F472482

General Info

Members Datasets Scaffolds Average Seq Length
649 239 649 332

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_249115_c1|nmdc:mga09592_249115_c1_255_1241
Length 328
Sequence MRLDLHTHFYTEHFFKMILHLPSDFSFGTSSTGQTIITYRGARFFGVTPAMTDVNKRIEDMDRAGIDVEVVSLSTPNVFFADAQHQPEVARMMNDFYAELIALHPKRFKGFASIPMDAPDAALDELHRAIDTLKLNGVILLSNIGGQPLTSPRYRAFFEEANRMKLCIFLHPMLPAGNSDSFREYVLGPIIGFPFDTSLAVARMCYDGMFEELPDIRWIIGHLGGAVPYLMERMDNGFRDFADCRVKIDKLPSVYLKRLYYDTVSFSPHTLMMVRNMVGADHMVMGSDYPHLLGSIDRAVTSIEGLEISEQEKTQIFSGTALQILNNV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
203 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
204 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
211 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
212 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
213 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
234 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
235 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 1.85
Rhizosphere 95.38
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3631794 2162886007 Unclassified 1264
2 CNAas_1001041 3300000532 Unclassified 2555
3 JGI24034J14986_100094 3300001432 Bacteria 3749
4 JGI24748J21848_1000001 3300002074 Bacteria 444271
5 JGI24034J26672_10000001 3300002239 Bacteria 1118280
6 JGI24751J29686_10000109 3300002459 Bacteria 43362
7 JGI24751J29686_10014682 3300002459 Bacteria 1616
8 JGI25406J46586_10027947 3300003203 Bacteria 2155
9 Ga0065714_10064496 3300005288 Bacteria 48442
10 Ga0065712_10000123 3300005290 Bacteria 89338
11 Ga0065712_10003222 3300005290 Bacteria 5166
12 Ga0065712_10008191 3300005290 Unclassified 2589
13 Ga0065712_10113064 3300005290 Bacteria 1789
14 Ga0065712_10115535 3300005290 Bacteria 1750
15 Ga0065712_10151656 3300005290 Bacteria 1365
16 Ga0065715_10007224 3300005293 Unclassified 2797
17 Ga0065715_10099279 3300005293 Bacteria 3375
18 Ga0065715_10102128 3300005293 Bacteria 3141
19 Ga0065715_10153163 3300005293 Bacteria 1706
20 Ga0065715_10199947 3300005293 Bacteria 1367
21 Ga0065715_10261560 3300005293 Bacteria 1136
22 Ga0065707_10106495 3300005295 Unclassified 2593
23 Ga0065707_10178833 3300005295 Bacteria 1432
24 Ga0070676_10183141 3300005328 Bacteria 1363
25 Ga0070690_100012341 3300005330 Bacteria 5026
26 Ga0070690_100019832 3300005330 Bacteria 4090
27 Ga0070670_100000876 3300005331 Bacteria 23661
28 Ga0070670_100016061 3300005331 Bacteria 6425
29 Ga0070670_100196000 3300005331 Bacteria 1755
30 Ga0070670_100215218 3300005331 Bacteria 1671
31 Ga0068869_100006969 3300005334 Bacteria 7194
32 Ga0068869_100055707 3300005334 Bacteria 2882
33 Ga0068869_100123637 3300005334 Bacteria 1982
34 Ga0070666_10131065 3300005335 Bacteria 1742
35 Ga0070680_100038601 3300005336 Bacteria 3862
36 Ga0070680_100178026 3300005336 Bacteria 1790
37 Ga0070682_100004044 3300005337 Bacteria 8151
38 Ga0068868_100149770 3300005338 Bacteria 1921
39 Ga0068868_100158548 3300005338 Bacteria 1867
40 Ga0068868_100334881 3300005338 Bacteria 1292
41 Ga0070660_100031470 3300005339 Unclassified 3985
42 Ga0070689_100000428 3300005340 Bacteria 24792
43 Ga0070689_100040774 3300005340 Bacteria 3560
44 Ga0070689_100073380 3300005340 Bacteria 2676
45 Ga0070689_100322854 3300005340 Unclassified 1290
46 Ga0070687_100009970 3300005343 Unclassified 4087
47 Ga0070687_100064569 3300005343 Bacteria 1945
48 Ga0070687_100108661 3300005343 Bacteria 1566
49 Ga0070692_10021963 3300005345 Bacteria 3112
50 Ga0070692_10092310 3300005345 Bacteria 1647
51 Ga0070669_100027390 3300005353 Bacteria 4101
52 Ga0070669_100191842 3300005353 Bacteria 1603
53 Ga0070675_100056278 3300005354 Bacteria 3240
54 Ga0070675_100347512 3300005354 Bacteria 1315
55 Ga0070671_100028519 3300005355 Unclassified 4597
56 Ga0070671_100355497 3300005355 Bacteria 1251
57 Ga0070674_100056702 3300005356 Bacteria 2717
58 Ga0070673_100113909 3300005364 Bacteria 2246
59 Ga0070673_100160918 3300005364 Bacteria 1909
60 Ga0070673_100356340 3300005364 Bacteria 1300
61 Ga0070688_100100120 3300005365 Bacteria 1909
62 Ga0070659_100004392 3300005366 Bacteria 10070
63 Ga0070703_10000016 3300005406 Bacteria 86253
64 Ga0070703_10059597 3300005406 Bacteria 1245
65 Ga0070709_10000006 3300005434 Bacteria 186534
66 Ga0070701_10072558 3300005438 Unclassified 1844
67 Ga0070701_10144232 3300005438 Unclassified 1365
68 Ga0070701_10156323 3300005438 Unclassified 1317
69 Ga0070711_100000051 3300005439 Bacteria 73775
70 Ga0070705_100000696 3300005440 Bacteria 19155
71 Ga0070705_100023912 3300005440 Bacteria 3289
72 Ga0070705_100026598 3300005440 Bacteria 3151
73 Ga0070705_100047944 3300005440 Bacteria 2472
74 Ga0070700_100000062 3300005441 Bacteria 79866
75 Ga0070700_100003264 3300005441 Bacteria 8356
76 Ga0070700_100004838 3300005441 Bacteria 7071
77 Ga0070700_100008899 3300005441 Bacteria 5490
78 Ga0070700_100190431 3300005441 Bacteria 1434
79 Ga0070700_100250878 3300005441 Bacteria 1269
80 Ga0070694_100007641 3300005444 Bacteria 6599
81 Ga0070694_100010574 3300005444 Bacteria 5698
82 Ga0070694_100019905 3300005444 Bacteria 4273
83 Ga0070694_100022235 3300005444 Unclassified 4061
84 Ga0070694_100089345 3300005444 Bacteria 2159
85 Ga0070708_100020861 3300005445 Bacteria 5532
86 Ga0070708_100056928 3300005445 Bacteria 3479
87 Ga0070708_100060297 3300005445 Unclassified 3386
88 Ga0070708_100129277 3300005445 Bacteria 2337
89 Ga0070662_100029352 3300005457 Unclassified 3838
90 Ga0070662_100257364 3300005457 Bacteria 1405
91 Ga0070681_10003045 3300005458 Bacteria 15543
92 Ga0070681_10012847 3300005458 Bacteria 8315
93 Ga0070681_10062544 3300005458 Unclassified 3696
94 Ga0068867_100051030 3300005459 Unclassified 3050
95 Ga0068867_100067049 3300005459 Bacteria 2674
96 Ga0068867_100086562 3300005459 Bacteria 2371
97 Ga0068867_100092167 3300005459 Unclassified 2301
98 Ga0070706_100000137 3300005467 Bacteria 91778
99 Ga0070706_100000689 3300005467 Bacteria 38267
100 Ga0070706_100000746 3300005467 Bacteria 36612
101 Ga0070706_100001693 3300005467 Bacteria 22957
102 Ga0070706_100006487 3300005467 Bacteria 11045
103 Ga0070706_100009200 3300005467 Bacteria 9199
104 Ga0070706_100011920 3300005467 Bacteria 8070
105 Ga0070706_100017853 3300005467 Bacteria 6546
106 Ga0070706_100020638 3300005467 Bacteria 6071
107 Ga0070706_100037010 3300005467 Bacteria 4508
108 Ga0070706_100104396 3300005467 Unclassified 2636
109 Ga0070706_100105625 3300005467 Unclassified 2620
110 Ga0070706_100246007 3300005467 Bacteria 1670
111 Ga0070706_100264256 3300005467 Bacteria 1606
112 Ga0070707_100000081 3300005468 Bacteria 85320
113 Ga0070707_100011165 3300005468 Bacteria 8369
114 Ga0070707_100011799 3300005468 Bacteria 8159
115 Ga0070707_100012982 3300005468 Bacteria 7783
116 Ga0070707_100070567 3300005468 Unclassified 3365
117 Ga0070707_100077992 3300005468 Bacteria 3196
118 Ga0070707_100145636 3300005468 Unclassified 2305
119 Ga0070698_100000107 3300005471 Bacteria 69457
120 Ga0070698_100003825 3300005471 Bacteria 16544
121 Ga0070698_100008313 3300005471 Bacteria 11221
122 Ga0070698_100013741 3300005471 Bacteria 8569
123 Ga0070698_100015062 3300005471 Bacteria 8175
124 Ga0070698_100022491 3300005471 Bacteria 6596
125 Ga0070698_100037232 3300005471 Bacteria 5017
126 Ga0070698_100083257 3300005471 Bacteria 3189
127 Ga0070698_100230793 3300005471 Bacteria 1784
128 Ga0070699_100000083 3300005518 Bacteria 89561
129 Ga0070699_100012438 3300005518 Bacteria 7344
130 Ga0070699_100015800 3300005518 Bacteria 6481
131 Ga0070699_100139539 3300005518 Bacteria 2140
132 Ga0070699_100143380 3300005518 Unclassified 2110
133 Ga0070699_100197197 3300005518 Bacteria 1790
134 Ga0070679_100000047 3300005530 Bacteria 90654
135 Ga0070679_100477664 3300005530 Unclassified 1191
136 Ga0070697_100001026 3300005536 Bacteria 21075
137 Ga0070697_100012574 3300005536 Bacteria 6630
138 Ga0070697_100260769 3300005536 Bacteria 1484
139 Ga0070697_100281709 3300005536 Bacteria 1426
140 Ga0070672_100144408 3300005543 Bacteria 1965
141 Ga0070686_100033913 3300005544 Bacteria 3140
142 Ga0070686_100045111 3300005544 Bacteria 2775
143 Ga0070695_100051581 3300005545 Bacteria 2640
144 Ga0070695_100075494 3300005545 Bacteria 2218
145 Ga0070695_100094848 3300005545 Bacteria 1999
146 Ga0070695_100135131 3300005545 Bacteria 1704
147 Ga0070696_100000738 3300005546 Bacteria 20879
148 Ga0070696_100056427 3300005546 Bacteria 2739
149 Ga0070693_100033630 3300005547 Bacteria 2831
150 Ga0070665_100176054 3300005548 Bacteria 2140
151 Ga0070665_100472762 3300005548 Unclassified 1264
152 Ga0070704_100003599 3300005549 Bacteria 8903
153 Ga0070704_100009963 3300005549 Bacteria 5771
154 Ga0070704_100014338 3300005549 Bacteria 4949
155 Ga0070704_100023137 3300005549 Bacteria 4052
156 Ga0070704_100042452 3300005549 Bacteria 3146
157 Ga0070704_100044725 3300005549 Bacteria 3079
158 Ga0070704_100059680 3300005549 Bacteria 2722
159 Ga0070704_100162844 3300005549 Unclassified 1766
160 Ga0070704_100258725 3300005549 Bacteria 1433
161 Ga0068855_100199075 3300005563 Bacteria 2256
162 Ga0068855_100245074 3300005563 Bacteria 2000
163 Ga0070664_100003326 3300005564 Bacteria 12992
164 Ga0068857_100006924 3300005577 Bacteria 9756
165 Ga0068857_100009546 3300005577 Bacteria 8427
166 Ga0068857_100260180 3300005577 Bacteria 1592
167 Ga0068856_100080156 3300005614 Bacteria 3238
168 Ga0070702_100011698 3300005615 Bacteria 4373
169 Ga0070702_100132215 3300005615 Bacteria 1578
170 Ga0068852_100067674 3300005616 Bacteria 3123
171 Ga0068852_100206871 3300005616 Bacteria 1860
172 Ga0068852_100319007 3300005616 Unclassified 1508
173 Ga0068859_100002197 3300005617 Bacteria 19807
174 Ga0068859_100006037 3300005617 Bacteria 12300
175 Ga0068859_100006648 3300005617 Bacteria 11744
176 Ga0068859_100064763 3300005617 Unclassified 3688
177 Ga0068859_100076248 3300005617 Unclassified 3393
178 Ga0068859_100124300 3300005617 Unclassified 2648
179 Ga0068859_100184032 3300005617 Bacteria 2172
180 Ga0068859_100196708 3300005617 Bacteria 2100
181 Ga0068859_100213936 3300005617 Unclassified 2014
182 Ga0068859_100297677 3300005617 Bacteria 1707
183 Ga0068864_100007415 3300005618 Bacteria 9032
184 Ga0068864_100021405 3300005618 Bacteria 5417
185 Ga0068864_100029783 3300005618 Bacteria 4626
186 Ga0068864_100080416 3300005618 Unclassified 2855
187 Ga0068864_100227406 3300005618 Bacteria 1724
188 Ga0068864_100256167 3300005618 Bacteria 1626
189 Ga0068866_10001186 3300005718 Bacteria 11388
190 Ga0068861_100022555 3300005719 Bacteria 4538
191 Ga0068861_100022865 3300005719 Unclassified 4507
192 Ga0068870_10144581 3300005840 Bacteria 1394
193 Ga0068863_100067078 3300005841 Unclassified 3394
194 Ga0068863_100078355 3300005841 Bacteria 3129
195 Ga0068863_100306011 3300005841 Unclassified 1542
196 Ga0068863_100414096 3300005841 Bacteria 1319
197 Ga0068858_100000044 3300005842 Bacteria 128977
198 Ga0068858_100011114 3300005842 Bacteria 8511
199 Ga0068858_100077403 3300005842 Unclassified 3090
200 Ga0068858_100084246 3300005842 Bacteria 2957
201 Ga0068858_100106671 3300005842 Bacteria 2615
202 Ga0068858_100115221 3300005842 Bacteria 2511
203 Ga0068858_100246115 3300005842 Unclassified 1698
204 Ga0068858_100328909 3300005842 Bacteria 1462
205 Ga0068860_100027304 3300005843 Bacteria 5500
206 Ga0068860_100103763 3300005843 Bacteria 2714
207 Ga0068860_100132324 3300005843 Bacteria 2394
208 Ga0068860_100140083 3300005843 Bacteria 2324
209 Ga0068860_100141115 3300005843 Bacteria 2316
210 Ga0068860_100233533 3300005843 Unclassified 1788
211 Ga0068860_100431934 3300005843 Bacteria 1307
212 Ga0068862_100008290 3300005844 Bacteria 8598
213 Ga0068862_100014370 3300005844 Bacteria 6567
214 Ga0068862_100278425 3300005844 Bacteria 1532
215 Ga0081455_10047437 3300005937 Bacteria 3720
216 Ga0081455_10100978 3300005937 Bacteria 2316
217 Ga0081540_1070278 3300005983 Bacteria 1622
218 Ga0081539_10000887 3300005985 Bacteria 57193
219 Ga0075365_10028836 3300006038 Bacteria 3542
220 Ga0075364_10035347 3300006051 Bacteria 3228
221 Ga0070716_100000004 3300006173 Bacteria 296614
222 Ga0070716_100216352 3300006173 Unclassified 1284
223 Ga0070712_100050786 3300006175 Bacteria 2887
224 Ga0075362_10002309 3300006177 Bacteria 6375
225 Ga0075367_10014809 3300006178 Bacteria 4225
226 Ga0075366_10051168 3300006195 Bacteria 2454
227 Ga0097621_100009292 3300006237 Bacteria 7134
228 Ga0097621_100018054 3300006237 Bacteria 5378
229 Ga0097621_100043674 3300006237 Bacteria 3614
230 Ga0068871_100021032 3300006358 Bacteria 5008
231 Ga0068871_100021401 3300006358 Bacteria 4970
232 Ga0075428_100009182 3300006844 Bacteria 10968
233 Ga0075428_100015913 3300006844 Bacteria 8322
234 Ga0075428_100096868 3300006844 Bacteria 3216
235 Ga0075428_100169084 3300006844 Bacteria 2371
236 Ga0075428_100336825 3300006844 Bacteria 1620
237 Ga0075431_100013940 3300006847 Bacteria 8119
238 Ga0075431_100016154 3300006847 Bacteria 7574
239 Ga0075431_100041399 3300006847 Bacteria 4749
240 Ga0075433_10095985 3300006852 Bacteria 2624
241 Ga0075433_10096947 3300006852 Bacteria 2610
242 Ga0075433_10104884 3300006852 Bacteria 2504
243 Ga0075433_10238704 3300006852 Bacteria 1613
244 Ga0075434_100034377 3300006871 Bacteria 5005
245 Ga0075434_100092528 3300006871 Bacteria 3026
246 Ga0075434_100203541 3300006871 Bacteria 2000
247 Ga0075434_100341969 3300006871 Bacteria 1517
248 Ga0075429_100044853 3300006880 Unclassified 3846
249 Ga0068865_100161034 3300006881 Unclassified 1712
250 Ga0075436_100001301 3300006914 Bacteria 16968
251 Ga0075436_100004655 3300006914 Bacteria 9399
252 Ga0075436_100245711 3300006914 Bacteria 1273
253 Ga0097620_100002197 3300006931 Bacteria 19807
254 Ga0097620_100006037 3300006931 Bacteria 12300
255 Ga0097620_100006648 3300006931 Bacteria 11744
256 Ga0097620_100064764 3300006931 Unclassified 3688
257 Ga0097620_100076249 3300006931 Unclassified 3393
258 Ga0097620_100124297 3300006931 Unclassified 2648
259 Ga0097620_100184024 3300006931 Bacteria 2172
260 Ga0097620_100196705 3300006931 Bacteria 2100
261 Ga0097620_100213937 3300006931 Unclassified 2014
262 Ga0097620_100297680 3300006931 Bacteria 1707
263 Ga0075435_100000292 3300007076 Bacteria 31075
264 Ga0075435_100046663 3300007076 Unclassified 3476
265 Ga0075435_100069186 3300007076 Bacteria 2877
266 Ga0075435_100080087 3300007076 Bacteria 2681
267 Ga0075435_100085714 3300007076 Bacteria 2593
268 Ga0105240_10072884 3300009093 Unclassified 4243
269 Ga0111539_10058991 3300009094 Bacteria 4552
270 Ga0111539_10060008 3300009094 Unclassified 4508
271 Ga0111539_10200113 3300009094 Unclassified 2329
272 Ga0111539_10279905 3300009094 Bacteria 1941
273 Ga0105245_10253483 3300009098 Bacteria 1710
274 Ga0105247_10000004 3300009101 Bacteria 455497
275 Ga0105247_10001464 3300009101 Bacteria 17002
276 Ga0105247_10009326 3300009101 Bacteria 5957
277 Ga0105247_10298939 3300009101 Bacteria 1116
278 Ga0114129_10003077 3300009147 Bacteria 23398
279 Ga0114129_10007145 3300009147 Bacteria 15890
280 Ga0114129_10013377 3300009147 Bacteria 11693
281 Ga0114129_10028310 3300009147 Bacteria 7939
282 Ga0114129_10031498 3300009147 Bacteria 7496
283 Ga0114129_10052996 3300009147 Bacteria 5691
284 Ga0114129_10074786 3300009147 Unclassified 4718
285 Ga0114129_10095175 3300009147 Bacteria 4125
286 Ga0114129_10106750 3300009147 Unclassified 3868
287 Ga0114129_10272910 3300009147 Bacteria 2262
288 Ga0114129_10292442 3300009147 Bacteria 2173
289 Ga0105243_10000240 3300009148 Bacteria 62821
290 Ga0105243_10000573 3300009148 Bacteria 36983
291 Ga0105243_10035191 3300009148 Bacteria 3881
292 Ga0105243_10247541 3300009148 Unclassified 1590
293 Ga0105241_10017940 3300009174 Bacteria 5204
294 Ga0105241_10133211 3300009174 Bacteria 2014
295 Ga0105242_10000222 3300009176 Bacteria 44723
296 Ga0105242_10001271 3300009176 Bacteria 19930
297 Ga0105242_10010557 3300009176 Bacteria 7092
298 Ga0105242_10015359 3300009176 Bacteria 5946
299 Ga0105242_10017782 3300009176 Bacteria 5547
300 Ga0105242_10308045 3300009176 Bacteria 1448
301 Ga0105248_10008970 3300009177 Bacteria 10996
302 Ga0105248_10022191 3300009177 Bacteria 7038
303 Ga0105248_10055195 3300009177 Bacteria 4455
304 Ga0105248_10084538 3300009177 Bacteria 3569
305 Ga0105248_10109336 3300009177 Bacteria 3117
306 Ga0105248_10160290 3300009177 Bacteria 2538
307 Ga0105248_10172833 3300009177 Bacteria 2435
308 Ga0105248_10177888 3300009177 Bacteria 2397
309 Ga0105248_10207042 3300009177 Bacteria 2210
310 Ga0105248_10271234 3300009177 Bacteria 1911
311 Ga0105237_10000334 3300009545 Bacteria 66523
312 Ga0105237_10109188 3300009545 Bacteria 2758
313 Ga0105238_10010300 3300009551 Bacteria 9379
314 Ga0105249_10006116 3300009553 Bacteria 10441
315 Ga0105249_10018220 3300009553 Bacteria 6241
316 Ga0105249_10020906 3300009553 Bacteria 5853
317 Ga0105249_10029641 3300009553 Bacteria 4943
318 Ga0105249_10046928 3300009553 Bacteria 3933
319 Ga0105249_10063970 3300009553 Bacteria 3381
320 Ga0105249_10106369 3300009553 Unclassified 2647
321 Ga0105239_10102080 3300010375 Unclassified 3174
322 Ga0105239_10698847 3300010375 Unclassified 1159
323 Ga0105246_10027558 3300011119 Unclassified 3724
324 Ga0157373_10004904 3300013100 Bacteria 10074
325 Ga0157373_10065994 3300013100 Bacteria 2561
326 Ga0157371_10065740 3300013102 Bacteria 2568
327 Ga0157374_10026240 3300013296 Bacteria 5242
328 Ga0157378_10000025 3300013297 Bacteria 128568
329 Ga0157378_10026893 3300013297 Bacteria 5074
330 Ga0157378_10043708 3300013297 Bacteria 3978
331 Ga0157378_10058112 3300013297 Bacteria 3449
332 Ga0157378_10070099 3300013297 Unclassified 3147
333 Ga0157378_10072694 3300013297 Bacteria 3090
334 Ga0157378_10075670 3300013297 Bacteria 3032
335 Ga0157378_10405712 3300013297 Bacteria 1344
336 Ga0163162_10008906 3300013306 Bacteria 9758
337 Ga0163162_10011757 3300013306 Bacteria 8538
338 Ga0163162_10016001 3300013306 Bacteria 7332
339 Ga0163162_10098561 3300013306 Unclassified 3012
340 Ga0163162_10144974 3300013306 Bacteria 2490
341 Ga0163162_10312777 3300013306 Bacteria 1703
342 Ga0163162_10314110 3300013306 Bacteria 1700
343 Ga0157372_10004643 3300013307 Bacteria 14598
344 Ga0157372_10343093 3300013307 Bacteria 1740
345 Ga0157375_10049802 3300013308 Bacteria 4106
346 Ga0157375_10067012 3300013308 Bacteria 3586
347 Ga0157375_10196996 3300013308 Bacteria 2169
348 Ga0157375_10328158 3300013308 Unclassified 1695
349 Ga0163163_10004395 3300014325 Bacteria 12012
350 Ga0163163_10009284 3300014325 Bacteria 8772
351 Ga0163163_10021104 3300014325 Bacteria 6144
352 Ga0163163_10043112 3300014325 Bacteria 4422
353 Ga0163163_10104899 3300014325 Unclassified 2852
354 Ga0163163_10249018 3300014325 Bacteria 1827
355 Ga0163163_10311915 3300014325 Bacteria 1626
356 Ga0163163_10552382 3300014325 Unclassified 1214
357 Ga0163163_10640946 3300014325 Unclassified 1126
358 Ga0157380_10034342 3300014326 Bacteria 3912
359 Ga0157380_10410147 3300014326 Bacteria 1288
360 Ga0157377_10014866 3300014745 Bacteria 3970
361 Ga0157377_10124174 3300014745 Bacteria 1568
362 Ga0157379_10014334 3300014968 Bacteria 6956
363 Ga0157379_10115018 3300014968 Unclassified 2419
364 Ga0157376_10006817 3300014969 Bacteria 8086
365 Ga0157376_10007899 3300014969 Bacteria 7632
366 Ga0157376_10316380 3300014969 Bacteria 1483
367 Ga0182007_10027242 3300015262 Unclassified 1972
368 Ga0163161_10123664 3300017792 Bacteria 1946
369 Ga0207672_1000062 3300025223 Bacteria 14385
370 Ga0207697_10030617 3300025315 Bacteria 2202
371 Ga0207697_10055723 3300025315 Bacteria 1639
372 Ga0207656_10001825 3300025321 Bacteria 7073
373 Ga0207653_10000065 3300025885 Bacteria 80727
374 Ga0207653_10000070 3300025885 Bacteria 76652
375 Ga0207653_10003408 3300025885 Bacteria 5016
376 Ga0207653_10057557 3300025885 Bacteria 1305
377 Ga0207710_10000002 3300025900 Bacteria 1251998
378 Ga0207710_10000776 3300025900 Bacteria 17388
379 Ga0207710_10030148 3300025900 Bacteria 2364
380 Ga0207688_10080130 3300025901 Bacteria 1863
381 Ga0207680_10073150 3300025903 Bacteria 2130
382 Ga0207647_10011627 3300025904 Bacteria 6164
383 Ga0207685_10000021 3300025905 Bacteria 131248
384 Ga0207699_10000003 3300025906 Bacteria 577076
385 Ga0207645_10277202 3300025907 Bacteria 1113
386 Ga0207643_10002307 3300025908 Bacteria 10377
387 Ga0207643_10166597 3300025908 Bacteria 1328
388 Ga0207684_10000090 3300025910 Bacteria 171831
389 Ga0207684_10000314 3300025910 Bacteria 68706
390 Ga0207684_10000515 3300025910 Bacteria 47938
391 Ga0207684_10007510 3300025910 Bacteria 9810
392 Ga0207684_10010306 3300025910 Bacteria 8230
393 Ga0207684_10019527 3300025910 Bacteria 5796
394 Ga0207684_10037214 3300025910 Bacteria 4129
395 Ga0207684_10045008 3300025910 Unclassified 3744
396 Ga0207684_10046124 3300025910 Bacteria 3697
397 Ga0207684_10166785 3300025910 Bacteria 1898
398 Ga0207684_10236848 3300025910 Bacteria 1575
399 Ga0207707_10000006 3300025912 Bacteria 374131
400 Ga0207707_10002499 3300025912 Bacteria 16555
401 Ga0207707_10063587 3300025912 Unclassified 3212
402 Ga0207695_10173522 3300025913 Bacteria 2080
403 Ga0207671_10007914 3300025914 Bacteria 9120
404 Ga0207671_10155085 3300025914 Bacteria 1771
405 Ga0207663_10000003 3300025916 Bacteria 458807
406 Ga0207660_10007861 3300025917 Bacteria 6902
407 Ga0207660_10312956 3300025917 Unclassified 1252
408 Ga0207662_10083541 3300025918 Bacteria 1952
409 Ga0207662_10095439 3300025918 Unclassified 1836
410 Ga0207662_10103649 3300025918 Bacteria 1765
411 Ga0207662_10154121 3300025918 Bacteria 1464
412 Ga0207657_10037330 3300025919 Unclassified 4339
413 Ga0207652_10009231 3300025921 Bacteria 7934
414 Ga0207652_10108713 3300025921 Bacteria 2457
415 Ga0207646_10000076 3300025922 Bacteria 135473
416 Ga0207646_10001170 3300025922 Bacteria 33272
417 Ga0207646_10002078 3300025922 Bacteria 24029
418 Ga0207646_10002536 3300025922 Bacteria 21546
419 Ga0207646_10013680 3300025922 Bacteria 7749
420 Ga0207646_10017025 3300025922 Bacteria 6813
421 Ga0207646_10212487 3300025922 Bacteria 1747
422 Ga0207646_10357858 3300025922 Unclassified 1319
423 Ga0207681_10031479 3300025923 Bacteria 3465
424 Ga0207681_10261039 3300025923 Unclassified 1356
425 Ga0207681_10427295 3300025923 Bacteria 1074
426 Ga0207694_10006023 3300025924 Bacteria 9277
427 Ga0207650_10000047 3300025925 Bacteria 175675
428 Ga0207650_10010016 3300025925 Bacteria 6488
429 Ga0207650_10012820 3300025925 Bacteria 5792
430 Ga0207659_10202227 3300025926 Bacteria 1587
431 Ga0207659_10275335 3300025926 Bacteria 1374
432 Ga0207687_10114315 3300025927 Bacteria 2009
433 Ga0207644_10001021 3300025931 Bacteria 17910
434 Ga0207644_10301971 3300025931 Bacteria 1290
435 Ga0207690_10010825 3300025932 Bacteria 5435
436 Ga0207690_10298481 3300025932 Bacteria 1260
437 Ga0207706_10079474 3300025933 Archaea 2884
438 Ga0207706_10115665 3300025933 Bacteria 2359
439 Ga0207706_10297609 3300025933 Bacteria 1406
440 Ga0207686_10000010 3300025934 Bacteria 227471
441 Ga0207686_10001178 3300025934 Bacteria 15109
442 Ga0207686_10003853 3300025934 Bacteria 8043
443 Ga0207686_10022322 3300025934 Bacteria 3644
444 Ga0207686_10091840 3300025934 Bacteria 2006
445 Ga0207709_10000052 3300025935 Bacteria 227471
446 Ga0207709_10004105 3300025935 Bacteria 8481
447 Ga0207709_10063888 3300025935 Bacteria 2309
448 Ga0207709_10088396 3300025935 Bacteria 2017
449 Ga0207709_10191552 3300025935 Bacteria 1453
450 Ga0207670_10001863 3300025936 Bacteria 11025
451 Ga0207670_10037820 3300025936 Bacteria 3147
452 Ga0207704_10216174 3300025938 Unclassified 1415
453 Ga0207665_10000006 3300025939 Bacteria 184957
454 Ga0207665_10059897 3300025939 Unclassified 2578
455 Ga0207691_10075993 3300025940 Bacteria 3027
456 Ga0207711_10008789 3300025941 Bacteria 8447
457 Ga0207711_10024161 3300025941 Bacteria 5087
458 Ga0207711_10025330 3300025941 Bacteria 4977
459 Ga0207711_10062470 3300025941 Bacteria 3212
460 Ga0207711_10106862 3300025941 Unclassified 2484
461 Ga0207711_10170115 3300025941 Bacteria 1977
462 Ga0207711_10268390 3300025941 Bacteria 1569
463 Ga0207689_10004703 3300025942 Bacteria 12325
464 Ga0207689_10025437 3300025942 Bacteria 4962
465 Ga0207689_10035192 3300025942 Bacteria 4160
466 Ga0207689_10070732 3300025942 Bacteria 2866
467 Ga0207689_10093966 3300025942 Bacteria 2463
468 Ga0207689_10115682 3300025942 Bacteria 2205
469 Ga0207689_10153416 3300025942 Unclassified 1898
470 Ga0207679_10014681 3300025945 Bacteria 5156
471 Ga0207712_10004222 3300025961 Bacteria 9065
472 Ga0207712_10012477 3300025961 Bacteria 5430
473 Ga0207712_10031326 3300025961 Bacteria 3581
474 Ga0207712_10100961 3300025961 Bacteria 2145
475 Ga0207712_10105819 3300025961 Archaea 2100
476 Ga0207640_10271530 3300025981 Bacteria 1327
477 Ga0207677_10008832 3300026023 Bacteria 5647
478 Ga0207677_10128913 3300026023 Bacteria 1917
479 Ga0207703_10000032 3300026035 Bacteria 188472
480 Ga0207703_10024888 3300026035 Bacteria 4710
481 Ga0207703_10037387 3300026035 Bacteria 3867
482 Ga0207703_10123582 3300026035 Unclassified 2225
483 Ga0207703_10233903 3300026035 Bacteria 1649
484 Ga0207708_10000080 3300026075 Bacteria 74889
485 Ga0207708_10006626 3300026075 Bacteria 8572
486 Ga0207708_10011233 3300026075 Bacteria 6664
487 Ga0207708_10030117 3300026075 Bacteria 4116
488 Ga0207708_10043398 3300026075 Bacteria 3427
489 Ga0207708_10044607 3300026075 Bacteria 3378
490 Ga0207708_10071762 3300026075 Bacteria 2653
491 Ga0207708_10153999 3300026075 Bacteria 1812
492 Ga0207708_10163833 3300026075 Bacteria 1757
493 Ga0207708_10169493 3300026075 Bacteria 1728
494 Ga0207702_10052323 3300026078 Bacteria 3455
495 Ga0207641_10302769 3300026088 Unclassified 1511
496 Ga0207641_10310859 3300026088 Unclassified 1491
497 Ga0207641_10382757 3300026088 Unclassified 1348
498 Ga0207648_10006470 3300026089 Bacteria 11634
499 Ga0207648_10059260 3300026089 Bacteria 3338
500 Ga0207648_10108721 3300026089 Bacteria 2434
501 Ga0207648_10109769 3300026089 Unclassified 2422
502 Ga0207648_10221792 3300026089 Bacteria 1680
503 Ga0207676_10030967 3300026095 Unclassified 4020
504 Ga0207676_10052560 3300026095 Bacteria 3185
505 Ga0207676_10079561 3300026095 Bacteria 2658
506 Ga0207676_10228322 3300026095 Unclassified 1662
507 Ga0207676_10274850 3300026095 Unclassified 1527
508 Ga0207676_10477040 3300026095 Unclassified 1181
509 Ga0207674_10015381 3300026116 Bacteria 8406
510 Ga0207674_10023682 3300026116 Bacteria 6572
511 Ga0207674_10214247 3300026116 Bacteria 1875
512 Ga0207674_10288733 3300026116 Unclassified 1589
513 Ga0207674_10566078 3300026116 Unclassified 1098
514 Ga0207675_100000252 3300026118 Bacteria 51296
515 Ga0207675_100037753 3300026118 Bacteria 4506
516 Ga0207675_100136044 3300026118 Bacteria 2331
517 Ga0207675_100276831 3300026118 Bacteria 1630
518 Ga0207675_100528950 3300026118 Unclassified 1176
519 Ga0207683_10150587 3300026121 Bacteria 2099
520 Ga0207698_10154547 3300026142 Bacteria 1996
521 Ga0207698_10180891 3300026142 Bacteria 1868
522 Ga0207428_10000449 3300027907 Bacteria 50066
523 Ga0207428_10002119 3300027907 Bacteria 19981
524 Ga0207428_10067080 3300027907 Unclassified 2826
525 Ga0268265_10013661 3300028380 Bacteria 5524
526 Ga0268265_10031177 3300028380 Bacteria 3848
527 Ga0268264_10085187 3300028381 Bacteria 2712
528 Ga0268264_10107507 3300028381 Bacteria 2437
529 Ga0268264_10138561 3300028381 Bacteria 2167
530 Ga0268264_10593171 3300028381 Bacteria 1091
531 Ga0307515_10065518 3300028794 Bacteria 5053
532 Ga0265332_10003403 3300031238 Bacteria 7694
533 Ga0307509_10049420 3300031507 Bacteria 4509
534 Ga0307408_100287800 3300031548 Bacteria 1371
535 Ga0307408_100333402 3300031548 Unclassified 1282
536 Ga0307405_10003793 3300031731 Bacteria 7024
537 Ga0307406_10101889 3300031901 Bacteria 1957
538 Ga0307416_100023009 3300032002 Bacteria 4512
539 Ga0307416_100132451 3300032002 Bacteria 2247
540 Ga0373949_0004798 3300035090 Bacteria 3067
541 Ga0373943_0014390 3300035170 Bacteria 3582
542 Ga0373961_0000038 3300035241 Bacteria 78956
543 Ga0373947_0077995 3300035725 Unclassified 2044
544 Ga0373937_0016062 3300036401 Bacteria 6641
545 Ga0395900_0138618 3300037418 Bacteria 2492
546 Ga0395898_0157831 3300037466 Unclassified 2170
547 Ga0395898_0313755 3300037466 Bacteria 1496
548 Ga0242420_009479 3300038996 Unclassified 1598
549 Ga0436365_0715042 3300039437 Bacteria 6821
550 Ga0436365_0896267 3300039437 Unclassified 4203
551 Ga0453683_0023509 3300044673 Bacteria 3928
552 Ga0451576_0453405 3300045051 Unclassified 1346
553 Ga0495639_0045578 3300046475 Unclassified 1984
554 Ga0495647_0012526 3300046681 Bacteria 2921
555 Ga0496102_0130388 3300048905 Bacteria 2353
556 Ga0496103_0143690 3300048906 Bacteria 1527
557 Ga0496104_0054805 3300048907 Bacteria 3769
558 Ga0496104_0365645 3300048907 Unclassified 1355
559 Ga0496106_0118754 3300048909 Bacteria 2065
560 Ga0496106_0183748 3300048909 Bacteria 1660
561 Ga0496108_0070140 3300048911 Bacteria 2958
562 Ga0496108_0160950 3300048911 Unclassified 1940
563 Ga0496109_0000189 3300048912 Bacteria 61378
564 Ga0496112_0059849 3300048915 Bacteria 3753
565 Ga0496112_0123617 3300048915 Bacteria 2559
566 Ga0496113_0111079 3300048916 Unclassified 2134
567 Ga0501291_010775 3300049514 Bacteria 1307
568 Ga0501298_018823 3300049521 Unclassified 1274
569 Ga0501303_000634 3300049526 Unclassified 2716
570 Ga0501038_0002453 3300049574 Bacteria 17278
571 Ga0501038_0174331 3300049574 Unclassified 1739
572 Ga0501072_0017386 3300049588 Bacteria 5525
573 Ga0501076_0027434 3300049592 Bacteria 4417
574 Ga0501217_004442 3300049661 Bacteria 2884
575 Ga0501223_003726 3300049663 Bacteria 3294
576 Ga0501227_000411 3300049665 Bacteria 9103
577 Ga0501233_004582 3300049668 Bacteria 2540
578 Ga0501233_005147 3300049668 Bacteria 2421
579 Ga0501233_008412 3300049668 Bacteria 1988
580 Ga0501235_005013 3300049669 Bacteria 2873
581 Ga0501243_005204 3300049675 Unclassified 1956
582 Ga0501257_047299 3300049686 Unclassified 1067
583 Ga0501225_0011818 3300049705 Unclassified 2455
584 Ga0501079_0083636 3300049741 Bacteria 2469
585 Ga0501081_0103036 3300049743 Bacteria 2019
586 Ga0501045_0162812 3300049824 Bacteria 1661
587 Ga0501226_000354 3300049853 Bacteria 6691
588 nmdc:mga03683_22202_c1 3300050489 Bacteria 2459
589 nmdc:mga00v17_30593_c1 3300050491 Bacteria 3169
590 nmdc:mga0yw44_144913_c1 3300050492 Bacteria 1546
591 nmdc:mga0k408_28733_c2 3300050493 Bacteria 2342
592 nmdc:mga06z11_16105_c1 3300050494 Bacteria 3358
593 nmdc:mga05p37_123888_c1 3300050507 Unclassified 3175
594 nmdc:mga05p37_128718_c1 3300050507 Bacteria 3108
595 nmdc:mga05p37_130459_c1 3300050507 Bacteria 3084
596 nmdc:mga05p37_20401_c1 3300050507 Bacteria 8017
597 nmdc:mga05p37_263110_c1 3300050507 Unclassified 2063
598 nmdc:mga05p37_354573_c1 3300050507 Unclassified 1726
599 nmdc:mga05p37_45148_c1 3300050507 Bacteria 5421
600 nmdc:mga05p37_5670_c1 3300050507 Bacteria 14680
601 nmdc:mga05p37_571092_c1 3300050507 Unclassified 1283
602 nmdc:mga05p37_800061_c1 3300050507 Unclassified 1032
603 nmdc:mga05p37_84943_c1 3300050507 Bacteria 3899
604 nmdc:mga09592_16979_c1 3300050508 Bacteria 5955
605 nmdc:mga09592_249115_c1 3300050508 Unclassified 1539
606 nmdc:mga09592_278932_c1 3300050508 Bacteria 1449
607 nmdc:mga06r32_120557_c1 3300050510 Bacteria 2587
608 nmdc:mga06r32_132872_c1 3300050510 Bacteria 2462
609 nmdc:mga06r32_18754_c1 3300050510 Bacteria 6340
610 nmdc:mga06r32_196920_c1 3300050510 Bacteria 2002
611 nmdc:mga06r32_571762_c1 3300050510 Bacteria 1103
612 nmdc:mga06r32_7254_c1 3300050510 Bacteria 9986
613 nmdc:mga08y16_153019_c1 3300050511 Bacteria 2397
614 nmdc:mga08y16_248160_c1 3300050511 Bacteria 1839
615 nmdc:mga08y16_38799_c1 3300050511 Unclassified 4999
616 nmdc:mga0n895_110201_c1 3300050512 Bacteria 2768
617 nmdc:mga0n895_110536_c1 3300050512 Bacteria 2764
618 nmdc:mga0n895_130851_c1 3300050512 Bacteria 2534
619 nmdc:mga0n895_210719_c1 3300050512 Bacteria 1973
620 nmdc:mga0n895_270775_c1 3300050512 Unclassified 1723
621 nmdc:mga0n895_338998_c1 3300050512 Bacteria 1523
622 nmdc:mga0n895_4533_c1 3300050512 Bacteria 11435
623 nmdc:mga0n895_53735_c1 3300050512 Bacteria 3959
624 nmdc:mga0n895_629438_c1 3300050512 Bacteria 1073
625 nmdc:mga0n895_87329_c1 3300050512 Bacteria 3116
626 nmdc:mga0rr50_11169_c1 3300050513 Bacteria 5730
627 nmdc:mga0rr50_151_c1 3300050513 Bacteria 37856
628 nmdc:mga0rr50_200527_c1 3300050513 Bacteria 1639
629 nmdc:mga0rr50_36995_c1 3300050513 Unclassified 3520
630 nmdc:mga0rr50_55473_c1 3300050513 Bacteria 2956
631 nmdc:mga0rr50_8379_c1 3300050513 Bacteria 6434
632 nmdc:mga08x19_46_c1 3300050514 Bacteria 145818
633 nmdc:mga08x19_61_c1 3300050514 Bacteria 114972
634 nmdc:mga0a205_108363_c1 3300050515 Bacteria 2676
635 nmdc:mga0a205_108810_c1 3300050515 Bacteria 2670
636 nmdc:mga0a205_204527_c1 3300050515 Bacteria 1864
637 nmdc:mga0a205_21437_c1 3300050515 Bacteria 6112
638 nmdc:mga0a205_4945_c1 3300050515 Bacteria 11986
639 nmdc:mga0a205_84799_c1 3300050515 Bacteria 3060
640 nmdc:mga0a205_84870_c1 3300050515 Unclassified 3059
641 nmdc:mga0a205_99790_c1 3300050515 Bacteria 2802
642 Ga0500583_0157830 3300053092 Bacteria 1130
643 Ga0500566_0016621 3300053094 Bacteria 4319
644 Ga0500597_000348 3300053120 Bacteria 9595
645 Ga0500636_0035310 3300053177 Bacteria 2959
646 Ga0501084_0053935 3300054114 Bacteria 3363
647 Ga0501082_0037531 3300060353 Unclassified 4177
648 Ga0501082_0260964 3300060353 Bacteria 1507
649 Ga0530510_0198155 3300061734 Bacteria 1491

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_11169_c1 nmdc:mga0rr50_11169_c1_1263_2198 311
2 3300050515 nmdc:mga0a205_21437_c1 nmdc:mga0a205_21437_c1_986_1969 322
3 3300025932 Ga0207690_10298481 Ga0207690_102984811 323
4 3300026075 Ga0207708_10043398 Ga0207708_100433981 323
5 3300031548 Ga0307408_100333402 Ga0307408_1003334021 323
6 3300005441 Ga0070700_100004838 Ga0070700_1000048382 324
7 3300005616 Ga0068852_100319007 Ga0068852_1003190072 324
8 3300005617 Ga0068859_100064763 Ga0068859_1000647632 324
9 3300005843 Ga0068860_100233533 Ga0068860_1002335332 324
10 3300006931 Ga0097620_100064764 Ga0097620_1000647642 324
11 3300025315 Ga0207697_10055723 Ga0207697_100557232 324
12 3300026035 Ga0207703_10024888 Ga0207703_100248881 324
13 3300026075 Ga0207708_10006626 Ga0207708_100066266 324
14 3300028381 Ga0268264_10107507 Ga0268264_101075072 324
15 3300003203 JGI25406J46586_10027947 JGI25406J46586_100279472 325
16 3300005441 Ga0070700_100190431 Ga0070700_1001904312 325
17 3300005471 Ga0070698_100037232 Ga0070698_1000372323 325
18 3300005518 Ga0070699_100143380 Ga0070699_1001433802 325
19 3300005618 Ga0068864_100227406 Ga0068864_1002274061 325
20 3300005840 Ga0068870_10144581 Ga0068870_101445812 325
21 3300005985 Ga0081539_10000887 Ga0081539_1000088740 325
22 3300025908 Ga0207643_10166597 Ga0207643_101665972 325
23 3300025918 Ga0207662_10154121 Ga0207662_101541212 325
24 3300025922 Ga0207646_10013680 Ga0207646_100136802 325
25 3300026075 Ga0207708_10169493 Ga0207708_101694932 325
26 3300026116 Ga0207674_10214247 Ga0207674_102142472 325
27 3300048915 Ga0496112_0059849 Ga0496112_0059849_1353_2333 325
28 3300053094 Ga0500566_0016621 Ga0500566_0016621_2763_3740 325
29 3300005577 Ga0068857_100260180 Ga0068857_1002601802 326
30 3300006852 Ga0075433_10096947 Ga0075433_100969472 326
31 3300025908 Ga0207643_10002307 Ga0207643_100023072 326
32 3300050515 nmdc:mga0a205_108810_c1 nmdc:mga0a205_108810_c1_1364_2422 326
33 2162886007 SwRhRL2b_contig_3631794 SwRhRL2b_0387.00006650 327
34 3300000532 CNAas_1001041 CNAas_10010412 327
35 3300001432 JGI24034J14986_100094 JGI24034J14986_1000943 327
36 3300002074 JGI24748J21848_1000001 JGI24748J21848_1000001191 327
37 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001225 327
38 3300002459 JGI24751J29686_10000109 JGI24751J29686_100001093 327
39 3300002459 JGI24751J29686_10014682 JGI24751J29686_100146822 327
40 3300005288 Ga0065714_10064496 Ga0065714_100644969 327
41 3300005290 Ga0065712_10000123 Ga0065712_1000012344 327
42 3300005290 Ga0065712_10003222 Ga0065712_100032222 327
43 3300005290 Ga0065712_10008191 Ga0065712_100081914 327
44 3300005290 Ga0065712_10113064 Ga0065712_101130643 327
45 3300005290 Ga0065712_10115535 Ga0065712_101155352 327
46 3300005290 Ga0065712_10151656 Ga0065712_101516562 327
47 3300005293 Ga0065715_10007224 Ga0065715_100072242 327
48 3300005293 Ga0065715_10099279 Ga0065715_100992791 327
49 3300005293 Ga0065715_10102128 Ga0065715_101021284 327
50 3300005293 Ga0065715_10153163 Ga0065715_101531632 327
51 3300005293 Ga0065715_10199947 Ga0065715_101999471 327
52 3300005293 Ga0065715_10261560 Ga0065715_102615601 327
53 3300005295 Ga0065707_10106495 Ga0065707_101064952 327
54 3300005295 Ga0065707_10178833 Ga0065707_101788331 327
55 3300005328 Ga0070676_10183141 Ga0070676_101831412 327
56 3300005330 Ga0070690_100012341 Ga0070690_1000123412 327
57 3300005330 Ga0070690_100019832 Ga0070690_1000198322 327
58 3300005331 Ga0070670_100000876 Ga0070670_10000087619 327
59 3300005331 Ga0070670_100016061 Ga0070670_1000160612 327
60 3300005331 Ga0070670_100196000 Ga0070670_1001960002 327
61 3300005331 Ga0070670_100215218 Ga0070670_1002152182 327
62 3300005334 Ga0068869_100006969 Ga0068869_1000069695 327
63 3300005334 Ga0068869_100055707 Ga0068869_1000557073 327
64 3300005334 Ga0068869_100123637 Ga0068869_1001236372 327
65 3300005335 Ga0070666_10131065 Ga0070666_101310652 327
66 3300005336 Ga0070680_100038601 Ga0070680_1000386012 327
67 3300005336 Ga0070680_100178026 Ga0070680_1001780262 327
68 3300005337 Ga0070682_100004044 Ga0070682_1000040444 327
69 3300005338 Ga0068868_100149770 Ga0068868_1001497702 327
70 3300005338 Ga0068868_100158548 Ga0068868_1001585483 327
71 3300005338 Ga0068868_100334881 Ga0068868_1003348811 327
72 3300005339 Ga0070660_100031470 Ga0070660_1000314704 327
73 3300005340 Ga0070689_100000428 Ga0070689_10000042814 327
74 3300005340 Ga0070689_100040774 Ga0070689_1000407742 327
75 3300005340 Ga0070689_100073380 Ga0070689_1000733802 327
76 3300005340 Ga0070689_100322854 Ga0070689_1003228541 327
77 3300005343 Ga0070687_100009970 Ga0070687_1000099702 327
78 3300005343 Ga0070687_100064569 Ga0070687_1000645692 327
79 3300005343 Ga0070687_100108661 Ga0070687_1001086612 327
80 3300005345 Ga0070692_10021963 Ga0070692_100219633 327
81 3300005345 Ga0070692_10092310 Ga0070692_100923102 327
82 3300005353 Ga0070669_100027390 Ga0070669_1000273905 327
83 3300005353 Ga0070669_100191842 Ga0070669_1001918422 327
84 3300005354 Ga0070675_100056278 Ga0070675_1000562784 327
85 3300005354 Ga0070675_100347512 Ga0070675_1003475121 327
86 3300005355 Ga0070671_100028519 Ga0070671_1000285193 327
87 3300005355 Ga0070671_100355497 Ga0070671_1003554971 327
88 3300005356 Ga0070674_100056702 Ga0070674_1000567022 327
89 3300005364 Ga0070673_100113909 Ga0070673_1001139092 327
90 3300005364 Ga0070673_100160918 Ga0070673_1001609182 327
91 3300005364 Ga0070673_100356340 Ga0070673_1003563401 327
92 3300005365 Ga0070688_100100120 Ga0070688_1001001202 327
93 3300005366 Ga0070659_100004392 Ga0070659_1000043924 327
94 3300005406 Ga0070703_10000016 Ga0070703_1000001642 327
95 3300005406 Ga0070703_10059597 Ga0070703_100595971 327
96 3300005434 Ga0070709_10000006 Ga0070709_100000064 327
97 3300005438 Ga0070701_10072558 Ga0070701_100725582 327
98 3300005438 Ga0070701_10144232 Ga0070701_101442321 327
99 3300005438 Ga0070701_10156323 Ga0070701_101563231 327
100 3300005439 Ga0070711_100000051 Ga0070711_1000000517 327
101 3300005440 Ga0070705_100000696 Ga0070705_10000069615 327
102 3300005440 Ga0070705_100023912 Ga0070705_1000239124 327
103 3300005440 Ga0070705_100026598 Ga0070705_1000265982 327
104 3300005440 Ga0070705_100047944 Ga0070705_1000479442 327
105 3300005441 Ga0070700_100000062 Ga0070700_10000006253 327
106 3300005441 Ga0070700_100003264 Ga0070700_1000032643 327
107 3300005441 Ga0070700_100008899 Ga0070700_1000088995 327
108 3300005441 Ga0070700_100250878 Ga0070700_1002508781 327
109 3300005444 Ga0070694_100007641 Ga0070694_1000076413 327
110 3300005444 Ga0070694_100010574 Ga0070694_1000105743 327
111 3300005444 Ga0070694_100019905 Ga0070694_1000199054 327
112 3300005444 Ga0070694_100022235 Ga0070694_1000222357 327
113 3300005444 Ga0070694_100089345 Ga0070694_1000893451 327
114 3300005445 Ga0070708_100020861 Ga0070708_1000208617 327
115 3300005445 Ga0070708_100056928 Ga0070708_1000569283 327
116 3300005445 Ga0070708_100060297 Ga0070708_1000602972 327
117 3300005445 Ga0070708_100129277 Ga0070708_1001292772 327
118 3300005457 Ga0070662_100029352 Ga0070662_1000293522 327
119 3300005457 Ga0070662_100257364 Ga0070662_1002573641 327
120 3300005458 Ga0070681_10003045 Ga0070681_1000304516 327
121 3300005458 Ga0070681_10012847 Ga0070681_100128474 327
122 3300005458 Ga0070681_10062544 Ga0070681_100625442 327
123 3300005459 Ga0068867_100051030 Ga0068867_1000510303 327
124 3300005459 Ga0068867_100067049 Ga0068867_1000670493 327
125 3300005459 Ga0068867_100086562 Ga0068867_1000865622 327
126 3300005459 Ga0068867_100092167 Ga0068867_1000921671 327
127 3300005467 Ga0070706_100000137 Ga0070706_10000013743 327
128 3300005467 Ga0070706_100000689 Ga0070706_10000068916 327
129 3300005467 Ga0070706_100000746 Ga0070706_10000074622 327
130 3300005467 Ga0070706_100001693 Ga0070706_1000016936 327
131 3300005467 Ga0070706_100006487 Ga0070706_1000064878 327
132 3300005467 Ga0070706_100009200 Ga0070706_1000092009 327
133 3300005467 Ga0070706_100011920 Ga0070706_1000119206 327
134 3300005467 Ga0070706_100017853 Ga0070706_1000178534 327
135 3300005467 Ga0070706_100020638 Ga0070706_1000206386 327
136 3300005467 Ga0070706_100037010 Ga0070706_1000370104 327
137 3300005467 Ga0070706_100104396 Ga0070706_1001043962 327
138 3300005467 Ga0070706_100105625 Ga0070706_1001056251 327
139 3300005467 Ga0070706_100246007 Ga0070706_1002460071 327
140 3300005467 Ga0070706_100264256 Ga0070706_1002642561 327
141 3300005468 Ga0070707_100000081 Ga0070707_10000008117 327
142 3300005468 Ga0070707_100011165 Ga0070707_1000111653 327
143 3300005468 Ga0070707_100011799 Ga0070707_1000117994 327
144 3300005468 Ga0070707_100012982 Ga0070707_1000129824 327
145 3300005468 Ga0070707_100070567 Ga0070707_1000705673 327
146 3300005468 Ga0070707_100077992 Ga0070707_1000779923 327
147 3300005468 Ga0070707_100145636 Ga0070707_1001456362 327
148 3300005471 Ga0070698_100000107 Ga0070698_10000010735 327
149 3300005471 Ga0070698_100003825 Ga0070698_10000382513 327
150 3300005471 Ga0070698_100008313 Ga0070698_1000083132 327
151 3300005471 Ga0070698_100013741 Ga0070698_1000137413 327
152 3300005471 Ga0070698_100015062 Ga0070698_1000150624 327
153 3300005471 Ga0070698_100022491 Ga0070698_1000224917 327
154 3300005471 Ga0070698_100083257 Ga0070698_1000832573 327
155 3300005471 Ga0070698_100230793 Ga0070698_1002307931 327
156 3300005518 Ga0070699_100000083 Ga0070699_10000008377 327
157 3300005518 Ga0070699_100012438 Ga0070699_1000124381 327
158 3300005518 Ga0070699_100015800 Ga0070699_1000158002 327
159 3300005518 Ga0070699_100139539 Ga0070699_1001395391 327
160 3300005518 Ga0070699_100197197 Ga0070699_1001971972 327
161 3300005530 Ga0070679_100000047 Ga0070679_1000000472 327
162 3300005530 Ga0070679_100477664 Ga0070679_1004776641 327
163 3300005536 Ga0070697_100001026 Ga0070697_10000102613 327
164 3300005536 Ga0070697_100012574 Ga0070697_1000125743 327
165 3300005536 Ga0070697_100260769 Ga0070697_1002607692 327
166 3300005536 Ga0070697_100281709 Ga0070697_1002817091 327
167 3300005543 Ga0070672_100144408 Ga0070672_1001444083 327
168 3300005544 Ga0070686_100033913 Ga0070686_1000339134 327
169 3300005544 Ga0070686_100045111 Ga0070686_1000451112 327
170 3300005545 Ga0070695_100051581 Ga0070695_1000515812 327
171 3300005545 Ga0070695_100075494 Ga0070695_1000754942 327
172 3300005545 Ga0070695_100094848 Ga0070695_1000948483 327
173 3300005545 Ga0070695_100135131 Ga0070695_1001351311 327
174 3300005546 Ga0070696_100000738 Ga0070696_10000073818 327
175 3300005546 Ga0070696_100056427 Ga0070696_1000564272 327
176 3300005547 Ga0070693_100033630 Ga0070693_1000336304 327
177 3300005548 Ga0070665_100176054 Ga0070665_1001760542 327
178 3300005548 Ga0070665_100472762 Ga0070665_1004727622 327
179 3300005549 Ga0070704_100003599 Ga0070704_1000035997 327
180 3300005549 Ga0070704_100009963 Ga0070704_1000099633 327
181 3300005549 Ga0070704_100014338 Ga0070704_1000143383 327
182 3300005549 Ga0070704_100023137 Ga0070704_1000231374 327
183 3300005549 Ga0070704_100042452 Ga0070704_1000424524 327
184 3300005549 Ga0070704_100044725 Ga0070704_1000447253 327
185 3300005549 Ga0070704_100059680 Ga0070704_1000596802 327
186 3300005549 Ga0070704_100162844 Ga0070704_1001628442 327
187 3300005549 Ga0070704_100258725 Ga0070704_1002587251 327
188 3300005563 Ga0068855_100199075 Ga0068855_1001990753 327
189 3300005563 Ga0068855_100245074 Ga0068855_1002450741 327
190 3300005564 Ga0070664_100003326 Ga0070664_10000332610 327
191 3300005577 Ga0068857_100006924 Ga0068857_10000692411 327
192 3300005577 Ga0068857_100009546 Ga0068857_1000095462 327
193 3300005614 Ga0068856_100080156 Ga0068856_1000801563 327
194 3300005615 Ga0070702_100011698 Ga0070702_1000116982 327
195 3300005615 Ga0070702_100132215 Ga0070702_1001322152 327
196 3300005616 Ga0068852_100067674 Ga0068852_1000676745 327
197 3300005616 Ga0068852_100206871 Ga0068852_1002068712 327
198 3300005617 Ga0068859_100002197 Ga0068859_10000219714 327
199 3300005617 Ga0068859_100006037 Ga0068859_10000603714 327
200 3300005617 Ga0068859_100006648 Ga0068859_1000066489 327
201 3300005617 Ga0068859_100076248 Ga0068859_1000762483 327
202 3300005617 Ga0068859_100124300 Ga0068859_1001243002 327
203 3300005617 Ga0068859_100184032 Ga0068859_1001840323 327
204 3300005617 Ga0068859_100196708 Ga0068859_1001967082 327
205 3300005617 Ga0068859_100213936 Ga0068859_1002139362 327
206 3300005617 Ga0068859_100297677 Ga0068859_1002976772 327
207 3300005618 Ga0068864_100007415 Ga0068864_1000074155 327
208 3300005618 Ga0068864_100021405 Ga0068864_1000214055 327
209 3300005618 Ga0068864_100029783 Ga0068864_1000297837 327
210 3300005618 Ga0068864_100080416 Ga0068864_1000804162 327
211 3300005618 Ga0068864_100256167 Ga0068864_1002561671 327
212 3300005718 Ga0068866_10001186 Ga0068866_100011868 327
213 3300005719 Ga0068861_100022555 Ga0068861_1000225555 327
214 3300005719 Ga0068861_100022865 Ga0068861_1000228657 327
215 3300005841 Ga0068863_100067078 Ga0068863_1000670782 327
216 3300005841 Ga0068863_100078355 Ga0068863_1000783553 327
217 3300005841 Ga0068863_100306011 Ga0068863_1003060111 327
218 3300005841 Ga0068863_100414096 Ga0068863_1004140962 327
219 3300005842 Ga0068858_100000044 Ga0068858_10000004450 327
220 3300005842 Ga0068858_100011114 Ga0068858_1000111146 327
221 3300005842 Ga0068858_100077403 Ga0068858_1000774033 327
222 3300005842 Ga0068858_100084246 Ga0068858_1000842462 327
223 3300005842 Ga0068858_100106671 Ga0068858_1001066712 327
224 3300005842 Ga0068858_100115221 Ga0068858_1001152212 327
225 3300005842 Ga0068858_100246115 Ga0068858_1002461151 327
226 3300005842 Ga0068858_100328909 Ga0068858_1003289091 327
227 3300005843 Ga0068860_100027304 Ga0068860_1000273043 327
228 3300005843 Ga0068860_100103763 Ga0068860_1001037632 327
229 3300005843 Ga0068860_100132324 Ga0068860_1001323243 327
230 3300005843 Ga0068860_100140083 Ga0068860_1001400831 327
231 3300005843 Ga0068860_100141115 Ga0068860_1001411152 327
232 3300005843 Ga0068860_100431934 Ga0068860_1004319341 327
233 3300005844 Ga0068862_100008290 Ga0068862_1000082903 327
234 3300005844 Ga0068862_100014370 Ga0068862_1000143705 327
235 3300005844 Ga0068862_100278425 Ga0068862_1002784252 327
236 3300005937 Ga0081455_10047437 Ga0081455_100474373 327
237 3300005937 Ga0081455_10100978 Ga0081455_101009782 327
238 3300005983 Ga0081540_1070278 Ga0081540_10702783 327
239 3300006038 Ga0075365_10028836 Ga0075365_100288361 327
240 3300006051 Ga0075364_10035347 Ga0075364_100353472 327
241 3300006173 Ga0070716_100000004 Ga0070716_10000000497 327
242 3300006173 Ga0070716_100216352 Ga0070716_1002163522 327
243 3300006175 Ga0070712_100050786 Ga0070712_1000507863 327
244 3300006177 Ga0075362_10002309 Ga0075362_100023092 327
245 3300006178 Ga0075367_10014809 Ga0075367_100148094 327
246 3300006195 Ga0075366_10051168 Ga0075366_100511682 327
247 3300006237 Ga0097621_100009292 Ga0097621_1000092922 327
248 3300006237 Ga0097621_100018054 Ga0097621_1000180542 327
249 3300006237 Ga0097621_100043674 Ga0097621_1000436744 327
250 3300006358 Ga0068871_100021032 Ga0068871_1000210324 327
251 3300006358 Ga0068871_100021401 Ga0068871_1000214012 327
252 3300006844 Ga0075428_100009182 Ga0075428_1000091822 327
253 3300006844 Ga0075428_100015913 Ga0075428_1000159134 327
254 3300006844 Ga0075428_100096868 Ga0075428_1000968682 327
255 3300006844 Ga0075428_100169084 Ga0075428_1001690841 327
256 3300006844 Ga0075428_100336825 Ga0075428_1003368253 327
257 3300006847 Ga0075431_100013940 Ga0075431_1000139405 327
258 3300006847 Ga0075431_100016154 Ga0075431_1000161544 327
259 3300006847 Ga0075431_100041399 Ga0075431_1000413992 327
260 3300006852 Ga0075433_10095985 Ga0075433_100959852 327
261 3300006852 Ga0075433_10104884 Ga0075433_101048842 327
262 3300006852 Ga0075433_10238704 Ga0075433_102387042 327
263 3300006871 Ga0075434_100034377 Ga0075434_1000343778 327
264 3300006871 Ga0075434_100092528 Ga0075434_1000925281 327
265 3300006871 Ga0075434_100203541 Ga0075434_1002035413 327
266 3300006871 Ga0075434_100341969 Ga0075434_1003419691 327
267 3300006880 Ga0075429_100044853 Ga0075429_1000448533 327
268 3300006881 Ga0068865_100161034 Ga0068865_1001610342 327
269 3300006914 Ga0075436_100001301 Ga0075436_1000013017 327
270 3300006914 Ga0075436_100004655 Ga0075436_1000046554 327
271 3300006914 Ga0075436_100245711 Ga0075436_1002457112 327
272 3300006931 Ga0097620_100002197 Ga0097620_10000219714 327
273 3300006931 Ga0097620_100006037 Ga0097620_10000603714 327
274 3300006931 Ga0097620_100006648 Ga0097620_1000066489 327
275 3300006931 Ga0097620_100076249 Ga0097620_1000762493 327
276 3300006931 Ga0097620_100124297 Ga0097620_1001242972 327
277 3300006931 Ga0097620_100184024 Ga0097620_1001840243 327
278 3300006931 Ga0097620_100196705 Ga0097620_1001967052 327
279 3300006931 Ga0097620_100213937 Ga0097620_1002139372 327
280 3300006931 Ga0097620_100297680 Ga0097620_1002976802 327
281 3300007076 Ga0075435_100000292 Ga0075435_10000029212 327
282 3300007076 Ga0075435_100046663 Ga0075435_1000466632 327
283 3300007076 Ga0075435_100069186 Ga0075435_1000691862 327
284 3300007076 Ga0075435_100080087 Ga0075435_1000800874 327
285 3300007076 Ga0075435_100085714 Ga0075435_1000857142 327
286 3300009093 Ga0105240_10072884 Ga0105240_100728846 327
287 3300009094 Ga0111539_10058991 Ga0111539_100589912 327
288 3300009094 Ga0111539_10060008 Ga0111539_100600083 327
289 3300009094 Ga0111539_10200113 Ga0111539_102001132 327
290 3300009094 Ga0111539_10279905 Ga0111539_102799052 327
291 3300009098 Ga0105245_10253483 Ga0105245_102534831 327
292 3300009101 Ga0105247_10000004 Ga0105247_10000004262 327
293 3300009101 Ga0105247_10001464 Ga0105247_1000146415 327
294 3300009101 Ga0105247_10009326 Ga0105247_100093262 327
295 3300009101 Ga0105247_10298939 Ga0105247_102989392 327
296 3300009147 Ga0114129_10003077 Ga0114129_100030779 327
297 3300009147 Ga0114129_10007145 Ga0114129_100071456 327
298 3300009147 Ga0114129_10013377 Ga0114129_100133777 327
299 3300009147 Ga0114129_10028310 Ga0114129_100283106 327
300 3300009147 Ga0114129_10031498 Ga0114129_100314987 327
301 3300009147 Ga0114129_10052996 Ga0114129_100529964 327
302 3300009147 Ga0114129_10074786 Ga0114129_100747864 327
303 3300009147 Ga0114129_10095175 Ga0114129_100951752 327
304 3300009147 Ga0114129_10106750 Ga0114129_101067502 327
305 3300009147 Ga0114129_10272910 Ga0114129_102729102 327
306 3300009147 Ga0114129_10292442 Ga0114129_102924422 327
307 3300009148 Ga0105243_10000240 Ga0105243_1000024014 327
308 3300009148 Ga0105243_10000573 Ga0105243_1000057316 327
309 3300009148 Ga0105243_10035191 Ga0105243_100351915 327
310 3300009148 Ga0105243_10247541 Ga0105243_102475411 327
311 3300009174 Ga0105241_10017940 Ga0105241_100179402 327
312 3300009174 Ga0105241_10133211 Ga0105241_101332111 327
313 3300009176 Ga0105242_10000222 Ga0105242_1000022223 327
314 3300009176 Ga0105242_10001271 Ga0105242_1000127110 327
315 3300009176 Ga0105242_10010557 Ga0105242_100105572 327
316 3300009176 Ga0105242_10015359 Ga0105242_100153593 327
317 3300009176 Ga0105242_10017782 Ga0105242_100177824 327
318 3300009176 Ga0105242_10308045 Ga0105242_103080453 327
319 3300009177 Ga0105248_10008970 Ga0105248_100089705 327
320 3300009177 Ga0105248_10022191 Ga0105248_100221915 327
321 3300009177 Ga0105248_10055195 Ga0105248_100551953 327
322 3300009177 Ga0105248_10084538 Ga0105248_100845382 327
323 3300009177 Ga0105248_10109336 Ga0105248_101093362 327
324 3300009177 Ga0105248_10160290 Ga0105248_101602902 327
325 3300009177 Ga0105248_10172833 Ga0105248_101728332 327
326 3300009177 Ga0105248_10177888 Ga0105248_101778882 327
327 3300009177 Ga0105248_10207042 Ga0105248_102070423 327
328 3300009177 Ga0105248_10271234 Ga0105248_102712342 327
329 3300009545 Ga0105237_10000334 Ga0105237_1000033412 327
330 3300009545 Ga0105237_10109188 Ga0105237_101091882 327
331 3300009551 Ga0105238_10010300 Ga0105238_100103005 327
332 3300009553 Ga0105249_10006116 Ga0105249_100061167 327
333 3300009553 Ga0105249_10018220 Ga0105249_100182203 327
334 3300009553 Ga0105249_10020906 Ga0105249_100209064 327
335 3300009553 Ga0105249_10029641 Ga0105249_100296414 327
336 3300009553 Ga0105249_10046928 Ga0105249_100469283 327
337 3300009553 Ga0105249_10063970 Ga0105249_100639702 327
338 3300009553 Ga0105249_10106369 Ga0105249_101063692 327
339 3300010375 Ga0105239_10102080 Ga0105239_101020802 327
340 3300010375 Ga0105239_10698847 Ga0105239_106988471 327
341 3300011119 Ga0105246_10027558 Ga0105246_100275582 327
342 3300013100 Ga0157373_10004904 Ga0157373_100049048 327
343 3300013100 Ga0157373_10065994 Ga0157373_100659942 327
344 3300013102 Ga0157371_10065740 Ga0157371_100657402 327
345 3300013296 Ga0157374_10026240 Ga0157374_100262401 327
346 3300013297 Ga0157378_10000025 Ga0157378_1000002555 327
347 3300013297 Ga0157378_10026893 Ga0157378_100268932 327
348 3300013297 Ga0157378_10043708 Ga0157378_100437081 327
349 3300013297 Ga0157378_10058112 Ga0157378_100581123 327
350 3300013297 Ga0157378_10070099 Ga0157378_100700992 327
351 3300013297 Ga0157378_10072694 Ga0157378_100726942 327
352 3300013297 Ga0157378_10075670 Ga0157378_100756702 327
353 3300013297 Ga0157378_10405712 Ga0157378_104057122 327
354 3300013306 Ga0163162_10008906 Ga0163162_100089069 327
355 3300013306 Ga0163162_10011757 Ga0163162_100117573 327
356 3300013306 Ga0163162_10016001 Ga0163162_100160012 327
357 3300013306 Ga0163162_10098561 Ga0163162_100985611 327
358 3300013306 Ga0163162_10144974 Ga0163162_101449743 327
359 3300013306 Ga0163162_10312777 Ga0163162_103127772 327
360 3300013306 Ga0163162_10314110 Ga0163162_103141102 327
361 3300013307 Ga0157372_10004643 Ga0157372_1000464319 327
362 3300013307 Ga0157372_10343093 Ga0157372_103430932 327
363 3300013308 Ga0157375_10049802 Ga0157375_100498023 327
364 3300013308 Ga0157375_10067012 Ga0157375_100670122 327
365 3300013308 Ga0157375_10196996 Ga0157375_101969963 327
366 3300013308 Ga0157375_10328158 Ga0157375_103281582 327
367 3300014325 Ga0163163_10004395 Ga0163163_100043953 327
368 3300014325 Ga0163163_10009284 Ga0163163_100092847 327
369 3300014325 Ga0163163_10021104 Ga0163163_100211042 327
370 3300014325 Ga0163163_10043112 Ga0163163_100431122 327
371 3300014325 Ga0163163_10104899 Ga0163163_101048992 327
372 3300014325 Ga0163163_10249018 Ga0163163_102490182 327
373 3300014325 Ga0163163_10311915 Ga0163163_103119151 327
374 3300014325 Ga0163163_10552382 Ga0163163_105523822 327
375 3300014325 Ga0163163_10640946 Ga0163163_106409461 327
376 3300014326 Ga0157380_10034342 Ga0157380_100343424 327
377 3300014326 Ga0157380_10410147 Ga0157380_104101471 327
378 3300014745 Ga0157377_10014866 Ga0157377_100148663 327
379 3300014745 Ga0157377_10124174 Ga0157377_101241741 327
380 3300014968 Ga0157379_10014334 Ga0157379_100143346 327
381 3300014968 Ga0157379_10115018 Ga0157379_101150182 327
382 3300014969 Ga0157376_10006817 Ga0157376_100068171 327
383 3300014969 Ga0157376_10007899 Ga0157376_100078992 327
384 3300014969 Ga0157376_10316380 Ga0157376_103163801 327
385 3300015262 Ga0182007_10027242 Ga0182007_100272422 327
386 3300017792 Ga0163161_10123664 Ga0163161_101236642 327
387 3300025223 Ga0207672_1000062 Ga0207672_10000624 327
388 3300025315 Ga0207697_10030617 Ga0207697_100306171 327
389 3300025321 Ga0207656_10001825 Ga0207656_100018259 327
390 3300025885 Ga0207653_10000065 Ga0207653_1000006514 327
391 3300025885 Ga0207653_10000070 Ga0207653_1000007015 327
392 3300025885 Ga0207653_10003408 Ga0207653_100034083 327
393 3300025885 Ga0207653_10057557 Ga0207653_100575571 327
394 3300025900 Ga0207710_10000002 Ga0207710_10000002750 327
395 3300025900 Ga0207710_10000776 Ga0207710_100007763 327
396 3300025900 Ga0207710_10030148 Ga0207710_100301483 327
397 3300025901 Ga0207688_10080130 Ga0207688_100801302 327
398 3300025903 Ga0207680_10073150 Ga0207680_100731502 327
399 3300025904 Ga0207647_10011627 Ga0207647_100116273 327
400 3300025905 Ga0207685_10000021 Ga0207685_1000002167 327
401 3300025906 Ga0207699_10000003 Ga0207699_10000003250 327
402 3300025907 Ga0207645_10277202 Ga0207645_102772021 327
403 3300025910 Ga0207684_10000090 Ga0207684_10000090156 327
404 3300025910 Ga0207684_10000314 Ga0207684_1000031442 327
405 3300025910 Ga0207684_10000515 Ga0207684_1000051523 327
406 3300025910 Ga0207684_10007510 Ga0207684_100075103 327
407 3300025910 Ga0207684_10010306 Ga0207684_100103065 327
408 3300025910 Ga0207684_10019527 Ga0207684_100195275 327
409 3300025910 Ga0207684_10037214 Ga0207684_100372142 327
410 3300025910 Ga0207684_10045008 Ga0207684_100450081 327
411 3300025910 Ga0207684_10046124 Ga0207684_100461243 327
412 3300025910 Ga0207684_10166785 Ga0207684_101667852 327
413 3300025910 Ga0207684_10236848 Ga0207684_102368482 327
414 3300025912 Ga0207707_10000006 Ga0207707_10000006311 327
415 3300025912 Ga0207707_10002499 Ga0207707_1000249915 327
416 3300025912 Ga0207707_10063587 Ga0207707_100635873 327
417 3300025913 Ga0207695_10173522 Ga0207695_101735222 327
418 3300025914 Ga0207671_10007914 Ga0207671_1000791411 327
419 3300025914 Ga0207671_10155085 Ga0207671_101550851 327
420 3300025916 Ga0207663_10000003 Ga0207663_10000003165 327
421 3300025917 Ga0207660_10007861 Ga0207660_100078617 327
422 3300025917 Ga0207660_10312956 Ga0207660_103129561 327
423 3300025918 Ga0207662_10083541 Ga0207662_100835412 327
424 3300025918 Ga0207662_10095439 Ga0207662_100954392 327
425 3300025918 Ga0207662_10103649 Ga0207662_101036492 327
426 3300025919 Ga0207657_10037330 Ga0207657_100373305 327
427 3300025921 Ga0207652_10009231 Ga0207652_100092312 327
428 3300025921 Ga0207652_10108713 Ga0207652_101087132 327
429 3300025922 Ga0207646_10000076 Ga0207646_1000007623 327
430 3300025922 Ga0207646_10001170 Ga0207646_1000117011 327
431 3300025922 Ga0207646_10002078 Ga0207646_100020788 327
432 3300025922 Ga0207646_10002536 Ga0207646_1000253618 327
433 3300025922 Ga0207646_10017025 Ga0207646_100170253 327
434 3300025922 Ga0207646_10212487 Ga0207646_102124871 327
435 3300025922 Ga0207646_10357858 Ga0207646_103578581 327
436 3300025923 Ga0207681_10031479 Ga0207681_100314792 327
437 3300025923 Ga0207681_10261039 Ga0207681_102610391 327
438 3300025923 Ga0207681_10427295 Ga0207681_104272951 327
439 3300025924 Ga0207694_10006023 Ga0207694_100060236 327
440 3300025925 Ga0207650_10000047 Ga0207650_1000004730 327
441 3300025925 Ga0207650_10010016 Ga0207650_100100166 327
442 3300025925 Ga0207650_10012820 Ga0207650_100128203 327
443 3300025926 Ga0207659_10202227 Ga0207659_102022271 327
444 3300025926 Ga0207659_10275335 Ga0207659_102753351 327
445 3300025927 Ga0207687_10114315 Ga0207687_101143152 327
446 3300025931 Ga0207644_10001021 Ga0207644_100010213 327
447 3300025931 Ga0207644_10301971 Ga0207644_103019711 327
448 3300025932 Ga0207690_10010825 Ga0207690_100108253 327
449 3300025933 Ga0207706_10079474 Ga0207706_100794743 327
450 3300025933 Ga0207706_10115665 Ga0207706_101156652 327
451 3300025933 Ga0207706_10297609 Ga0207706_102976092 327
452 3300025934 Ga0207686_10000010 Ga0207686_10000010184 327
453 3300025934 Ga0207686_10001178 Ga0207686_100011789 327
454 3300025934 Ga0207686_10003853 Ga0207686_100038535 327
455 3300025934 Ga0207686_10022322 Ga0207686_100223222 327
456 3300025934 Ga0207686_10091840 Ga0207686_100918401 327
457 3300025935 Ga0207709_10000052 Ga0207709_10000052184 327
458 3300025935 Ga0207709_10004105 Ga0207709_100041053 327
459 3300025935 Ga0207709_10063888 Ga0207709_100638881 327
460 3300025935 Ga0207709_10088396 Ga0207709_100883962 327
461 3300025935 Ga0207709_10191552 Ga0207709_101915522 327
462 3300025936 Ga0207670_10001863 Ga0207670_100018632 327
463 3300025936 Ga0207670_10037820 Ga0207670_100378202 327
464 3300025938 Ga0207704_10216174 Ga0207704_102161741 327
465 3300025939 Ga0207665_10000006 Ga0207665_10000006116 327
466 3300025939 Ga0207665_10059897 Ga0207665_100598974 327
467 3300025940 Ga0207691_10075993 Ga0207691_100759934 327
468 3300025941 Ga0207711_10008789 Ga0207711_1000878914 327
469 3300025941 Ga0207711_10024161 Ga0207711_100241613 327
470 3300025941 Ga0207711_10025330 Ga0207711_100253304 327
471 3300025941 Ga0207711_10062470 Ga0207711_100624702 327
472 3300025941 Ga0207711_10106862 Ga0207711_101068622 327
473 3300025941 Ga0207711_10170115 Ga0207711_101701152 327
474 3300025941 Ga0207711_10268390 Ga0207711_102683902 327
475 3300025942 Ga0207689_10004703 Ga0207689_100047038 327
476 3300025942 Ga0207689_10025437 Ga0207689_100254372 327
477 3300025942 Ga0207689_10035192 Ga0207689_100351925 327
478 3300025942 Ga0207689_10070732 Ga0207689_100707323 327
479 3300025942 Ga0207689_10093966 Ga0207689_100939662 327
480 3300025942 Ga0207689_10115682 Ga0207689_101156823 327
481 3300025942 Ga0207689_10153416 Ga0207689_101534161 327
482 3300025945 Ga0207679_10014681 Ga0207679_100146815 327
483 3300025961 Ga0207712_10004222 Ga0207712_100042226 327
484 3300025961 Ga0207712_10012477 Ga0207712_100124775 327
485 3300025961 Ga0207712_10031326 Ga0207712_100313263 327
486 3300025961 Ga0207712_10100961 Ga0207712_101009612 327
487 3300025961 Ga0207712_10105819 Ga0207712_101058192 327
488 3300025981 Ga0207640_10271530 Ga0207640_102715301 327
489 3300026023 Ga0207677_10008832 Ga0207677_100088323 327
490 3300026023 Ga0207677_10128913 Ga0207677_101289132 327
491 3300026035 Ga0207703_10000032 Ga0207703_10000032102 327
492 3300026035 Ga0207703_10037387 Ga0207703_100373873 327
493 3300026035 Ga0207703_10123582 Ga0207703_101235822 327
494 3300026035 Ga0207703_10233903 Ga0207703_102339031 327
495 3300026075 Ga0207708_10000080 Ga0207708_1000008016 327
496 3300026075 Ga0207708_10011233 Ga0207708_100112336 327
497 3300026075 Ga0207708_10030117 Ga0207708_100301174 327
498 3300026075 Ga0207708_10044607 Ga0207708_100446072 327
499 3300026075 Ga0207708_10071762 Ga0207708_100717623 327
500 3300026075 Ga0207708_10153999 Ga0207708_101539992 327
501 3300026075 Ga0207708_10163833 Ga0207708_101638332 327
502 3300026078 Ga0207702_10052323 Ga0207702_100523232 327
503 3300026088 Ga0207641_10302769 Ga0207641_103027691 327
504 3300026088 Ga0207641_10310859 Ga0207641_103108591 327
505 3300026088 Ga0207641_10382757 Ga0207641_103827571 327
506 3300026089 Ga0207648_10006470 Ga0207648_100064705 327
507 3300026089 Ga0207648_10059260 Ga0207648_100592602 327
508 3300026089 Ga0207648_10108721 Ga0207648_101087212 327
509 3300026089 Ga0207648_10109769 Ga0207648_101097693 327
510 3300026089 Ga0207648_10221792 Ga0207648_102217922 327
511 3300026095 Ga0207676_10030967 Ga0207676_100309675 327
512 3300026095 Ga0207676_10052560 Ga0207676_100525601 327
513 3300026095 Ga0207676_10079561 Ga0207676_100795613 327
514 3300026095 Ga0207676_10228322 Ga0207676_102283222 327
515 3300026095 Ga0207676_10274850 Ga0207676_102748502 327
516 3300026095 Ga0207676_10477040 Ga0207676_104770402 327
517 3300026116 Ga0207674_10015381 Ga0207674_100153812 327
518 3300026116 Ga0207674_10023682 Ga0207674_100236827 327
519 3300026116 Ga0207674_10288733 Ga0207674_102887332 327
520 3300026116 Ga0207674_10566078 Ga0207674_105660781 327
521 3300026118 Ga0207675_100000252 Ga0207675_10000025223 327
522 3300026118 Ga0207675_100037753 Ga0207675_1000377532 327
523 3300026118 Ga0207675_100136044 Ga0207675_1001360441 327
524 3300026118 Ga0207675_100276831 Ga0207675_1002768312 327
525 3300026118 Ga0207675_100528950 Ga0207675_1005289501 327
526 3300026121 Ga0207683_10150587 Ga0207683_101505872 327
527 3300026142 Ga0207698_10154547 Ga0207698_101545472 327
528 3300026142 Ga0207698_10180891 Ga0207698_101808912 327
529 3300027907 Ga0207428_10000449 Ga0207428_100004495 327
530 3300027907 Ga0207428_10002119 Ga0207428_1000211917 327
531 3300027907 Ga0207428_10067080 Ga0207428_100670802 327
532 3300028380 Ga0268265_10013661 Ga0268265_100136616 327
533 3300028380 Ga0268265_10031177 Ga0268265_100311773 327
534 3300028381 Ga0268264_10085187 Ga0268264_100851872 327
535 3300028381 Ga0268264_10138561 Ga0268264_101385612 327
536 3300028381 Ga0268264_10593171 Ga0268264_105931711 327
537 3300028794 Ga0307515_10065518 Ga0307515_100655183 327
538 3300031238 Ga0265332_10003403 Ga0265332_100034035 327
539 3300031507 Ga0307509_10049420 Ga0307509_100494202 327
540 3300031548 Ga0307408_100287800 Ga0307408_1002878002 327
541 3300031731 Ga0307405_10003793 Ga0307405_100037937 327
542 3300031901 Ga0307406_10101889 Ga0307406_101018892 327
543 3300032002 Ga0307416_100023009 Ga0307416_1000230095 327
544 3300032002 Ga0307416_100132451 Ga0307416_1001324512 327
545 3300035090 Ga0373949_0004798 Ga0373949_0004798_1991_2974 327
546 3300035170 Ga0373943_0014390 Ga0373943_0014390_2151_3251 327
547 3300035241 Ga0373961_0000038 Ga0373961_0000038_5071_6054 327
548 3300035725 Ga0373947_0077995 Ga0373947_0077995_654_1754 327
549 3300036401 Ga0373937_0016062 Ga0373937_0016062_68_1081 327
550 3300037418 Ga0395900_0138618 Ga0395900_0138618_1176_2159 327
551 3300037466 Ga0395898_0157831 Ga0395898_0157831_329_1312 327
552 3300037466 Ga0395898_0313755 Ga0395898_0313755_43_1026 327
553 3300038996 Ga0242420_009479 Ga0242420_009479_557_1540 327
554 3300039437 Ga0436365_0715042 Ga0436365_0715042_3818_4942 327
555 3300039437 Ga0436365_0896267 Ga0436365_0896267_61_1173 327
556 3300044673 Ga0453683_0023509 Ga0453683_0023509_2260_3273 327
557 3300045051 Ga0451576_0453405 Ga0451576_0453405_141_1124 327
558 3300046475 Ga0495639_0045578 Ga0495639_0045578_877_1866 327
559 3300046681 Ga0495647_0012526 Ga0495647_0012526_848_1837 327
560 3300048905 Ga0496102_0130388 Ga0496102_0130388_641_1633 327
561 3300048906 Ga0496103_0143690 Ga0496103_0143690_125_1117 327
562 3300048907 Ga0496104_0054805 Ga0496104_0054805_1474_2466 327
563 3300048907 Ga0496104_0365645 Ga0496104_0365645_237_1223 327
564 3300048909 Ga0496106_0118754 Ga0496106_0118754_332_1315 327
565 3300048909 Ga0496106_0183748 Ga0496106_0183748_140_1147 327
566 3300048911 Ga0496108_0070140 Ga0496108_0070140_754_1737 327
567 3300048911 Ga0496108_0160950 Ga0496108_0160950_827_1810 327
568 3300048912 Ga0496109_0000189 Ga0496109_0000189_13121_14203 327
569 3300048915 Ga0496112_0123617 Ga0496112_0123617_635_1618 327
570 3300048916 Ga0496113_0111079 Ga0496113_0111079_1002_1994 327
571 3300049514 Ga0501291_010775 Ga0501291_010775_299_1285 327
572 3300049521 Ga0501298_018823 Ga0501298_018823_275_1261 327
573 3300049526 Ga0501303_000634 Ga0501303_000634_1266_2252 327
574 3300049574 Ga0501038_0002453 Ga0501038_0002453_15234_16220 327
575 3300049574 Ga0501038_0174331 Ga0501038_0174331_664_1653 327
576 3300049588 Ga0501072_0017386 Ga0501072_0017386_1298_2287 327
577 3300049592 Ga0501076_0027434 Ga0501076_0027434_601_1593 327
578 3300049661 Ga0501217_004442 Ga0501217_004442_135_1121 327
579 3300049663 Ga0501223_003726 Ga0501223_003726_268_1260 327
580 3300049665 Ga0501227_000411 Ga0501227_000411_2430_3413 327
581 3300049668 Ga0501233_004582 Ga0501233_004582_109_1101 327
582 3300049668 Ga0501233_005147 Ga0501233_005147_1003_1986 327
583 3300049668 Ga0501233_008412 Ga0501233_008412_162_1145 327
584 3300049669 Ga0501235_005013 Ga0501235_005013_1164_2150 327
585 3300049675 Ga0501243_005204 Ga0501243_005204_524_1510 327
586 3300049686 Ga0501257_047299 Ga0501257_047299_62_1054 327
587 3300049705 Ga0501225_0011818 Ga0501225_0011818_962_1948 327
588 3300049741 Ga0501079_0083636 Ga0501079_0083636_671_1663 327
589 3300049743 Ga0501081_0103036 Ga0501081_0103036_312_1304 327
590 3300049824 Ga0501045_0162812 Ga0501045_0162812_17_1009 327
591 3300049853 Ga0501226_000354 Ga0501226_000354_3646_4629 327
592 3300050489 nmdc:mga03683_22202_c1 nmdc:mga03683_22202_c1_1026_2090 327
593 3300050491 nmdc:mga00v17_30593_c1 nmdc:mga00v17_30593_c1_1880_2944 327
594 3300050492 nmdc:mga0yw44_144913_c1 nmdc:mga0yw44_144913_c1_177_1292 327
595 3300050493 nmdc:mga0k408_28733_c2 nmdc:mga0k408_28733_c2_848_1912 327
596 3300050494 nmdc:mga06z11_16105_c1 nmdc:mga06z11_16105_c1_341_1405 327
597 3300050507 nmdc:mga05p37_123888_c1 nmdc:mga05p37_123888_c1_1818_2810 327
598 3300050507 nmdc:mga05p37_128718_c1 nmdc:mga05p37_128718_c1_796_1788 327
599 3300050507 nmdc:mga05p37_130459_c1 nmdc:mga05p37_130459_c1_573_1646 327
600 3300050507 nmdc:mga05p37_20401_c1 nmdc:mga05p37_20401_c1_5205_6287 327
601 3300050507 nmdc:mga05p37_263110_c1 nmdc:mga05p37_263110_c1_145_1128 327
602 3300050507 nmdc:mga05p37_354573_c1 nmdc:mga05p37_354573_c1_477_1556 327
603 3300050507 nmdc:mga05p37_45148_c1 nmdc:mga05p37_45148_c1_3929_4912 327
604 3300050507 nmdc:mga05p37_5670_c1 nmdc:mga05p37_5670_c1_8288_9274 327
605 3300050507 nmdc:mga05p37_571092_c1 nmdc:mga05p37_571092_c1_263_1249 327
606 3300050507 nmdc:mga05p37_800061_c1 nmdc:mga05p37_800061_c1_32_1015 327
607 3300050507 nmdc:mga05p37_84943_c1 nmdc:mga05p37_84943_c1_724_1806 327
608 3300050508 nmdc:mga09592_16979_c1 nmdc:mga09592_16979_c1_1264_2247 327
609 3300050508 nmdc:mga09592_249115_c1 nmdc:mga09592_249115_c1_255_1241 327
610 3300050508 nmdc:mga09592_278932_c1 nmdc:mga09592_278932_c1_256_1245 327
611 3300050510 nmdc:mga06r32_120557_c1 nmdc:mga06r32_120557_c1_1280_2362 327
612 3300050510 nmdc:mga06r32_132872_c1 nmdc:mga06r32_132872_c1_866_1849 327
613 3300050510 nmdc:mga06r32_18754_c1 nmdc:mga06r32_18754_c1_4984_6081 327
614 3300050510 nmdc:mga06r32_196920_c1 nmdc:mga06r32_196920_c1_682_1674 327
615 3300050510 nmdc:mga06r32_571762_c1 nmdc:mga06r32_571762_c1_89_1072 327
616 3300050510 nmdc:mga06r32_7254_c1 nmdc:mga06r32_7254_c1_6157_7236 327
617 3300050511 nmdc:mga08y16_153019_c1 nmdc:mga08y16_153019_c1_1042_2025 327
618 3300050511 nmdc:mga08y16_248160_c1 nmdc:mga08y16_248160_c1_514_1614 327
619 3300050511 nmdc:mga08y16_38799_c1 nmdc:mga08y16_38799_c1_1824_2807 327
620 3300050512 nmdc:mga0n895_110201_c1 nmdc:mga0n895_110201_c1_909_1901 327
621 3300050512 nmdc:mga0n895_110536_c1 nmdc:mga0n895_110536_c1_1008_1991 327
622 3300050512 nmdc:mga0n895_130851_c1 nmdc:mga0n895_130851_c1_474_1457 327
623 3300050512 nmdc:mga0n895_210719_c1 nmdc:mga0n895_210719_c1_115_1101 327
624 3300050512 nmdc:mga0n895_270775_c1 nmdc:mga0n895_270775_c1_391_1374 327
625 3300050512 nmdc:mga0n895_338998_c1 nmdc:mga0n895_338998_c1_105_1088 327
626 3300050512 nmdc:mga0n895_4533_c1 nmdc:mga0n895_4533_c1_8410_9393 327
627 3300050512 nmdc:mga0n895_53735_c1 nmdc:mga0n895_53735_c1_1644_2636 327
628 3300050512 nmdc:mga0n895_629438_c1 nmdc:mga0n895_629438_c1_21_1007 327
629 3300050512 nmdc:mga0n895_87329_c1 nmdc:mga0n895_87329_c1_1317_2396 327
630 3300050513 nmdc:mga0rr50_151_c1 nmdc:mga0rr50_151_c1_28370_29359 327
631 3300050513 nmdc:mga0rr50_200527_c1 nmdc:mga0rr50_200527_c1_10_996 327
632 3300050513 nmdc:mga0rr50_36995_c1 nmdc:mga0rr50_36995_c1_1438_2421 327
633 3300050513 nmdc:mga0rr50_55473_c1 nmdc:mga0rr50_55473_c1_257_1357 327
634 3300050513 nmdc:mga0rr50_8379_c1 nmdc:mga0rr50_8379_c1_1687_2670 327
635 3300050514 nmdc:mga08x19_46_c1 nmdc:mga08x19_46_c1_134424_135407 327
636 3300050514 nmdc:mga08x19_61_c1 nmdc:mga08x19_61_c1_28367_29356 327
637 3300050515 nmdc:mga0a205_108363_c1 nmdc:mga0a205_108363_c1_77_1060 327
638 3300050515 nmdc:mga0a205_204527_c1 nmdc:mga0a205_204527_c1_513_1592 327
639 3300050515 nmdc:mga0a205_4945_c1 nmdc:mga0a205_4945_c1_5440_6423 327
640 3300050515 nmdc:mga0a205_84799_c1 nmdc:mga0a205_84799_c1_911_1894 327
641 3300050515 nmdc:mga0a205_84870_c1 nmdc:mga0a205_84870_c1_146_1129 327
642 3300050515 nmdc:mga0a205_99790_c1 nmdc:mga0a205_99790_c1_493_1476 327
643 3300053092 Ga0500583_0157830 Ga0500583_0157830_59_1042 327
644 3300053120 Ga0500597_000348 Ga0500597_000348_8398_9381 327
645 3300053177 Ga0500636_0035310 Ga0500636_0035310_136_1119 327
646 3300054114 Ga0501084_0053935 Ga0501084_0053935_497_1486 327
647 3300060353 Ga0501082_0037531 Ga0501082_0037531_2825_3814 327
648 3300060353 Ga0501082_0260964 Ga0501082_0260964_28_1020 327
649 3300061734 Ga0530510_0198155 Ga0530510_0198155_332_1315 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

3

326

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pwy-assembly2.cif.gz_C structure of human dimeric acmsd in complex with the inhibitor tes-1025 0.8901 2 323
4ign-assembly2.cif.gz_B 2.32 angstrom x-ray crystal structure of r47a mutant of human acmsd 0.888 1 323
4ofc-assembly1.cif.gz_A 2.0 angstroms x-ray crystal structure of human 2-amino-3-carboxymuconate-6-semialdehye decarboxylase 0.8853 1 323
4lal-assembly2.cif.gz_D crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil 0.8832 1 323
4hk7-assembly1.cif.gz_C crystal structure of cordyceps militaris idcase in complex with uracil 0.8781 1 323
ID Description Score Start End Superfamily
4lalD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8832 1 323 3.20.20.140
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8809 2 323 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8805 1 323 3.20.20.140
3nurA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8757 1 323 3.20.20.140
4icmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8754 2 323 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7C2J9A6-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9981 159 323 GO:0005829
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8QDW8-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9977 84 327 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8QDW8-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9896 84 327 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A7C4H3Y7-F1-model_v4 Amidohydrolase 0.983 1 323 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A3C1G6X0-F1-model_v4 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase 0.9826 2 323 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Feature Viewer

pLDDT pTM Quality
95.52 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map