 3300026023 Bacteria 4566
328 Ga0207677_10383172 3300026023 Bacteria 1187
329 Ga0207639_10019378 3300026041 Bacteria 4851
330 Ga0207639_10139927 3300026041 Bacteria 2015
331 Ga0207678_10026992 3300026067 Bacteria 5008
332 Ga0207641_10008372 3300026088 Bacteria 8547
333 Ga0207641_10523579 3300026088 Bacteria 1154
334 Ga0207648_10013164 3300026089 Bacteria 7711
335 Ga0207648_10065424 3300026089 Bacteria 3170
336 Ga0207648_10502337 3300026089 Bacteria 1110
337 Ga0207676_10033357 3300026095 Bacteria 3889
338 Ga0207676_10132659 3300026095 Bacteria 2120
339 Ga0207676_10324649 3300026095 Bacteria 1414
340 Ga0207674_10016085 3300026116 Bacteria 8194
341 Ga0207674_10034413 3300026116 Bacteria 5296
342 Ga0207674_10362917 3300026116 Bacteria 1400
343 Ga0207674_10402966 3300026116 Bacteria 1322
344 Ga0207674_10434698 3300026116 Bacteria 1268
345 Ga0207675_100032073 3300026118 Bacteria 4893
346 Ga0207675_100384680 3300026118 Bacteria 1380
347 Ga0207683_10031829 3300026121 Bacteria 4580
348 Ga0207683_10276400 3300026121 Bacteria 1535
349 Ga0207698_10044076 3300026142 Bacteria 3348
350 Ga0209281_1000002 3300027111 Bacteria 1924012
351 Ga0209281_1000423 3300027111 Bacteria 63126
352 Ga0209281_1019020 3300027111 Bacteria 1362
353 Ga0209970_1000026 3300027614 Bacteria 19518
354 Ga0209282_1000298 3300027666 Bacteria 24501
355 Ga0209971_1000744 3300027682 Bacteria 8388
356 Ga0209974_10005128 3300027876 Bacteria 4627
357 Ga0209974_10010577 3300027876 Bacteria 3113
358 Ga0209974_10016653 3300027876 Bacteria 2440
359 Ga0268266_10006260 3300028379 Bacteria 10924
360 Ga0268266_10026800 3300028379 Bacteria 4904
361 Ga0268266_10345295 3300028379 Bacteria 1398
362 Ga0268265_10174867 3300028380 Bacteria 1839
363 Ga0268265_10352528 3300028380 Bacteria 1344
364 Ga0268264_10051817 3300028381 Bacteria 3421
365 Ga0307517_10139084 3300028786 Bacteria 1713
366 Ga0307515_10000419 3300028794 Bacteria 102271
367 Ga0307515_10003462 3300028794 Bacteria 33182
368 Ga0307515_10007779 3300028794 Bacteria 21087
369 Ga0307515_10048555 3300028794 Bacteria 6414
370 Ga0307515_10149053 3300028794 Bacteria 2457
371 Ga0307515_10160465 3300028794 Bacteria 2296
372 Ga0307515_10196436 3300028794 Bacteria 1908
373 Ga0307512_10061877 3300030522 Bacteria 2878
374 Ga0316176_1093739 3300030732 Bacteria 1374
375 Ga0314311_1200241 3300030733 Bacteria 1827
376 Ga0316179_1078761 3300030734 Bacteria 1798
377 Ga0316183_1110470 3300030742 Bacteria 3052
378 Ga0265330_10000044 3300031235 Bacteria 113679
379 Ga0265330_10037185 3300031235 Bacteria 2168
380 Ga0265332_10000046 3300031238 Bacteria 113777
381 Ga0265332_10003009 3300031238 Bacteria 8269
382 Ga0265325_10013967 3300031241 Bacteria 4554
383 Ga0265340_10006278 3300031247 Bacteria 6550
384 Ga0265327_10000945 3300031251 Bacteria 42267
385 Ga0265327_10005555 3300031251 Bacteria 10470
386 Ga0265316_10056195 3300031344 Bacteria 3076
387 Ga0307513_10000008 3300031456 Bacteria 442128
388 Ga0307513_10000316 3300031456 Bacteria 69426
389 Ga0307513_10029422 3300031456 Bacteria 6263
390 Ga0307513_10189360 3300031456 Bacteria 1911
391 Ga0307513_10350444 3300031456 Bacteria 1224
392 Ga0307513_10440379 3300031456 Bacteria 1029
393 Ga0307509_10000904 3300031507 Bacteria 50711
394 Ga0307509_10011898 3300031507 Bacteria 10462
395 Ga0307509_10154799 3300031507 Bacteria 2200
396 Ga0307509_10249323 3300031507 Bacteria 1561
397 Ga0307408_100000229 3300031548 Bacteria 59103
398 Ga0307408_100052417 3300031548 Bacteria 2942
399 Ga0307408_100066336 3300031548 Bacteria 2650
400 Ga0307408_100196146 3300031548 Bacteria 1630
401 Ga0307408_100257436 3300031548 Bacteria 1442
402 Ga0307408_100327357 3300031548 Bacteria 1293
403 Ga0307408_100547679 3300031548 Bacteria 1020
404 Ga0307514_10001645 3300031649 Bacteria 26056
405 Ga0307514_10005374 3300031649 Bacteria 11477
406 Ga0307514_10017019 3300031649 Bacteria 5984
407 Ga0265314_10000130 3300031711 Bacteria 113776
408 Ga0265314_10008127 3300031711 Bacteria 9029
409 Ga0265342_10027415 3300031712 Bacteria 3561
410 Ga0307516_10005347 3300031730 Bacteria 15436
411 Ga0307516_10036692 3300031730 Bacteria 4905
412 Ga0307516_10412981 3300031730 Bacteria 1008
413 Ga0307405_10071808 3300031731 Bacteria 2228
414 Ga0307405_10332780 3300031731 Bacteria 1164
415 Ga0307413_10056778 3300031824 Bacteria 2390
416 Ga0307406_10000319 3300031901 Bacteria 28062
417 Ga0307406_10459303 3300031901 Bacteria 1023
418 Ga0307412_10247479 3300031911 Bacteria 1382
419 Ga0307416_100035902 3300032002 Bacteria 3793
420 Ga0307411_10088171 3300032005 Bacteria 2157
421 Ga0307510_10000122 3300033180 Bacteria 62024
422 Ga0307510_10288971 3300033180 Bacteria 1106
423 Ga0373939_0048742 3300035114 Bacteria 1307
424 Ga0373931_0114117 3300035691 Bacteria 1536
425 Ga0373933_0433548 3300035724 Bacteria 859
426 Ga0373925_0013137 3300037068 Bacteria 5993
427 Ga0395899_0010475 3300037312 Bacteria 7100
428 Ga0395900_0038355 3300037418 Bacteria 4937
429 Ga0395900_0043581 3300037418 Bacteria 4624
430 Ga0395898_0026798 3300037466 Bacteria 5793
431 Ga0395898_0051820 3300037466 Bacteria 4011
432 Ga0395898_0091650 3300037466 Bacteria 2924
433 Ga0395898_0834481 3300037466 Bacteria 861
434 Ga0395905_0011798 3300037471 Bacteria 8437
435 Ga0395905_0014547 3300037471 Bacteria 7507
436 Ga0395905_0066757 3300037471 Bacteria 3369
437 Ga0395905_0081260 3300037471 Bacteria 3037
438 Ga0395905_0084626 3300037471 Bacteria 2972
439 Ga0395905_0177666 3300037471 Bacteria 1998
440 Ga0395905_0354791 3300037471 Bacteria 1359
441 Ga0439436_0008463 3300041404 Bacteria 3164
442 Ga0439439_0010418 3300041406 Bacteria 2222
443 Ga0439439_0011894 3300041406 Bacteria 2099
444 Ga0439465_0004738 3300041413 Bacteria 4385
445 Ga0451853_2883190 3300041512 Bacteria 1576
446 Ga0439431_0042692 3300041997 Bacteria 1159
447 Ga0439433_0011584 3300041999 Bacteria 1933
448 Ga0439442_009514 3300042002 Bacteria 1967
449 Ga0439445_0007498 3300042004 Bacteria 2533
450 Ga0439445_0032908 3300042004 Bacteria 1353
451 Ga0439432_001103 3300042006 Bacteria 10265
452 Ga0439432_008450 3300042006 Bacteria 3615
453 Ga0439449_0000682 3300042007 Bacteria 12925
454 Ga0439449_0002069 3300042007 Bacteria 7898
455 Ga0439452_004403 3300042010 Bacteria 4727
456 Ga0439452_004644 3300042010 Bacteria 4559
457 Ga0439455_0001526 3300042012 Bacteria 3906
458 Ga0439457_040827 3300042014 Bacteria 1034
459 Ga0439462_0005434 3300042015 Bacteria 3141
460 Ga0450919_000440 3300042121 Bacteria 5139
461 Ga0450921_000658 3300042123 Bacteria 1754
462 Ga0450921_001695 3300042123 Bacteria 1376
463 Ga0450898_007415 3300042134 Bacteria 1708
464 Ga0450906_005936 3300042145 Bacteria 2485
465 Ga0439446_0029223 3300042156 Bacteria 1590
466 Ga0439446_0052999 3300042156 Bacteria 1215
467 Ga0439458_0066148 3300042157 Bacteria 908
468 Ga0439434_0001557 3300042435 Bacteria 6612
469 Ga0439434_0017164 3300042435 Bacteria 2165
470 Ga0439434_0054867 3300042435 Bacteria 1240
471 Ga0439460_0063482 3300042461 Bacteria 1132
472 Ga0450918_000195 3300042531 Bacteria 13613
473 Ga0450893_0016345 3300042532 Bacteria 1256
474 Ga0451577_0000340 3300042876 Bacteria 87523
475 Ga0451577_0004391 3300042876 Bacteria 14903
476 Ga0466969_0213469 3300044656 Bacteria 878
477 Ga0453683_0007043 3300044673 Bacteria 7660
478 Ga0466965_0009394 3300044683 Bacteria 4544
479 Ga0466965_0022297 3300044683 Bacteria 3054
480 Ga0466961_0054566 3300044693 Bacteria 2548
481 Ga0466964_0003116 3300044706 Bacteria 6026
482 Ga0453684_0000793 3300044712 Bacteria 108286
483 Ga0453684_0079742 3300044712 Bacteria 4091
484 Ga0466971_0118285 3300044719 Bacteria 1225
485 Ga0466957_0071907 3300044842 Bacteria 2140
486 Ga0466957_0443580 3300044842 Bacteria 893
487 Ga0466960_0050222 3300044901 Bacteria 2010
488 Ga0466959_0109790 3300045049 Bacteria 1969
489 Ga0451576_0020223 3300045051 Bacteria 7250
490 Ga0451576_0023961 3300045051 Bacteria 6597
491 Ga0451576_0126897 3300045051 Bacteria 2658
492 Ga0466958_0342029 3300045836 Bacteria 962
493 Ga0466967_0195272 3300045976 Bacteria 1914
494 Ga0495590_0004862 3300046457 Bacteria 5373
495 Ga0495639_0002239 3300046475 Bacteria 8498
496 Ga0495616_0000288 3300046513 Bacteria 40663
497 Ga0495631_0000187 3300046518 Bacteria 42155
498 Ga0495632_0009885 3300046519 Bacteria 5703
499 Ga0495637_0000830 3300046520 Bacteria 20412
500 Ga0495643_0050204 3300046522 Bacteria 2247
501 Ga0495642_0045448 3300046528 Bacteria 1795
502 Ga0495642_0145725 3300046528 Bacteria 1023
503 Ga0495654_0004560 3300046530 Bacteria 8192
504 Ga0495621_0011136 3300046539 Bacteria 2773
505 Ga0495597_0000721 3300046542 Bacteria 26390
506 Ga0495597_0009303 3300046542 Bacteria 4864
507 Ga0495622_0068598 3300046557 Bacteria 1638
508 Ga0495622_0141931 3300046557 Bacteria 1090
509 Ga0495633_0029065 3300046558 Bacteria 2690
510 Ga0495656_0001085 3300046615 Bacteria 8809
511 Ga0495668_0197976 3300046616 Bacteria 1100
512 Ga0495625_0001236 3300046660 Bacteria 32273
513 Ga0495625_0041071 3300046660 Bacteria 3368
514 Ga0495625_0047397 3300046660 Bacteria 3098
515 Ga0495661_0138377 3300046665 Bacteria 1327
516 Ga0495588_0007292 3300046674 Bacteria 5026
517 Ga0495588_0182152 3300046674 Bacteria 1110
518 Ga0495658_0388872 3300046683 Bacteria 889
519 Ga0495624_0076460 3300046690 Bacteria 2077
520 Ga0495670_0062043 3300046691 Bacteria 1880
521 Ga0495671_0007995 3300046692 Bacteria 5978
522 Ga0495649_0013765 3300046694 Bacteria 4657
523 Ga0495660_0055595 3300046810 Bacteria 2142
524 Ga0495676_0032357 3300047321 Bacteria 4415
525 Ga0495687_000327 3300047443 Bacteria 61677
526 Ga0495677_0013572 3300047445 Bacteria 2966
527 Ga0495681_0087967 3300047470 Bacteria 1376
528 Ga0495593_0008355 3300047673 Bacteria 6025
529 Ga0495593_0168172 3300047673 Bacteria 1106
530 Ga0495626_0027261 3300048091 Bacteria 2779
531 Ga0496100_0025814 3300048903 Bacteria 3595
532 Ga0496101_0001647 3300048904 Bacteria 13387
533 Ga0496101_0013086 3300048904 Bacteria 5550
534 Ga0496102_0071013 3300048905 Bacteria 3197
535 Ga0496103_0159333 3300048906 Bacteria 1447
536 Ga0496104_0024430 3300048907 Bacteria 5557
537 Ga0496105_0011915 3300048908 Bacteria 6884
538 Ga0496109_0210562 3300048912 Bacteria 1828
539 Ga0496109_0341157 3300048912 Bacteria 1415
540 Ga0496110_0076278 3300048913 Bacteria 2980
541 Ga0496113_0115852 3300048916 Bacteria 2091
542 Ga0496116_0122546 3300048919 Bacteria 1501
543 Ga0496121_0071081 3300048924 Bacteria 2800
544 Ga0496122_0000324 3300048925 Bacteria 104220
545 Ga0496123_0000160 3300048926 Bacteria 135310
546 Ga0496123_0124326 3300048926 Bacteria 1443
547 Ga0496124_0073204 3300048927 Bacteria 2836
548 Ga0496125_0010589 3300048928 Bacteria 9317
549 Ga0496125_0013806 3300048928 Bacteria 7912
550 Ga0496125_0078801 3300048928 Bacteria 2530
551 Ga0496126_0246918 3300048929 Bacteria 1489
552 Ga0501031_0033045 3300049568 Bacteria 3373
553 Ga0501034_0313959 3300049571 Bacteria 1501
554 Ga0501257_088789 3300049686 Bacteria 803
555 Ga0501262_003744 3300049759 Bacteria 1754
556 Ga0501044_0680562 3300049823 Bacteria 915
557 nmdc:mga03683_11698_c1 3300050489 Bacteria 3186
558 nmdc:mga03683_17684_c1 3300050489 Bacteria 2702
559 nmdc:mga03683_23445_c1 3300050489 Bacteria 2404
560 nmdc:mga03683_26319_c1 3300050489 Bacteria 2294
561 nmdc:mga03683_451_c1 3300050489 Bacteria 11851
562 nmdc:mga03n38_27152_c1 3300050490 Bacteria 2372
563 nmdc:mga00v17_13181_c1 3300050491 Bacteria 4581
564 nmdc:mga0yw44_10136_c1 3300050492 Bacteria 4801
565 nmdc:mga0yw44_77697_c1 3300050492 Bacteria 2074
566 nmdc:mga0k408_10712_c1 3300050493 Bacteria 4968
567 nmdc:mga0k408_21637_c1 3300050493 Bacteria 3614
568 nmdc:mga0k408_31612_c1 3300050493 Bacteria 3023
569 nmdc:mga0k408_43748_c1 3300050493 Bacteria 2582
570 nmdc:mga0k408_52493_c1 3300050493 Bacteria 2363
571 nmdc:mga0k408_73747_c1 3300050493 Bacteria 1994
572 nmdc:mga06z11_157852_c1 3300050494 Bacteria 1294
573 nmdc:mga07m45_110669_c1 3300050496 Bacteria 1582
574 nmdc:mga07m45_13783_c1 3300050496 Bacteria 4294
575 nmdc:mga07m45_28985_c1 3300050496 Bacteria 3058
576 nmdc:mga0sz30_26342_c1 3300050516 Bacteria 2383
577 nmdc:mga0sz30_55858_c1 3300050516 Bacteria 1681
578 nmdc:mga0sz30_83571_c1 3300050516 Bacteria 1383
579 Ga0500651_0000267 3300053093 Bacteria 30991
580 Ga0500593_000228 3300053117 Bacteria 23190
581 Ga0500607_001572 3300053121 Bacteria 20173
582 Ga0500608_048380 3300053122 Bacteria 2043
583 Ga0500658_0000239 3300053134 Bacteria 25725
584 Ga0500658_0000484 3300053134 Bacteria 17027
585 Ga0500559_0012276 3300053136 Bacteria 3644
586 Ga0500590_051358 3300053148 Bacteria 2094
587 Ga0500627_0040034 3300053158 Bacteria 2009
588 Ga0500645_000574 3300053730 Bacteria 23829
589 Ga0590075_016087 3300059424 Bacteria 1839

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10053794 Ga0075366_100537943 239
2 3300005338 Ga0068868_100565144 Ga0068868_1005651441 240
3 3300005355 Ga0070671_100025509 Ga0070671_1000255093 240
4 3300005548 Ga0070665_100085161 Ga0070665_1000851612 240
5 3300005617 Ga0068859_100044987 Ga0068859_1000449873 240
6 3300005841 Ga0068863_100034397 Ga0068863_1000343974 240
7 3300005843 Ga0068860_100080422 Ga0068860_1000804222 240
8 3300006931 Ga0097620_100044987 Ga0097620_1000449873 240
9 3300009098 Ga0105245_10418446 Ga0105245_104184462 240
10 3300009101 Ga0105247_10124116 Ga0105247_101241162 240
11 3300013297 Ga0157378_10271907 Ga0157378_102719072 240
12 3300025900 Ga0207710_10101190 Ga0207710_101011902 240
13 3300025925 Ga0207650_10160955 Ga0207650_101609552 240
14 3300025927 Ga0207687_10120309 Ga0207687_101203092 240
15 3300025931 Ga0207644_10038729 Ga0207644_100387292 240
16 3300026023 Ga0207677_10383172 Ga0207677_103831722 240
17 3300026088 Ga0207641_10008372 Ga0207641_100083722 240
18 3300028379 Ga0268266_10026800 Ga0268266_100268003 240
19 3300028381 Ga0268264_10051817 Ga0268264_100518172 240
20 3300031911 Ga0307412_10247479 Ga0307412_102474792 240
21 3300031507 Ga0307509_10249323 Ga0307509_102493232 241
22 3300005618 Ga0068864_100032354 Ga0068864_1000323543 242
23 3300026095 Ga0207676_10132659 Ga0207676_101326592 242
24 3300005347 Ga0070668_100249499 Ga0070668_1002494992 244
25 3300005353 Ga0070669_100148324 Ga0070669_1001483242 244
26 3300025923 Ga0207681_10176916 Ga0207681_101769161 244
27 3300005618 Ga0068864_100104975 Ga0068864_1001049752 246
28 3300005841 Ga0068863_100414650 Ga0068863_1004146502 246
29 3300026095 Ga0207676_10033357 Ga0207676_100333575 246
30 3300031730 Ga0307516_10036692 Ga0307516_100366923 246
31 3300014969 Ga0157376_10175324 Ga0157376_101753244 247
32 3300006058 Ga0075432_10033726 Ga0075432_100337262 248
33 3300028786 Ga0307517_10139084 Ga0307517_101390842 251
34 3300049571 Ga0501034_0313959 Ga0501034_0313959_380_1153 251
35 3300025960 Ga0207651_10298052 Ga0207651_102980522 252
36 3300046557 Ga0495622_0141931 Ga0495622_0141931_11_769 252
37 3300009148 Ga0105243_10122609 Ga0105243_101226092 255
38 3300027682 Ga0209971_1000744 Ga0209971_10007447 255
39 3300046542 Ga0495597_0000721 Ga0495597_0000721_8068_8835 255
40 iso_pu_bacteria 2511231002 2511243615 255
41 iso_pu_bacteria 2513020051 2513226969 255
42 iso_pu_bacteria 2513020051 2513228363 255
43 iso_pu_bacteria 2547132374 2548497803 255
44 iso_pu_bacteria 2599185214 2599626235 255
45 iso_pu_bacteria 2599185226 2599675874 255
46 iso_pu_bacteria 2599185227 2599682242 255
47 iso_pu_bacteria 2599185229 2599695893 255
48 iso_pu_bacteria 2643221570 2643867247 255
49 iso_pu_bacteria 2643221596 2643990165 255
50 iso_pu_bacteria 2643221609 2644059297 255
51 iso_pu_bacteria 2643221611 2644075664 255
52 iso_pu_bacteria 2643221628 2644164051 255
53 iso_pu_bacteria 2643221644 2644243975 255
54 iso_pu_bacteria 2643221652 2644295655 255
55 iso_pu_bacteria 2643221654 2644302939 255
56 iso_pu_bacteria 2643221672 2644399911 255
57 iso_pu_bacteria 2643221683 2644466759 255
58 iso_pu_bacteria 2643221717 2644645194 255
59 iso_pu_bacteria 2721755523 2722885628 255
60 iso_pu_bacteria 2738541277 2738721468 255
61 iso_pu_bacteria 2738541307 2738880826 255
62 iso_pu_bacteria 2738543012 2739240792 255
63 iso_pu_bacteria 2738543013 2739249674 255
64 iso_pu_bacteria 2738543019 2739281137 255
65 iso_pu_bacteria 2816332133 2816472130 255
66 iso_pu_bacteria 2818991446 2819601505 255
67 iso_pu_bacteria 2831265667 2831272228 255
68 iso_pu_bacteria 2838054893 2838059392 255
69 iso_pu_bacteria 2839138175 2839141700 255
70 iso_pu_bacteria 2842677519 2842678659 255
71 iso_pu_bacteria 2842718218 2842718407 255
72 iso_pu_bacteria 2842733646 2842733922 255
73 iso_pu_bacteria 2842747753 2842752686 255
74 iso_pu_bacteria 2881101125 2881104960 255
75 iso_pu_bacteria 2885192300 2885193184 255
76 iso_pu_bacteria 2885198086 2885202866 255
77 iso_pu_bacteria 2885211737 2885216737 255
78 iso_pu_bacteria 2899924645 2899930950 255
79 iso_pu_bacteria 2904449895 2904452738 255
80 iso_pu_bacteria 2904456579 2904460234 255
81 iso_pu_bacteria 2904541872 2904547145 255
82 iso_pu_bacteria 2919462493 2919463644 255
83 iso_pu_bacteria 2928037797 2928040815 255
84 iso_pu_bacteria 2928044640 2928047657 255
85 iso_pu_bacteria 2928051484 2928055438 255
86 iso_pu_bacteria 2928064002 2928069543 255
87 iso_pu_bacteria 2928070936 2928075514 255
88 iso_pu_bacteria 2928084124 2928089443 255
89 iso_pu_bacteria 2928115317 2928117941 255
90 iso_pu_bacteria 2929160207 2929165699 255
91 iso_pu_bacteria 2929520902 2929525700 255
92 iso_pu_bacteria 2945909444 2945909647 255
93 iso_pu_bacteria 2945945610 2945945734 255
94 iso_pu_bacteria 2945972063 2945975388 255
95 iso_pu_bacteria 2945984333 2945988379 255
96 iso_pu_bacteria 2954767861 2954769165 255
97 iso_pu_bacteria 2974320154 2974320629 255
98 iso_pu_bacteria 2990710928 2990711115 255
99 3300005937 Ga0081455_10153923 Ga0081455_101539232 256
100 3300025903 Ga0207680_10353356 Ga0207680_103533562 256
101 3300041997 Ga0439431_0042692 Ga0439431_0042692_163_936 257
102 3300042156 Ga0439446_0052999 Ga0439446_0052999_384_1157 257
103 3300050489 nmdc:mga03683_17684_c1 nmdc:mga03683_17684_c1_587_1597 257
104 3300005841 Ga0068863_100541600 Ga0068863_1005416002 258
105 3300005843 Ga0068860_100258559 Ga0068860_1002585592 258
106 3300005844 Ga0068862_100199483 Ga0068862_1001994832 258
107 3300025907 Ga0207645_10162906 Ga0207645_101629063 258
108 3300025942 Ga0207689_10391223 Ga0207689_103912232 258
109 3300025972 Ga0207668_10058976 Ga0207668_100589762 258
110 3300026095 Ga0207676_10324649 Ga0207676_103246492 258
111 3300026118 Ga0207675_100032073 Ga0207675_1000320733 258
112 3300027614 Ga0209970_1000026 Ga0209970_100002611 258
113 3300027876 Ga0209974_10010577 Ga0209974_100105773 258
114 3300028380 Ga0268265_10352528 Ga0268265_103525282 258
115 3300031456 Ga0307513_10000008 Ga0307513_10000008261 258
116 3300042461 Ga0439460_0063482 Ga0439460_0063482_146_922 258
117 3300042876 Ga0451577_0000340 Ga0451577_0000340_40651_41427 258
118 3300044712 Ga0453684_0000793 Ga0453684_0000793_66860_67636 258
119 3300045051 Ga0451576_0023961 Ga0451576_0023961_980_1756 258
120 3300048906 Ga0496103_0159333 Ga0496103_0159333_470_1348 258
121 iso_pu_bacteria 2919704043 2919706261 258
122 3300001989 JGI24739J22299_10052958 JGI24739J22299_100529582 259
123 3300002704 JGI25155J39150_1000029 JGI25155J39150_100002914 259
124 3300002705 JGI25156J39149_1000272 JGI25156J39149_100027214 259
125 3300002738 JGI25154J39366_1000053 JGI25154J39366_100005395 259
126 3300002741 JGI25157J39369_1000046 JGI25157J39369_100004614 259
127 3300002774 JGI25150J39212_1004866 JGI25150J39212_10048662 259
128 3300002774 JGI25150J39212_1011896 JGI25150J39212_10118962 259
129 3300002774 JGI25150J39212_1015851 JGI25150J39212_10158512 259
130 3300002987 JGI25159J45721_1005232 JGI25159J45721_10052323 259
131 3300002987 JGI25159J45721_1014942 JGI25159J45721_10149422 259
132 3300003187 JGI25151J46595_10001446 JGI25151J46595_1000144611 259
133 3300003187 JGI25151J46595_10003511 JGI25151J46595_100035117 259
134 3300003187 JGI25151J46595_10008613 JGI25151J46595_100086131 259
135 3300003187 JGI25151J46595_10011783 JGI25151J46595_100117833 259
136 3300003215 JGI25153J46596_10002887 JGI25153J46596_100028878 259
137 3300003215 JGI25153J46596_10026617 JGI25153J46596_100266172 259
138 3300003354 JGI25160J50197_1008376 JGI25160J50197_10083763 259
139 3300003354 JGI25160J50197_1010335 JGI25160J50197_10103353 259
140 3300003354 JGI25160J50197_1030576 JGI25160J50197_10305762 259
141 3300003374 JGI25161J50226_1000046 JGI25161J50226_1000046105 259
142 3300003374 JGI25161J50226_1004960 JGI25161J50226_10049602 259
143 3300003578 Ga0006562J51391_1044074 Ga0006562J51391_10440742 259
144 3300003578 Ga0006562J51391_1045467 Ga0006562J51391_10454674 259
145 3300003578 Ga0006562J51391_1045469 Ga0006562J51391_10454694 259
146 3300003761 Ga0055535_1000289 Ga0055535_100028932 259
147 3300003762 Ga0055542_1000036 Ga0055542_1000036121 259
148 3300003771 Ga0055526_1004155 Ga0055526_10041557 259
149 3300003771 Ga0055526_1005732 Ga0055526_10057323 259
150 3300003773 Ga0055537_1000623 Ga0055537_100062310 259
151 3300003775 Ga0055524_1000044 Ga0055524_100004482 259
152 3300003775 Ga0055524_1000469 Ga0055524_100046923 259
153 3300003775 Ga0055524_1022088 Ga0055524_10220881 259
154 3300003781 Ga0055536_1014715 Ga0055536_10147151 259
155 3300003784 Ga0055534_1000397 Ga0055534_100039716 259
156 3300003790 Ga0055528_1008275 Ga0055528_10082753 259
157 3300003791 Ga0055530_10000630 Ga0055530_1000063022 259
158 3300003791 Ga0055530_10003088 Ga0055530_100030882 259
159 3300003792 Ga0055540_1000063 Ga0055540_100006392 259
160 3300003792 Ga0055540_1000173 Ga0055540_10001738 259
161 3300003792 Ga0055540_1007713 Ga0055540_10077134 259
162 3300003794 Ga0055531_10000276 Ga0055531_1000027640 259
163 3300003794 Ga0055531_10014054 Ga0055531_100140545 259
164 3300004625 Ga0055543_1001803 Ga0055543_10018033 259
165 3300004625 Ga0055543_1002615 Ga0055543_10026153 259
166 3300005262 Ga0065165_1056801 Ga0065165_10568012 259
167 3300005289 Ga0065704_10196713 Ga0065704_101967131 259
168 3300005289 Ga0065704_10220127 Ga0065704_102201271 259
169 3300005295 Ga0065707_10152043 Ga0065707_101520431 259
170 3300005327 Ga0070658_10079968 Ga0070658_100799683 259
171 3300005327 Ga0070658_10180959 Ga0070658_101809592 259
172 3300005327 Ga0070658_10209465 Ga0070658_102094652 259
173 3300005331 Ga0070670_100091617 Ga0070670_1000916171 259
174 3300005344 Ga0070661_100001470 Ga0070661_10000147010 259
175 3300005347 Ga0070668_100463328 Ga0070668_1004633282 259
176 3300005353 Ga0070669_100081971 Ga0070669_1000819712 259
177 3300005353 Ga0070669_100164412 Ga0070669_1001644122 259
178 3300005354 Ga0070675_100024440 Ga0070675_1000244402 259
179 3300005355 Ga0070671_100047940 Ga0070671_1000479402 259
180 3300005364 Ga0070673_100020985 Ga0070673_1000209854 259
181 3300005366 Ga0070659_100001712 Ga0070659_1000017129 259
182 3300005366 Ga0070659_100089034 Ga0070659_1000890343 259
183 3300005367 Ga0070667_100015275 Ga0070667_1000152755 259
184 3300005445 Ga0070708_100111340 Ga0070708_1001113402 259
185 3300005455 Ga0070663_100091088 Ga0070663_1000910882 259
186 3300005456 Ga0070678_100228320 Ga0070678_1002283201 259
187 3300005457 Ga0070662_100040739 Ga0070662_1000407394 259
188 3300005459 Ga0068867_100069959 Ga0068867_1000699592 259
189 3300005459 Ga0068867_100149273 Ga0068867_1001492732 259
190 3300005466 Ga0070685_10407842 Ga0070685_104078421 259
191 3300005467 Ga0070706_100003421 Ga0070706_10000342115 259
192 3300005539 Ga0068853_100012883 Ga0068853_1000128834 259
193 3300005539 Ga0068853_100224713 Ga0068853_1002247132 259
194 3300005543 Ga0070672_100039085 Ga0070672_1000390853 259
195 3300005543 Ga0070672_100165814 Ga0070672_1001658142 259
196 3300005548 Ga0070665_100105115 Ga0070665_1001051152 259
197 3300005548 Ga0070665_100345199 Ga0070665_1003451992 259
198 3300005548 Ga0070665_100506427 Ga0070665_1005064271 259
199 3300005563 Ga0068855_100022176 Ga0068855_1000221769 259
200 3300005563 Ga0068855_100089597 Ga0068855_1000895973 259
201 3300005563 Ga0068855_100116141 Ga0068855_1001161414 259
202 3300005564 Ga0070664_100002031 Ga0070664_10000203110 259
203 3300005564 Ga0070664_100013022 Ga0070664_1000130227 259
204 3300005564 Ga0070664_100693134 Ga0070664_1006931341 259
205 3300005577 Ga0068857_100064053 Ga0068857_1000640533 259
206 3300005577 Ga0068857_100354154 Ga0068857_1003541542 259
207 3300005578 Ga0068854_100124322 Ga0068854_1001243222 259
208 3300005616 Ga0068852_100056642 Ga0068852_1000566424 259
209 3300005616 Ga0068852_100242356 Ga0068852_1002423562 259
210 3300005834 Ga0068851_10014047 Ga0068851_100140473 259
211 3300006038 Ga0075365_10003479 Ga0075365_100034792 259
212 3300006038 Ga0075365_10076520 Ga0075365_100765202 259
213 3300006038 Ga0075365_10132489 Ga0075365_101324892 259
214 3300006038 Ga0075365_10138900 Ga0075365_101389003 259
215 3300006042 Ga0075368_10054797 Ga0075368_100547972 259
216 3300006048 Ga0075363_100082242 Ga0075363_1000822422 259
217 3300006051 Ga0075364_10091292 Ga0075364_100912923 259
218 3300006177 Ga0075362_10003327 Ga0075362_100033274 259
219 3300006177 Ga0075362_10015585 Ga0075362_100155853 259
220 3300006177 Ga0075362_10017376 Ga0075362_100173762 259
221 3300006177 Ga0075362_10024283 Ga0075362_100242832 259
222 3300006177 Ga0075362_10099598 Ga0075362_100995982 259
223 3300006178 Ga0075367_10028530 Ga0075367_100285302 259
224 3300006178 Ga0075367_10045067 Ga0075367_100450672 259
225 3300006178 Ga0075367_10083729 Ga0075367_100837292 259
226 3300006195 Ga0075366_10001341 Ga0075366_100013414 259
227 3300006195 Ga0075366_10007913 Ga0075366_100079136 259
228 3300006195 Ga0075366_10022118 Ga0075366_100221182 259
229 3300006195 Ga0075366_10061318 Ga0075366_100613181 259
230 3300006195 Ga0075366_10065134 Ga0075366_100651342 259
231 3300006195 Ga0075366_10102128 Ga0075366_101021282 259
232 3300006195 Ga0075366_10105054 Ga0075366_101050542 259
233 3300006195 Ga0075366_10131971 Ga0075366_101319712 259
234 3300006237 Ga0097621_100111445 Ga0097621_1001114452 259
235 3300006353 Ga0075370_10001058 Ga0075370_100010588 259
236 3300006353 Ga0075370_10009223 Ga0075370_100092231 259
237 3300006353 Ga0075370_10033362 Ga0075370_100333621 259
238 3300006353 Ga0075370_10161389 Ga0075370_101613891 259
239 3300006358 Ga0068871_100151985 Ga0068871_1001519852 259
240 3300006946 Ga0079104_1000037 Ga0079104_1000037101 259
241 3300006946 Ga0079104_1000294 Ga0079104_10002949 259
242 3300006946 Ga0079104_1008514 Ga0079104_10085143 259
243 3300006946 Ga0079104_1026331 Ga0079104_10263312 259
244 3300009093 Ga0105240_10001543 Ga0105240_1000154343 259
245 3300009093 Ga0105240_10002814 Ga0105240_100028148 259
246 3300009093 Ga0105240_10351882 Ga0105240_103518821 259
247 3300009098 Ga0105245_10182584 Ga0105245_101825842 259
248 3300009148 Ga0105243_10015400 Ga0105243_100154002 259
249 3300009148 Ga0105243_10054766 Ga0105243_100547663 259
250 3300009174 Ga0105241_10381380 Ga0105241_103813802 259
251 3300009545 Ga0105237_10002372 Ga0105237_100023729 259
252 3300009545 Ga0105237_10014572 Ga0105237_100145724 259
253 3300009545 Ga0105237_10053518 Ga0105237_100535183 259
254 3300009551 Ga0105238_10027529 Ga0105238_100275293 259
255 3300009551 Ga0105238_10508411 Ga0105238_105084112 259
256 3300009551 Ga0105238_10596867 Ga0105238_105968672 259
257 3300010375 Ga0105239_10001168 Ga0105239_1000116820 259
258 3300010375 Ga0105239_10016215 Ga0105239_100162157 259
259 3300012502 Ga0157347_1005573 Ga0157347_10055732 259
260 3300012502 Ga0157347_1009747 Ga0157347_10097472 259
261 3300013100 Ga0157373_10003982 Ga0157373_1000398210 259
262 3300013102 Ga0157371_10108489 Ga0157371_101084892 259
263 3300013104 Ga0157370_10007530 Ga0157370_1000753013 259
264 3300013104 Ga0157370_10374199 Ga0157370_103741992 259
265 3300013105 Ga0157369_10050951 Ga0157369_100509514 259
266 3300013306 Ga0163162_10021978 Ga0163162_100219784 259
267 3300013307 Ga0157372_10804912 Ga0157372_108049121 259
268 3300013308 Ga0157375_10192299 Ga0157375_101922992 259
269 3300013308 Ga0157375_10295556 Ga0157375_102955562 259
270 3300014497 Ga0182008_10000191 Ga0182008_1000019110 259
271 3300014497 Ga0182008_10003941 Ga0182008_100039419 259
272 3300014497 Ga0182008_10005474 Ga0182008_100054742 259
273 3300014497 Ga0182008_10006656 Ga0182008_100066562 259
274 3300014497 Ga0182008_10026178 Ga0182008_100261783 259
275 3300014969 Ga0157376_10708669 Ga0157376_107086692 259
276 3300015261 Ga0182006_1001724 Ga0182006_100172412 259
277 3300015261 Ga0182006_1058840 Ga0182006_10588402 259
278 3300015262 Ga0182007_10002842 Ga0182007_100028425 259
279 3300015265 Ga0182005_1025809 Ga0182005_10258092 259
280 3300015683 Ga0183362_10005 Ga0183362_10005153 259
281 3300017792 Ga0163161_10000244 Ga0163161_1000024437 259
282 3300017792 Ga0163161_10128426 Ga0163161_101284262 259
283 3300017792 Ga0163161_10131556 Ga0163161_101315562 259
284 3300017792 Ga0163161_10181282 Ga0163161_101812822 259
285 3300025206 Ga0209435_100003 Ga0209435_100003266 259
286 3300025208 Ga0209436_106712 Ga0209436_1067121 259
287 3300025228 Ga0209672_101200 Ga0209672_1012002 259
288 3300025229 Ga0209147_100961 Ga0209147_1009619 259
289 3300025242 Ga0209258_100091 Ga0209258_100091121 259
290 3300025245 Ga0207425_1000183 Ga0207425_100018331 259
291 3300025245 Ga0207425_1000933 Ga0207425_10009338 259
292 3300025245 Ga0207425_1009626 Ga0207425_10096263 259
293 3300025245 Ga0207425_1033787 Ga0207425_10337871 259
294 3300025246 Ga0209646_1000008 Ga0209646_1000008266 259
295 3300025250 Ga0209026_1000007 Ga0209026_1000007266 259
296 3300025254 Ga0209148_1000033 Ga0209148_1000033363 259
297 3300025256 Ga0209759_1000026 Ga0209759_100002614 259
298 3300025258 Ga0209129_1000091 Ga0209129_100009170 259
299 3300025258 Ga0209129_1004863 Ga0209129_10048634 259
300 3300025263 Ga0209565_1000020 Ga0209565_1000020107 259
301 3300025263 Ga0209565_1000200 Ga0209565_100020020 259
302 3300025263 Ga0209565_1000270 Ga0209565_100027020 259
303 3300025263 Ga0209565_1000507 Ga0209565_100050713 259
304 3300025263 Ga0209565_1001022 Ga0209565_10010228 259
305 3300025263 Ga0209565_1027612 Ga0209565_10276122 259
306 3300025263 Ga0209565_1028856 Ga0209565_10288561 259
307 3300025273 Ga0209673_1000009 Ga0209673_1000009489 259
308 3300025273 Ga0209673_1000012 Ga0209673_1000012390 259
309 3300025273 Ga0209673_1000072 Ga0209673_100007293 259
310 3300025273 Ga0209673_1000154 Ga0209673_100015482 259
311 3300025273 Ga0209673_1000772 Ga0209673_100077231 259
312 3300025273 Ga0209673_1007609 Ga0209673_10076095 259
313 3300025284 Ga0209130_1000064 Ga0209130_1000064105 259
314 3300025284 Ga0209130_1000140 Ga0209130_100014022 259
315 3300025284 Ga0209130_1000203 Ga0209130_100020327 259
316 3300025284 Ga0209130_1000225 Ga0209130_100022550 259
317 3300025291 Ga0209675_1000014 Ga0209675_100001495 259
318 3300025291 Ga0209675_1000144 Ga0209675_100014454 259
319 3300025291 Ga0209675_1000447 Ga0209675_100044711 259
320 3300025291 Ga0209675_1001399 Ga0209675_100139910 259
321 3300025292 Ga0209676_1000051 Ga0209676_1000051254 259
322 3300025292 Ga0209676_1000088 Ga0209676_100008867 259
323 3300025292 Ga0209676_1000267 Ga0209676_100026790 259
324 3300025292 Ga0209676_1000966 Ga0209676_100096623 259
325 3300025292 Ga0209676_1002156 Ga0209676_100215614 259
326 3300025292 Ga0209676_1009167 Ga0209676_10091674 259
327 3300025294 Ga0209025_1000207 Ga0209025_100020726 259
328 3300025294 Ga0209025_1000356 Ga0209025_100035624 259
329 3300025294 Ga0209025_1001327 Ga0209025_100132712 259
330 3300025294 Ga0209025_1001509 Ga0209025_10015097 259
331 3300025294 Ga0209025_1007756 Ga0209025_10077563 259
332 3300025294 Ga0209025_1008400 Ga0209025_10084007 259
333 3300025294 Ga0209025_1013276 Ga0209025_10132763 259
334 3300025295 Ga0209564_1000103 Ga0209564_100010388 259
335 3300025295 Ga0209564_1000530 Ga0209564_100053053 259
336 3300025295 Ga0209564_1000797 Ga0209564_100079716 259
337 3300025295 Ga0209564_1000945 Ga0209564_100094516 259
338 3300025295 Ga0209564_1001673 Ga0209564_100167314 259
339 3300025297 Ga0209758_1000092 Ga0209758_100009278 259
340 3300025297 Ga0209758_1000327 Ga0209758_100032726 259
341 3300025297 Ga0209758_1010345 Ga0209758_10103456 259
342 3300025297 Ga0209758_1010394 Ga0209758_10103945 259
343 3300025297 Ga0209758_1015192 Ga0209758_10151925 259
344 3300025298 Ga0209050_1000044 Ga0209050_100004492 259
345 3300025298 Ga0209050_1000110 Ga0209050_1000110176 259
346 3300025298 Ga0209050_1000916 Ga0209050_100091627 259
347 3300025298 Ga0209050_1000983 Ga0209050_100098325 259
348 3300025298 Ga0209050_1005037 Ga0209050_10050379 259
349 3300025299 Ga0209256_1000003 Ga0209256_1000003644 259
350 3300025299 Ga0209256_1000036 Ga0209256_1000036353 259
351 3300025299 Ga0209256_1000065 Ga0209256_100006558 259
352 3300025299 Ga0209256_1000094 Ga0209256_100009448 259
353 3300025302 Ga0207426_1000084 Ga0207426_1000084181 259
354 3300025302 Ga0207426_1000116 Ga0207426_100011682 259
355 3300025302 Ga0207426_1000124 Ga0207426_100012431 259
356 3300025302 Ga0207426_1001529 Ga0207426_100152911 259
357 3300025303 Ga0209051_1000031 Ga0209051_100003192 259
358 3300025303 Ga0209051_1000069 Ga0209051_1000069135 259
359 3300025303 Ga0209051_1000114 Ga0209051_100011487 259
360 3300025303 Ga0209051_1000230 Ga0209051_10002303 259
361 3300025303 Ga0209051_1000379 Ga0209051_100037946 259
362 3300025303 Ga0209051_1000685 Ga0209051_100068523 259
363 3300025303 Ga0209051_1001139 Ga0209051_100113919 259
364 3300025303 Ga0209051_1001228 Ga0209051_100122811 259
365 3300025303 Ga0209051_1002160 Ga0209051_100216014 259
366 3300025304 Ga0209257_1000015 Ga0209257_1000015714 259
367 3300025304 Ga0209257_1000058 Ga0209257_100005886 259
368 3300025304 Ga0209257_1000093 Ga0209257_1000093177 259
369 3300025304 Ga0209257_1000141 Ga0209257_1000141140 259
370 3300025304 Ga0209257_1000575 Ga0209257_100057543 259
371 3300025321 Ga0207656_10007635 Ga0207656_100076353 259
372 3300025728 Ga0207655_1001961 Ga0207655_100196117 259
373 3300025899 Ga0207642_10169774 Ga0207642_101697741 259
374 3300025907 Ga0207645_10265362 Ga0207645_102653621 259
375 3300025909 Ga0207705_10352441 Ga0207705_103524411 259
376 3300025909 Ga0207705_10400712 Ga0207705_104007121 259
377 3300025910 Ga0207684_10053942 Ga0207684_100539422 259
378 3300025911 Ga0207654_10291750 Ga0207654_102917502 259
379 3300025913 Ga0207695_10005159 Ga0207695_100051599 259
380 3300025913 Ga0207695_10068733 Ga0207695_100687334 259
381 3300025913 Ga0207695_10163527 Ga0207695_101635272 259
382 3300025913 Ga0207695_10256385 Ga0207695_102563851 259
383 3300025914 Ga0207671_10013375 Ga0207671_100133753 259
384 3300025914 Ga0207671_10044087 Ga0207671_100440873 259
385 3300025914 Ga0207671_10252773 Ga0207671_102527732 259
386 3300025919 Ga0207657_10031330 Ga0207657_100313304 259
387 3300025919 Ga0207657_10186173 Ga0207657_101861731 259
388 3300025920 Ga0207649_10010410 Ga0207649_100104103 259
389 3300025920 Ga0207649_10136167 Ga0207649_101361671 259
390 3300025921 Ga0207652_10382497 Ga0207652_103824972 259
391 3300025923 Ga0207681_10002439 Ga0207681_1000243912 259
392 3300025923 Ga0207681_10170720 Ga0207681_101707201 259
393 3300025924 Ga0207694_10042635 Ga0207694_100426352 259
394 3300025931 Ga0207644_10186148 Ga0207644_101861481 259
395 3300025932 Ga0207690_10002101 Ga0207690_100021017 259
396 3300025932 Ga0207690_10022892 Ga0207690_100228923 259
397 3300025933 Ga0207706_10042818 Ga0207706_100428184 259
398 3300025934 Ga0207686_10011859 Ga0207686_100118595 259
399 3300025935 Ga0207709_10000076 Ga0207709_10000076132 259
400 3300025935 Ga0207709_10000472 Ga0207709_1000047223 259
401 3300025935 Ga0207709_10002379 Ga0207709_1000237910 259
402 3300025935 Ga0207709_10042383 Ga0207709_100423833 259
403 3300025940 Ga0207691_10015393 Ga0207691_100153935 259
404 3300025940 Ga0207691_10223290 Ga0207691_102232901 259
405 3300025942 Ga0207689_10137037 Ga0207689_101370372 259
406 3300025942 Ga0207689_10347778 Ga0207689_103477782 259
407 3300025945 Ga0207679_10000088 Ga0207679_100000887 259
408 3300025945 Ga0207679_10027321 Ga0207679_100273212 259
409 3300025949 Ga0207667_10039365 Ga0207667_100393656 259
410 3300025949 Ga0207667_10117417 Ga0207667_101174173 259
411 3300025960 Ga0207651_10013397 Ga0207651_100133973 259
412 3300025960 Ga0207651_10266560 Ga0207651_102665602 259
413 3300025981 Ga0207640_10320841 Ga0207640_103208411 259
414 3300026023 Ga0207677_10010744 Ga0207677_100107444 259
415 3300026023 Ga0207677_10014817 Ga0207677_100148174 259
416 3300026041 Ga0207639_10019378 Ga0207639_100193784 259
417 3300026041 Ga0207639_10139927 Ga0207639_101399272 259
418 3300026067 Ga0207678_10026992 Ga0207678_100269924 259
419 3300026088 Ga0207641_10523579 Ga0207641_105235791 259
420 3300026089 Ga0207648_10013164 Ga0207648_100131644 259
421 3300026089 Ga0207648_10065424 Ga0207648_100654242 259
422 3300026089 Ga0207648_10502337 Ga0207648_105023372 259
423 3300026116 Ga0207674_10016085 Ga0207674_100160857 259
424 3300026116 Ga0207674_10034413 Ga0207674_100344134 259
425 3300026116 Ga0207674_10362917 Ga0207674_103629172 259
426 3300026116 Ga0207674_10402966 Ga0207674_104029661 259
427 3300026116 Ga0207674_10434698 Ga0207674_104346982 259
428 3300026118 Ga0207675_100384680 Ga0207675_1003846802 259
429 3300026121 Ga0207683_10031829 Ga0207683_100318297 259
430 3300026121 Ga0207683_10276400 Ga0207683_102764003 259
431 3300026142 Ga0207698_10044076 Ga0207698_100440764 259
432 3300027111 Ga0209281_1000002 Ga0209281_1000002883 259
433 3300027111 Ga0209281_1000423 Ga0209281_100042345 259
434 3300027111 Ga0209281_1019020 Ga0209281_10190202 259
435 3300027666 Ga0209282_1000298 Ga0209282_100029825 259
436 3300027876 Ga0209974_10005128 Ga0209974_100051283 259
437 3300027876 Ga0209974_10016653 Ga0209974_100166532 259
438 3300028379 Ga0268266_10006260 Ga0268266_1000626014 259
439 3300028379 Ga0268266_10345295 Ga0268266_103452952 259
440 3300028380 Ga0268265_10174867 Ga0268265_101748672 259
441 3300028794 Ga0307515_10000419 Ga0307515_1000041934 259
442 3300028794 Ga0307515_10003462 Ga0307515_1000346224 259
443 3300028794 Ga0307515_10007779 Ga0307515_1000777910 259
444 3300028794 Ga0307515_10048555 Ga0307515_100485552 259
445 3300028794 Ga0307515_10149053 Ga0307515_101490532 259
446 3300028794 Ga0307515_10160465 Ga0307515_101604652 259
447 3300028794 Ga0307515_10196436 Ga0307515_101964363 259
448 3300030522 Ga0307512_10061877 Ga0307512_100618771 259
449 3300030732 Ga0316176_1093739 Ga0316176_10937392 259
450 3300030733 Ga0314311_1200241 Ga0314311_12002412 259
451 3300030734 Ga0316179_1078761 Ga0316179_10787613 259
452 3300030742 Ga0316183_1110470 Ga0316183_11104703 259
453 3300031235 Ga0265330_10000044 Ga0265330_1000004424 259
454 3300031235 Ga0265330_10037185 Ga0265330_100371852 259
455 3300031238 Ga0265332_10000046 Ga0265332_1000004672 259
456 3300031238 Ga0265332_10003009 Ga0265332_100030096 259
457 3300031241 Ga0265325_10013967 Ga0265325_100139673 259
458 3300031247 Ga0265340_10006278 Ga0265340_100062785 259
459 3300031251 Ga0265327_10000945 Ga0265327_100009453 259
460 3300031251 Ga0265327_10005555 Ga0265327_1000555511 259
461 3300031344 Ga0265316_10056195 Ga0265316_100561954 259
462 3300031456 Ga0307513_10000316 Ga0307513_1000031617 259
463 3300031456 Ga0307513_10029422 Ga0307513_100294227 259
464 3300031456 Ga0307513_10189360 Ga0307513_101893602 259
465 3300031456 Ga0307513_10350444 Ga0307513_103504441 259
466 3300031456 Ga0307513_10440379 Ga0307513_104403791 259
467 3300031507 Ga0307509_10000904 Ga0307509_100009049 259
468 3300031507 Ga0307509_10011898 Ga0307509_100118987 259
469 3300031507 Ga0307509_10154799 Ga0307509_101547992 259
470 3300031548 Ga0307408_100000229 Ga0307408_10000022941 259
471 3300031548 Ga0307408_100052417 Ga0307408_1000524172 259
472 3300031548 Ga0307408_100066336 Ga0307408_1000663362 259
473 3300031548 Ga0307408_100196146 Ga0307408_1001961462 259
474 3300031548 Ga0307408_100257436 Ga0307408_1002574362 259
475 3300031548 Ga0307408_100327357 Ga0307408_1003273572 259
476 3300031548 Ga0307408_100547679 Ga0307408_1005476791 259
477 3300031649 Ga0307514_10001645 Ga0307514_100016457 259
478 3300031649 Ga0307514_10005374 Ga0307514_1000537414 259
479 3300031649 Ga0307514_10017019 Ga0307514_100170192 259
480 3300031711 Ga0265314_10000130 Ga0265314_1000013024 259
481 3300031711 Ga0265314_10008127 Ga0265314_100081278 259
482 3300031712 Ga0265342_10027415 Ga0265342_100274152 259
483 3300031730 Ga0307516_10005347 Ga0307516_1000534711 259
484 3300031730 Ga0307516_10412981 Ga0307516_104129811 259
485 3300031731 Ga0307405_10071808 Ga0307405_100718082 259
486 3300031731 Ga0307405_10332780 Ga0307405_103327802 259
487 3300031824 Ga0307413_10056778 Ga0307413_100567781 259
488 3300031901 Ga0307406_10000319 Ga0307406_1000031921 259
489 3300031901 Ga0307406_10459303 Ga0307406_104593032 259
490 3300032002 Ga0307416_100035902 Ga0307416_1000359023 259
491 3300032005 Ga0307411_10088171 Ga0307411_100881712 259
492 3300033180 Ga0307510_10000122 Ga0307510_1000012221 259
493 3300033180 Ga0307510_10288971 Ga0307510_102889712 259
494 3300035114 Ga0373939_0048742 Ga0373939_0048742_130_918 259
495 3300035691 Ga0373931_0114117 Ga0373931_0114117_372_1160 259
496 3300035724 Ga0373933_0433548 Ga0373933_0433548_52_831 259
497 3300037068 Ga0373925_0013137 Ga0373925_0013137_4016_4804 259
498 3300037312 Ga0395899_0010475 Ga0395899_0010475_4320_5099 259
499 3300037418 Ga0395900_0038355 Ga0395900_0038355_4099_4878 259
500 3300037418 Ga0395900_0043581 Ga0395900_0043581_896_1675 259
501 3300037466 Ga0395898_0026798 Ga0395898_0026798_2830_3609 259
502 3300037466 Ga0395898_0051820 Ga0395898_0051820_2392_3171 259
503 3300037466 Ga0395898_0091650 Ga0395898_0091650_103_882 259
504 3300037466 Ga0395898_0834481 Ga0395898_0834481_37_831 259
505 3300037471 Ga0395905_0011798 Ga0395905_0011798_5858_6637 259
506 3300037471 Ga0395905_0014547 Ga0395905_0014547_1034_1828 259
507 3300037471 Ga0395905_0066757 Ga0395905_0066757_1562_2341 259
508 3300037471 Ga0395905_0081260 Ga0395905_0081260_90_869 259
509 3300037471 Ga0395905_0084626 Ga0395905_0084626_1205_1984 259
510 3300037471 Ga0395905_0177666 Ga0395905_0177666_1084_1878 259
511 3300037471 Ga0395905_0354791 Ga0395905_0354791_393_1172 259
512 3300041404 Ga0439436_0008463 Ga0439436_0008463_1174_1953 259
513 3300041406 Ga0439439_0010418 Ga0439439_0010418_904_1683 259
514 3300041406 Ga0439439_0011894 Ga0439439_0011894_682_1461 259
515 3300041413 Ga0439465_0004738 Ga0439465_0004738_1005_1784 259
516 3300041512 Ga0451853_2883190 Ga0451853_2883190_661_1458 259
517 3300041999 Ga0439433_0011584 Ga0439433_0011584_222_1001 259
518 3300042002 Ga0439442_009514 Ga0439442_009514_349_1128 259
519 3300042004 Ga0439445_0007498 Ga0439445_0007498_513_1292 259
520 3300042004 Ga0439445_0032908 Ga0439445_0032908_302_1108 259
521 3300042006 Ga0439432_001103 Ga0439432_001103_1616_2395 259
522 3300042006 Ga0439432_008450 Ga0439432_008450_2513_3292 259
523 3300042007 Ga0439449_0000682 Ga0439449_0000682_3969_4748 259
524 3300042007 Ga0439449_0002069 Ga0439449_0002069_6297_7076 259
525 3300042010 Ga0439452_004403 Ga0439452_004403_3535_4314 259
526 3300042010 Ga0439452_004644 Ga0439452_004644_3401_4180 259
527 3300042012 Ga0439455_0001526 Ga0439455_0001526_2553_3341 259
528 3300042014 Ga0439457_040827 Ga0439457_040827_193_972 259
529 3300042015 Ga0439462_0005434 Ga0439462_0005434_2057_2836 259
530 3300042121 Ga0450919_000440 Ga0450919_000440_2714_3493 259
531 3300042123 Ga0450921_000658 Ga0450921_000658_379_1158 259
532 3300042123 Ga0450921_001695 Ga0450921_001695_565_1344 259
533 3300042134 Ga0450898_007415 Ga0450898_007415_801_1580 259
534 3300042145 Ga0450906_005936 Ga0450906_005936_1457_2236 259
535 3300042156 Ga0439446_0029223 Ga0439446_0029223_777_1556 259
536 3300042157 Ga0439458_0066148 Ga0439458_0066148_29_808 259
537 3300042435 Ga0439434_0001557 Ga0439434_0001557_885_1664 259
538 3300042435 Ga0439434_0017164 Ga0439434_0017164_891_1670 259
539 3300042435 Ga0439434_0054867 Ga0439434_0054867_37_816 259
540 3300042531 Ga0450918_000195 Ga0450918_000195_11573_12352 259
541 3300042532 Ga0450893_0016345 Ga0450893_0016345_126_905 259
542 3300042876 Ga0451577_0004391 Ga0451577_0004391_5061_5840 259
543 3300044656 Ga0466969_0213469 Ga0466969_0213469_73_861 259
544 3300044673 Ga0453683_0007043 Ga0453683_0007043_2360_3139 259
545 3300044683 Ga0466965_0009394 Ga0466965_0009394_3216_4004 259
546 3300044683 Ga0466965_0022297 Ga0466965_0022297_2199_2978 259
547 3300044693 Ga0466961_0054566 Ga0466961_0054566_1327_2115 259
548 3300044706 Ga0466964_0003116 Ga0466964_0003116_944_1732 259
549 3300044712 Ga0453684_0079742 Ga0453684_0079742_2895_3674 259
550 3300044719 Ga0466971_0118285 Ga0466971_0118285_16_804 259
551 3300044842 Ga0466957_0071907 Ga0466957_0071907_1228_2016 259
552 3300044842 Ga0466957_0443580 Ga0466957_0443580_49_837 259
553 3300044901 Ga0466960_0050222 Ga0466960_0050222_88_876 259
554 3300045049 Ga0466959_0109790 Ga0466959_0109790_187_975 259
555 3300045051 Ga0451576_0020223 Ga0451576_0020223_1631_2410 259
556 3300045051 Ga0451576_0126897 Ga0451576_0126897_1438_2217 259
557 3300045836 Ga0466958_0342029 Ga0466958_0342029_94_882 259
558 3300045976 Ga0466967_0195272 Ga0466967_0195272_238_1026 259
559 3300046457 Ga0495590_0004862 Ga0495590_0004862_706_1500 259
560 3300046475 Ga0495639_0002239 Ga0495639_0002239_3991_4770 259
561 3300046513 Ga0495616_0000288 Ga0495616_0000288_31682_32461 259
562 3300046518 Ga0495631_0000187 Ga0495631_0000187_11797_12576 259
563 3300046519 Ga0495632_0009885 Ga0495632_0009885_4801_5589 259
564 3300046520 Ga0495637_0000830 Ga0495637_0000830_10942_11721 259
565 3300046522 Ga0495643_0050204 Ga0495643_0050204_356_1144 259
566 3300046528 Ga0495642_0045448 Ga0495642_0045448_154_933 259
567 3300046528 Ga0495642_0145725 Ga0495642_0145725_170_949 259
568 3300046530 Ga0495654_0004560 Ga0495654_0004560_3466_4245 259
569 3300046539 Ga0495621_0011136 Ga0495621_0011136_756_1535 259
570 3300046542 Ga0495597_0009303 Ga0495597_0009303_1345_2133 259
571 3300046557 Ga0495622_0068598 Ga0495622_0068598_336_1124 259
572 3300046558 Ga0495633_0029065 Ga0495633_0029065_669_1448 259
573 3300046615 Ga0495656_0001085 Ga0495656_0001085_4418_5197 259
574 3300046616 Ga0495668_0197976 Ga0495668_0197976_194_982 259
575 3300046660 Ga0495625_0001236 Ga0495625_0001236_8088_8867 259
576 3300046660 Ga0495625_0041071 Ga0495625_0041071_1693_2481 259
577 3300046660 Ga0495625_0047397 Ga0495625_0047397_1631_2410 259
578 3300046665 Ga0495661_0138377 Ga0495661_0138377_477_1256 259
579 3300046674 Ga0495588_0007292 Ga0495588_0007292_1209_1988 259
580 3300046674 Ga0495588_0182152 Ga0495588_0182152_206_985 259
581 3300046683 Ga0495658_0388872 Ga0495658_0388872_84_872 259
582 3300046690 Ga0495624_0076460 Ga0495624_0076460_413_1201 259
583 3300046691 Ga0495670_0062043 Ga0495670_0062043_980_1759 259
584 3300046692 Ga0495671_0007995 Ga0495671_0007995_4908_5687 259
585 3300046694 Ga0495649_0013765 Ga0495649_0013765_1182_1970 259
586 3300046810 Ga0495660_0055595 Ga0495660_0055595_544_1332 259
587 3300047321 Ga0495676_0032357 Ga0495676_0032357_3528_4307 259
588 3300047443 Ga0495687_000327 Ga0495687_000327_55128_55916 259
589 3300047445 Ga0495677_0013572 Ga0495677_0013572_826_1605 259
590 3300047470 Ga0495681_0087967 Ga0495681_0087967_301_1080 259
591 3300047673 Ga0495593_0008355 Ga0495593_0008355_3846_4625 259
592 3300047673 Ga0495593_0168172 Ga0495593_0168172_115_894 259
593 3300048091 Ga0495626_0027261 Ga0495626_0027261_1675_2463 259
594 3300048903 Ga0496100_0025814 Ga0496100_0025814_2774_3553 259
595 3300048904 Ga0496101_0001647 Ga0496101_0001647_5931_6710 259
596 3300048904 Ga0496101_0013086 Ga0496101_0013086_1006_1785 259
597 3300048905 Ga0496102_0071013 Ga0496102_0071013_235_1014 259
598 3300048907 Ga0496104_0024430 Ga0496104_0024430_2895_3674 259
599 3300048908 Ga0496105_0011915 Ga0496105_0011915_2121_2900 259
600 3300048912 Ga0496109_0210562 Ga0496109_0210562_640_1419 259
601 3300048912 Ga0496109_0341157 Ga0496109_0341157_132_920 259
602 3300048913 Ga0496110_0076278 Ga0496110_0076278_64_843 259
603 3300048916 Ga0496113_0115852 Ga0496113_0115852_710_1489 259
604 3300048919 Ga0496116_0122546 Ga0496116_0122546_634_1413 259
605 3300048924 Ga0496121_0071081 Ga0496121_0071081_883_1662 259
606 3300048925 Ga0496122_0000324 Ga0496122_0000324_76882_77661 259
607 3300048926 Ga0496123_0000160 Ga0496123_0000160_64493_65272 259
608 3300048926 Ga0496123_0124326 Ga0496123_0124326_602_1381 259
609 3300048927 Ga0496124_0073204 Ga0496124_0073204_1401_2189 259
610 3300048928 Ga0496125_0010589 Ga0496125_0010589_7724_8530 259
611 3300048928 Ga0496125_0013806 Ga0496125_0013806_5882_6661 259
612 3300048928 Ga0496125_0078801 Ga0496125_0078801_739_1518 259
613 3300048929 Ga0496126_0246918 Ga0496126_0246918_89_868 259
614 3300049568 Ga0501031_0033045 Ga0501031_0033045_1720_2529 259
615 3300049686 Ga0501257_088789 Ga0501257_088789_11_790 259
616 3300049759 Ga0501262_003744 Ga0501262_003744_191_970 259
617 3300049823 Ga0501044_0680562 Ga0501044_0680562_75_854 259
618 3300050489 nmdc:mga03683_11698_c1 nmdc:mga03683_11698_c1_2027_2806 259
619 3300050489 nmdc:mga03683_23445_c1 nmdc:mga03683_23445_c1_1005_1820 259
620 3300050489 nmdc:mga03683_26319_c1 nmdc:mga03683_26319_c1_475_1263 259
621 3300050489 nmdc:mga03683_451_c1 nmdc:mga03683_451_c1_3072_3851 259
622 3300050490 nmdc:mga03n38_27152_c1 nmdc:mga03n38_27152_c1_475_1263 259
623 3300050491 nmdc:mga00v17_13181_c1 nmdc:mga00v17_13181_c1_1075_1863 259
624 3300050492 nmdc:mga0yw44_10136_c1 nmdc:mga0yw44_10136_c1_2417_3196 259
625 3300050492 nmdc:mga0yw44_77697_c1 nmdc:mga0yw44_77697_c1_279_1067 259
626 3300050493 nmdc:mga0k408_10712_c1 nmdc:mga0k408_10712_c1_3617_4405 259
627 3300050493 nmdc:mga0k408_21637_c1 nmdc:mga0k408_21637_c1_361_1140 259
628 3300050493 nmdc:mga0k408_31612_c1 nmdc:mga0k408_31612_c1_1431_2219 259
629 3300050493 nmdc:mga0k408_43748_c1 nmdc:mga0k408_43748_c1_538_1326 259
630 3300050493 nmdc:mga0k408_52493_c1 nmdc:mga0k408_52493_c1_721_1509 259
631 3300050493 nmdc:mga0k408_73747_c1 nmdc:mga0k408_73747_c1_800_1588 259
632 3300050494 nmdc:mga06z11_157852_c1 nmdc:mga06z11_157852_c1_448_1227 259
633 3300050496 nmdc:mga07m45_110669_c1 nmdc:mga07m45_110669_c1_223_1011 259
634 3300050496 nmdc:mga07m45_13783_c1 nmdc:mga07m45_13783_c1_2608_3387 259
635 3300050496 nmdc:mga07m45_13783_c1 nmdc:mga07m45_13783_c1_908_1687 259
636 3300050496 nmdc:mga07m45_28985_c1 nmdc:mga07m45_28985_c1_1168_1947 259
637 3300050516 nmdc:mga0sz30_26342_c1 nmdc:mga0sz30_26342_c1_583_1371 259
638 3300050516 nmdc:mga0sz30_55858_c1 nmdc:mga0sz30_55858_c1_285_1100 259
639 3300050516 nmdc:mga0sz30_83571_c1 nmdc:mga0sz30_83571_c1_388_1167 259
640 3300053093 Ga0500651_0000267 Ga0500651_0000267_27297_28076 259
641 3300053117 Ga0500593_000228 Ga0500593_000228_1473_2252 259
642 3300053121 Ga0500607_001572 Ga0500607_001572_8593_9372 259
643 3300053122 Ga0500608_048380 Ga0500608_048380_1022_1801 259
644 3300053134 Ga0500658_0000239 Ga0500658_0000239_11189_11968 259
645 3300053134 Ga0500658_0000484 Ga0500658_0000484_2636_3415 259
646 3300053136 Ga0500559_0012276 Ga0500559_0012276_526_1305 259
647 3300053148 Ga0500590_051358 Ga0500590_051358_708_1496 259
648 3300053158 Ga0500627_0040034 Ga0500627_0040034_1213_1992 259
649 3300053730 Ga0500645_000574 Ga0500645_000574_17290_18084 259
650 3300059424 Ga0590075_016087 Ga0590075_016087_413_1192 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

51

300

0.96

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

56

238

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xzd-assembly1.cif.gz_F structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism 0.9708 3 235
3moy-assembly1.cif.gz_A crystal structure of probable enoyl-coa hydratase from mycobacterium smegmatis 0.9693 1 255
5xzd-assembly1.cif.gz_F structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism 0.9664 3 235
4fjw-assembly1.cif.gz_D crystal structure of the apo form of the e131q mtb crotonase 0.9663 1 256
3h81-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis 0.9637 2 258
ID Description Score Start End Superfamily
af_Q7ZZ04_32_233_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.972 1 199 3.90.226.10
af_Q54BX7_16_236_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9714 2 194 3.90.226.10
4fzwB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9645 2 197 3.90.226.10
2qq3L01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9599 3 198 3.90.226.10
af_Q7ZZ04_32_233_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9532 1 199 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A0L0DKA5-F1-model_v4 Enoyl-CoA hydratase 0.9795 2 211 GO:0005739
GO:0006635
GO:0016836
AF-A0A640JBL3-F1-model_v4 deleted 0.979 1 258
AF-A0A7S3ZB57-F1-model_v4 Enoyl-CoA hydratase 0.9785 1 205 GO:0005739
GO:0006635
GO:0016836
AF-A0A7J7AMY3-F1-model_v4 deleted 0.9776 1 216
AF-A0A6V7GZV5-F1-model_v4 Enoyl-CoA hydratase 0.9775 1 213 GO:0005739
GO:0006635
GO:0016836

Feature Viewer

pLDDT pTM Quality
93.48 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map