F472482
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 649 | 239 | 649 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300050508|nmdc:mga09592_249115_c1|nmdc:mga09592_249115_c1_255_1241 |
| Length | 328 |
| Sequence | MRLDLHTHFYTEHFFKMILHLPSDFSFGTSSTGQTIITYRGARFFGVTPAMTDVNKRIEDMDRAGIDVEVVSLSTPNVFFADAQHQPEVARMMNDFYAELIALHPKRFKGFASIPMDAPDAALDELHRAIDTLKLNGVILLSNIGGQPLTSPRYRAFFEEANRMKLCIFLHPMLPAGNSDSFREYVLGPIIGFPFDTSLAVARMCYDGMFEELPDIRWIIGHLGGAVPYLMERMDNGFRDFADCRVKIDKLPSVYLKRLYYDTVSFSPHTLMMVRNMVGADHMVMGSDYPHLLGSIDRAVTSIEGLEISEQEKTQIFSGTALQILNNV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 191 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 192 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 203 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 204 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 205 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 209 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 214 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 215 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 221 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 222 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 223 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 224 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 225 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 234 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 235 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 236 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 237 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.16 |
| Nodule | 0 |
| Rhizoplane | 1.85 |
| Rhizosphere | 95.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3631794 | 2162886007 | Unclassified | 1264 |
| 2 | CNAas_1001041 | 3300000532 | Unclassified | 2555 |
| 3 | JGI24034J14986_100094 | 3300001432 | Bacteria | 3749 |
| 4 | JGI24748J21848_1000001 | 3300002074 | Bacteria | 444271 |
| 5 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 6 | JGI24751J29686_10000109 | 3300002459 | Bacteria | 43362 |
| 7 | JGI24751J29686_10014682 | 3300002459 | Bacteria | 1616 |
| 8 | JGI25406J46586_10027947 | 3300003203 | Bacteria | 2155 |
| 9 | Ga0065714_10064496 | 3300005288 | Bacteria | 48442 |
| 10 | Ga0065712_10000123 | 3300005290 | Bacteria | 89338 |
| 11 | Ga0065712_10003222 | 3300005290 | Bacteria | 5166 |
| 12 | Ga0065712_10008191 | 3300005290 | Unclassified | 2589 |
| 13 | Ga0065712_10113064 | 3300005290 | Bacteria | 1789 |
| 14 | Ga0065712_10115535 | 3300005290 | Bacteria | 1750 |
| 15 | Ga0065712_10151656 | 3300005290 | Bacteria | 1365 |
| 16 | Ga0065715_10007224 | 3300005293 | Unclassified | 2797 |
| 17 | Ga0065715_10099279 | 3300005293 | Bacteria | 3375 |
| 18 | Ga0065715_10102128 | 3300005293 | Bacteria | 3141 |
| 19 | Ga0065715_10153163 | 3300005293 | Bacteria | 1706 |
| 20 | Ga0065715_10199947 | 3300005293 | Bacteria | 1367 |
| 21 | Ga0065715_10261560 | 3300005293 | Bacteria | 1136 |
| 22 | Ga0065707_10106495 | 3300005295 | Unclassified | 2593 |
| 23 | Ga0065707_10178833 | 3300005295 | Bacteria | 1432 |
| 24 | Ga0070676_10183141 | 3300005328 | Bacteria | 1363 |
| 25 | Ga0070690_100012341 | 3300005330 | Bacteria | 5026 |
| 26 | Ga0070690_100019832 | 3300005330 | Bacteria | 4090 |
| 27 | Ga0070670_100000876 | 3300005331 | Bacteria | 23661 |
| 28 | Ga0070670_100016061 | 3300005331 | Bacteria | 6425 |
| 29 | Ga0070670_100196000 | 3300005331 | Bacteria | 1755 |
| 30 | Ga0070670_100215218 | 3300005331 | Bacteria | 1671 |
| 31 | Ga0068869_100006969 | 3300005334 | Bacteria | 7194 |
| 32 | Ga0068869_100055707 | 3300005334 | Bacteria | 2882 |
| 33 | Ga0068869_100123637 | 3300005334 | Bacteria | 1982 |
| 34 | Ga0070666_10131065 | 3300005335 | Bacteria | 1742 |
| 35 | Ga0070680_100038601 | 3300005336 | Bacteria | 3862 |
| 36 | Ga0070680_100178026 | 3300005336 | Bacteria | 1790 |
| 37 | Ga0070682_100004044 | 3300005337 | Bacteria | 8151 |
| 38 | Ga0068868_100149770 | 3300005338 | Bacteria | 1921 |
| 39 | Ga0068868_100158548 | 3300005338 | Bacteria | 1867 |
| 40 | Ga0068868_100334881 | 3300005338 | Bacteria | 1292 |
| 41 | Ga0070660_100031470 | 3300005339 | Unclassified | 3985 |
| 42 | Ga0070689_100000428 | 3300005340 | Bacteria | 24792 |
| 43 | Ga0070689_100040774 | 3300005340 | Bacteria | 3560 |
| 44 | Ga0070689_100073380 | 3300005340 | Bacteria | 2676 |
| 45 | Ga0070689_100322854 | 3300005340 | Unclassified | 1290 |
| 46 | Ga0070687_100009970 | 3300005343 | Unclassified | 4087 |
| 47 | Ga0070687_100064569 | 3300005343 | Bacteria | 1945 |
| 48 | Ga0070687_100108661 | 3300005343 | Bacteria | 1566 |
| 49 | Ga0070692_10021963 | 3300005345 | Bacteria | 3112 |
| 50 | Ga0070692_10092310 | 3300005345 | Bacteria | 1647 |
| 51 | Ga0070669_100027390 | 3300005353 | Bacteria | 4101 |
| 52 | Ga0070669_100191842 | 3300005353 | Bacteria | 1603 |
| 53 | Ga0070675_100056278 | 3300005354 | Bacteria | 3240 |
| 54 | Ga0070675_100347512 | 3300005354 | Bacteria | 1315 |
| 55 | Ga0070671_100028519 | 3300005355 | Unclassified | 4597 |
| 56 | Ga0070671_100355497 | 3300005355 | Bacteria | 1251 |
| 57 | Ga0070674_100056702 | 3300005356 | Bacteria | 2717 |
| 58 | Ga0070673_100113909 | 3300005364 | Bacteria | 2246 |
| 59 | Ga0070673_100160918 | 3300005364 | Bacteria | 1909 |
| 60 | Ga0070673_100356340 | 3300005364 | Bacteria | 1300 |
| 61 | Ga0070688_100100120 | 3300005365 | Bacteria | 1909 |
| 62 | Ga0070659_100004392 | 3300005366 | Bacteria | 10070 |
| 63 | Ga0070703_10000016 | 3300005406 | Bacteria | 86253 |
| 64 | Ga0070703_10059597 | 3300005406 | Bacteria | 1245 |
| 65 | Ga0070709_10000006 | 3300005434 | Bacteria | 186534 |
| 66 | Ga0070701_10072558 | 3300005438 | Unclassified | 1844 |
| 67 | Ga0070701_10144232 | 3300005438 | Unclassified | 1365 |
| 68 | Ga0070701_10156323 | 3300005438 | Unclassified | 1317 |
| 69 | Ga0070711_100000051 | 3300005439 | Bacteria | 73775 |
| 70 | Ga0070705_100000696 | 3300005440 | Bacteria | 19155 |
| 71 | Ga0070705_100023912 | 3300005440 | Bacteria | 3289 |
| 72 | Ga0070705_100026598 | 3300005440 | Bacteria | 3151 |
| 73 | Ga0070705_100047944 | 3300005440 | Bacteria | 2472 |
| 74 | Ga0070700_100000062 | 3300005441 | Bacteria | 79866 |
| 75 | Ga0070700_100003264 | 3300005441 | Bacteria | 8356 |
| 76 | Ga0070700_100004838 | 3300005441 | Bacteria | 7071 |
| 77 | Ga0070700_100008899 | 3300005441 | Bacteria | 5490 |
| 78 | Ga0070700_100190431 | 3300005441 | Bacteria | 1434 |
| 79 | Ga0070700_100250878 | 3300005441 | Bacteria | 1269 |
| 80 | Ga0070694_100007641 | 3300005444 | Bacteria | 6599 |
| 81 | Ga0070694_100010574 | 3300005444 | Bacteria | 5698 |
| 82 | Ga0070694_100019905 | 3300005444 | Bacteria | 4273 |
| 83 | Ga0070694_100022235 | 3300005444 | Unclassified | 4061 |
| 84 | Ga0070694_100089345 | 3300005444 | Bacteria | 2159 |
| 85 | Ga0070708_100020861 | 3300005445 | Bacteria | 5532 |
| 86 | Ga0070708_100056928 | 3300005445 | Bacteria | 3479 |
| 87 | Ga0070708_100060297 | 3300005445 | Unclassified | 3386 |
| 88 | Ga0070708_100129277 | 3300005445 | Bacteria | 2337 |
| 89 | Ga0070662_100029352 | 3300005457 | Unclassified | 3838 |
| 90 | Ga0070662_100257364 | 3300005457 | Bacteria | 1405 |
| 91 | Ga0070681_10003045 | 3300005458 | Bacteria | 15543 |
| 92 | Ga0070681_10012847 | 3300005458 | Bacteria | 8315 |
| 93 | Ga0070681_10062544 | 3300005458 | Unclassified | 3696 |
| 94 | Ga0068867_100051030 | 3300005459 | Unclassified | 3050 |
| 95 | Ga0068867_100067049 | 3300005459 | Bacteria | 2674 |
| 96 | Ga0068867_100086562 | 3300005459 | Bacteria | 2371 |
| 97 | Ga0068867_100092167 | 3300005459 | Unclassified | 2301 |
| 98 | Ga0070706_100000137 | 3300005467 | Bacteria | 91778 |
| 99 | Ga0070706_100000689 | 3300005467 | Bacteria | 38267 |
| 100 | Ga0070706_100000746 | 3300005467 | Bacteria | 36612 |
| 101 | Ga0070706_100001693 | 3300005467 | Bacteria | 22957 |
| 102 | Ga0070706_100006487 | 3300005467 | Bacteria | 11045 |
| 103 | Ga0070706_100009200 | 3300005467 | Bacteria | 9199 |
| 104 | Ga0070706_100011920 | 3300005467 | Bacteria | 8070 |
| 105 | Ga0070706_100017853 | 3300005467 | Bacteria | 6546 |
| 106 | Ga0070706_100020638 | 3300005467 | Bacteria | 6071 |
| 107 | Ga0070706_100037010 | 3300005467 | Bacteria | 4508 |
| 108 | Ga0070706_100104396 | 3300005467 | Unclassified | 2636 |
| 109 | Ga0070706_100105625 | 3300005467 | Unclassified | 2620 |
| 110 | Ga0070706_100246007 | 3300005467 | Bacteria | 1670 |
| 111 | Ga0070706_100264256 | 3300005467 | Bacteria | 1606 |
| 112 | Ga0070707_100000081 | 3300005468 | Bacteria | 85320 |
| 113 | Ga0070707_100011165 | 3300005468 | Bacteria | 8369 |
| 114 | Ga0070707_100011799 | 3300005468 | Bacteria | 8159 |
| 115 | Ga0070707_100012982 | 3300005468 | Bacteria | 7783 |
| 116 | Ga0070707_100070567 | 3300005468 | Unclassified | 3365 |
| 117 | Ga0070707_100077992 | 3300005468 | Bacteria | 3196 |
| 118 | Ga0070707_100145636 | 3300005468 | Unclassified | 2305 |
| 119 | Ga0070698_100000107 | 3300005471 | Bacteria | 69457 |
| 120 | Ga0070698_100003825 | 3300005471 | Bacteria | 16544 |
| 121 | Ga0070698_100008313 | 3300005471 | Bacteria | 11221 |
| 122 | Ga0070698_100013741 | 3300005471 | Bacteria | 8569 |
| 123 | Ga0070698_100015062 | 3300005471 | Bacteria | 8175 |
| 124 | Ga0070698_100022491 | 3300005471 | Bacteria | 6596 |
| 125 | Ga0070698_100037232 | 3300005471 | Bacteria | 5017 |
| 126 | Ga0070698_100083257 | 3300005471 | Bacteria | 3189 |
| 127 | Ga0070698_100230793 | 3300005471 | Bacteria | 1784 |
| 128 | Ga0070699_100000083 | 3300005518 | Bacteria | 89561 |
| 129 | Ga0070699_100012438 | 3300005518 | Bacteria | 7344 |
| 130 | Ga0070699_100015800 | 3300005518 | Bacteria | 6481 |
| 131 | Ga0070699_100139539 | 3300005518 | Bacteria | 2140 |
| 132 | Ga0070699_100143380 | 3300005518 | Unclassified | 2110 |
| 133 | Ga0070699_100197197 | 3300005518 | Bacteria | 1790 |
| 134 | Ga0070679_100000047 | 3300005530 | Bacteria | 90654 |
| 135 | Ga0070679_100477664 | 3300005530 | Unclassified | 1191 |
| 136 | Ga0070697_100001026 | 3300005536 | Bacteria | 21075 |
| 137 | Ga0070697_100012574 | 3300005536 | Bacteria | 6630 |
| 138 | Ga0070697_100260769 | 3300005536 | Bacteria | 1484 |
| 139 | Ga0070697_100281709 | 3300005536 | Bacteria | 1426 |
| 140 | Ga0070672_100144408 | 3300005543 | Bacteria | 1965 |
| 141 | Ga0070686_100033913 | 3300005544 | Bacteria | 3140 |
| 142 | Ga0070686_100045111 | 3300005544 | Bacteria | 2775 |
| 143 | Ga0070695_100051581 | 3300005545 | Bacteria | 2640 |
| 144 | Ga0070695_100075494 | 3300005545 | Bacteria | 2218 |
| 145 | Ga0070695_100094848 | 3300005545 | Bacteria | 1999 |
| 146 | Ga0070695_100135131 | 3300005545 | Bacteria | 1704 |
| 147 | Ga0070696_100000738 | 3300005546 | Bacteria | 20879 |
| 148 | Ga0070696_100056427 | 3300005546 | Bacteria | 2739 |
| 149 | Ga0070693_100033630 | 3300005547 | Bacteria | 2831 |
| 150 | Ga0070665_100176054 | 3300005548 | Bacteria | 2140 |
| 151 | Ga0070665_100472762 | 3300005548 | Unclassified | 1264 |
| 152 | Ga0070704_100003599 | 3300005549 | Bacteria | 8903 |
| 153 | Ga0070704_100009963 | 3300005549 | Bacteria | 5771 |
| 154 | Ga0070704_100014338 | 3300005549 | Bacteria | 4949 |
| 155 | Ga0070704_100023137 | 3300005549 | Bacteria | 4052 |
| 156 | Ga0070704_100042452 | 3300005549 | Bacteria | 3146 |
| 157 | Ga0070704_100044725 | 3300005549 | Bacteria | 3079 |
| 158 | Ga0070704_100059680 | 3300005549 | Bacteria | 2722 |
| 159 | Ga0070704_100162844 | 3300005549 | Unclassified | 1766 |
| 160 | Ga0070704_100258725 | 3300005549 | Bacteria | 1433 |
| 161 | Ga0068855_100199075 | 3300005563 | Bacteria | 2256 |
| 162 | Ga0068855_100245074 | 3300005563 | Bacteria | 2000 |
| 163 | Ga0070664_100003326 | 3300005564 | Bacteria | 12992 |
| 164 | Ga0068857_100006924 | 3300005577 | Bacteria | 9756 |
| 165 | Ga0068857_100009546 | 3300005577 | Bacteria | 8427 |
| 166 | Ga0068857_100260180 | 3300005577 | Bacteria | 1592 |
| 167 | Ga0068856_100080156 | 3300005614 | Bacteria | 3238 |
| 168 | Ga0070702_100011698 | 3300005615 | Bacteria | 4373 |
| 169 | Ga0070702_100132215 | 3300005615 | Bacteria | 1578 |
| 170 | Ga0068852_100067674 | 3300005616 | Bacteria | 3123 |
| 171 | Ga0068852_100206871 | 3300005616 | Bacteria | 1860 |
| 172 | Ga0068852_100319007 | 3300005616 | Unclassified | 1508 |
| 173 | Ga0068859_100002197 | 3300005617 | Bacteria | 19807 |
| 174 | Ga0068859_100006037 | 3300005617 | Bacteria | 12300 |
| 175 | Ga0068859_100006648 | 3300005617 | Bacteria | 11744 |
| 176 | Ga0068859_100064763 | 3300005617 | Unclassified | 3688 |
| 177 | Ga0068859_100076248 | 3300005617 | Unclassified | 3393 |
| 178 | Ga0068859_100124300 | 3300005617 | Unclassified | 2648 |
| 179 | Ga0068859_100184032 | 3300005617 | Bacteria | 2172 |
| 180 | Ga0068859_100196708 | 3300005617 | Bacteria | 2100 |
| 181 | Ga0068859_100213936 | 3300005617 | Unclassified | 2014 |
| 182 | Ga0068859_100297677 | 3300005617 | Bacteria | 1707 |
| 183 | Ga0068864_100007415 | 3300005618 | Bacteria | 9032 |
| 184 | Ga0068864_100021405 | 3300005618 | Bacteria | 5417 |
| 185 | Ga0068864_100029783 | 3300005618 | Bacteria | 4626 |
| 186 | Ga0068864_100080416 | 3300005618 | Unclassified | 2855 |
| 187 | Ga0068864_100227406 | 3300005618 | Bacteria | 1724 |
| 188 | Ga0068864_100256167 | 3300005618 | Bacteria | 1626 |
| 189 | Ga0068866_10001186 | 3300005718 | Bacteria | 11388 |
| 190 | Ga0068861_100022555 | 3300005719 | Bacteria | 4538 |
| 191 | Ga0068861_100022865 | 3300005719 | Unclassified | 4507 |
| 192 | Ga0068870_10144581 | 3300005840 | Bacteria | 1394 |
| 193 | Ga0068863_100067078 | 3300005841 | Unclassified | 3394 |
| 194 | Ga0068863_100078355 | 3300005841 | Bacteria | 3129 |
| 195 | Ga0068863_100306011 | 3300005841 | Unclassified | 1542 |
| 196 | Ga0068863_100414096 | 3300005841 | Bacteria | 1319 |
| 197 | Ga0068858_100000044 | 3300005842 | Bacteria | 128977 |
| 198 | Ga0068858_100011114 | 3300005842 | Bacteria | 8511 |
| 199 | Ga0068858_100077403 | 3300005842 | Unclassified | 3090 |
| 200 | Ga0068858_100084246 | 3300005842 | Bacteria | 2957 |
| 201 | Ga0068858_100106671 | 3300005842 | Bacteria | 2615 |
| 202 | Ga0068858_100115221 | 3300005842 | Bacteria | 2511 |
| 203 | Ga0068858_100246115 | 3300005842 | Unclassified | 1698 |
| 204 | Ga0068858_100328909 | 3300005842 | Bacteria | 1462 |
| 205 | Ga0068860_100027304 | 3300005843 | Bacteria | 5500 |
| 206 | Ga0068860_100103763 | 3300005843 | Bacteria | 2714 |
| 207 | Ga0068860_100132324 | 3300005843 | Bacteria | 2394 |
| 208 | Ga0068860_100140083 | 3300005843 | Bacteria | 2324 |
| 209 | Ga0068860_100141115 | 3300005843 | Bacteria | 2316 |
| 210 | Ga0068860_100233533 | 3300005843 | Unclassified | 1788 |
| 211 | Ga0068860_100431934 | 3300005843 | Bacteria | 1307 |
| 212 | Ga0068862_100008290 | 3300005844 | Bacteria | 8598 |
| 213 | Ga0068862_100014370 | 3300005844 | Bacteria | 6567 |
| 214 | Ga0068862_100278425 | 3300005844 | Bacteria | 1532 |
| 215 | Ga0081455_10047437 | 3300005937 | Bacteria | 3720 |
| 216 | Ga0081455_10100978 | 3300005937 | Bacteria | 2316 |
| 217 | Ga0081540_1070278 | 3300005983 | Bacteria | 1622 |
| 218 | Ga0081539_10000887 | 3300005985 | Bacteria | 57193 |
| 219 | Ga0075365_10028836 | 3300006038 | Bacteria | 3542 |
| 220 | Ga0075364_10035347 | 3300006051 | Bacteria | 3228 |
| 221 | Ga0070716_100000004 | 3300006173 | Bacteria | 296614 |
| 222 | Ga0070716_100216352 | 3300006173 | Unclassified | 1284 |
| 223 | Ga0070712_100050786 | 3300006175 | Bacteria | 2887 |
| 224 | Ga0075362_10002309 | 3300006177 | Bacteria | 6375 |
| 225 | Ga0075367_10014809 | 3300006178 | Bacteria | 4225 |
| 226 | Ga0075366_10051168 | 3300006195 | Bacteria | 2454 |
| 227 | Ga0097621_100009292 | 3300006237 | Bacteria | 7134 |
| 228 | Ga0097621_100018054 | 3300006237 | Bacteria | 5378 |
| 229 | Ga0097621_100043674 | 3300006237 | Bacteria | 3614 |
| 230 | Ga0068871_100021032 | 3300006358 | Bacteria | 5008 |
| 231 | Ga0068871_100021401 | 3300006358 | Bacteria | 4970 |
| 232 | Ga0075428_100009182 | 3300006844 | Bacteria | 10968 |
| 233 | Ga0075428_100015913 | 3300006844 | Bacteria | 8322 |
| 234 | Ga0075428_100096868 | 3300006844 | Bacteria | 3216 |
| 235 | Ga0075428_100169084 | 3300006844 | Bacteria | 2371 |
| 236 | Ga0075428_100336825 | 3300006844 | Bacteria | 1620 |
| 237 | Ga0075431_100013940 | 3300006847 | Bacteria | 8119 |
| 238 | Ga0075431_100016154 | 3300006847 | Bacteria | 7574 |
| 239 | Ga0075431_100041399 | 3300006847 | Bacteria | 4749 |
| 240 | Ga0075433_10095985 | 3300006852 | Bacteria | 2624 |
| 241 | Ga0075433_10096947 | 3300006852 | Bacteria | 2610 |
| 242 | Ga0075433_10104884 | 3300006852 | Bacteria | 2504 |
| 243 | Ga0075433_10238704 | 3300006852 | Bacteria | 1613 |
| 244 | Ga0075434_100034377 | 3300006871 | Bacteria | 5005 |
| 245 | Ga0075434_100092528 | 3300006871 | Bacteria | 3026 |
| 246 | Ga0075434_100203541 | 3300006871 | Bacteria | 2000 |
| 247 | Ga0075434_100341969 | 3300006871 | Bacteria | 1517 |
| 248 | Ga0075429_100044853 | 3300006880 | Unclassified | 3846 |
| 249 | Ga0068865_100161034 | 3300006881 | Unclassified | 1712 |
| 250 | Ga0075436_100001301 | 3300006914 | Bacteria | 16968 |
| 251 | Ga0075436_100004655 | 3300006914 | Bacteria | 9399 |
| 252 | Ga0075436_100245711 | 3300006914 | Bacteria | 1273 |
| 253 | Ga0097620_100002197 | 3300006931 | Bacteria | 19807 |
| 254 | Ga0097620_100006037 | 3300006931 | Bacteria | 12300 |
| 255 | Ga0097620_100006648 | 3300006931 | Bacteria | 11744 |
| 256 | Ga0097620_100064764 | 3300006931 | Unclassified | 3688 |
| 257 | Ga0097620_100076249 | 3300006931 | Unclassified | 3393 |
| 258 | Ga0097620_100124297 | 3300006931 | Unclassified | 2648 |
| 259 | Ga0097620_100184024 | 3300006931 | Bacteria | 2172 |
| 260 | Ga0097620_100196705 | 3300006931 | Bacteria | 2100 |
| 261 | Ga0097620_100213937 | 3300006931 | Unclassified | 2014 |
| 262 | Ga0097620_100297680 | 3300006931 | Bacteria | 1707 |
| 263 | Ga0075435_100000292 | 3300007076 | Bacteria | 31075 |
| 264 | Ga0075435_100046663 | 3300007076 | Unclassified | 3476 |
| 265 | Ga0075435_100069186 | 3300007076 | Bacteria | 2877 |
| 266 | Ga0075435_100080087 | 3300007076 | Bacteria | 2681 |
| 267 | Ga0075435_100085714 | 3300007076 | Bacteria | 2593 |
| 268 | Ga0105240_10072884 | 3300009093 | Unclassified | 4243 |
| 269 | Ga0111539_10058991 | 3300009094 | Bacteria | 4552 |
| 270 | Ga0111539_10060008 | 3300009094 | Unclassified | 4508 |
| 271 | Ga0111539_10200113 | 3300009094 | Unclassified | 2329 |
| 272 | Ga0111539_10279905 | 3300009094 | Bacteria | 1941 |
| 273 | Ga0105245_10253483 | 3300009098 | Bacteria | 1710 |
| 274 | Ga0105247_10000004 | 3300009101 | Bacteria | 455497 |
| 275 | Ga0105247_10001464 | 3300009101 | Bacteria | 17002 |
| 276 | Ga0105247_10009326 | 3300009101 | Bacteria | 5957 |
| 277 | Ga0105247_10298939 | 3300009101 | Bacteria | 1116 |
| 278 | Ga0114129_10003077 | 3300009147 | Bacteria | 23398 |
| 279 | Ga0114129_10007145 | 3300009147 | Bacteria | 15890 |
| 280 | Ga0114129_10013377 | 3300009147 | Bacteria | 11693 |
| 281 | Ga0114129_10028310 | 3300009147 | Bacteria | 7939 |
| 282 | Ga0114129_10031498 | 3300009147 | Bacteria | 7496 |
| 283 | Ga0114129_10052996 | 3300009147 | Bacteria | 5691 |
| 284 | Ga0114129_10074786 | 3300009147 | Unclassified | 4718 |
| 285 | Ga0114129_10095175 | 3300009147 | Bacteria | 4125 |
| 286 | Ga0114129_10106750 | 3300009147 | Unclassified | 3868 |
| 287 | Ga0114129_10272910 | 3300009147 | Bacteria | 2262 |
| 288 | Ga0114129_10292442 | 3300009147 | Bacteria | 2173 |
| 289 | Ga0105243_10000240 | 3300009148 | Bacteria | 62821 |
| 290 | Ga0105243_10000573 | 3300009148 | Bacteria | 36983 |
| 291 | Ga0105243_10035191 | 3300009148 | Bacteria | 3881 |
| 292 | Ga0105243_10247541 | 3300009148 | Unclassified | 1590 |
| 293 | Ga0105241_10017940 | 3300009174 | Bacteria | 5204 |
| 294 | Ga0105241_10133211 | 3300009174 | Bacteria | 2014 |
| 295 | Ga0105242_10000222 | 3300009176 | Bacteria | 44723 |
| 296 | Ga0105242_10001271 | 3300009176 | Bacteria | 19930 |
| 297 | Ga0105242_10010557 | 3300009176 | Bacteria | 7092 |
| 298 | Ga0105242_10015359 | 3300009176 | Bacteria | 5946 |
| 299 | Ga0105242_10017782 | 3300009176 | Bacteria | 5547 |
| 300 | Ga0105242_10308045 | 3300009176 | Bacteria | 1448 |
| 301 | Ga0105248_10008970 | 3300009177 | Bacteria | 10996 |
| 302 | Ga0105248_10022191 | 3300009177 | Bacteria | 7038 |
| 303 | Ga0105248_10055195 | 3300009177 | Bacteria | 4455 |
| 304 | Ga0105248_10084538 | 3300009177 | Bacteria | 3569 |
| 305 | Ga0105248_10109336 | 3300009177 | Bacteria | 3117 |
| 306 | Ga0105248_10160290 | 3300009177 | Bacteria | 2538 |
| 307 | Ga0105248_10172833 | 3300009177 | Bacteria | 2435 |
| 308 | Ga0105248_10177888 | 3300009177 | Bacteria | 2397 |
| 309 | Ga0105248_10207042 | 3300009177 | Bacteria | 2210 |
| 310 | Ga0105248_10271234 | 3300009177 | Bacteria | 1911 |
| 311 | Ga0105237_10000334 | 3300009545 | Bacteria | 66523 |
| 312 | Ga0105237_10109188 | 3300009545 | Bacteria | 2758 |
| 313 | Ga0105238_10010300 | 3300009551 | Bacteria | 9379 |
| 314 | Ga0105249_10006116 | 3300009553 | Bacteria | 10441 |
| 315 | Ga0105249_10018220 | 3300009553 | Bacteria | 6241 |
| 316 | Ga0105249_10020906 | 3300009553 | Bacteria | 5853 |
| 317 | Ga0105249_10029641 | 3300009553 | Bacteria | 4943 |
| 318 | Ga0105249_10046928 | 3300009553 | Bacteria | 3933 |
| 319 | Ga0105249_10063970 | 3300009553 | Bacteria | 3381 |
| 320 | Ga0105249_10106369 | 3300009553 | Unclassified | 2647 |
| 321 | Ga0105239_10102080 | 3300010375 | Unclassified | 3174 |
| 322 | Ga0105239_10698847 | 3300010375 | Unclassified | 1159 |
| 323 | Ga0105246_10027558 | 3300011119 | Unclassified | 3724 |
| 324 | Ga0157373_10004904 | 3300013100 | Bacteria | 10074 |
| 325 | Ga0157373_10065994 | 3300013100 | Bacteria | 2561 |
| 326 | Ga0157371_10065740 | 3300013102 | Bacteria | 2568 |
| 327 | Ga0157374_10026240 | 3300013296 | Bacteria | 5242 |
| 328 | Ga0157378_10000025 | 3300013297 | Bacteria | 128568 |
| 329 | Ga0157378_10026893 | 3300013297 | Bacteria | 5074 |
| 330 | Ga0157378_10043708 | 3300013297 | Bacteria | 3978 |
| 331 | Ga0157378_10058112 | 3300013297 | Bacteria | 3449 |
| 332 | Ga0157378_10070099 | 3300013297 | Unclassified | 3147 |
| 333 | Ga0157378_10072694 | 3300013297 | Bacteria | 3090 |
| 334 | Ga0157378_10075670 | 3300013297 | Bacteria | 3032 |
| 335 | Ga0157378_10405712 | 3300013297 | Bacteria | 1344 |
| 336 | Ga0163162_10008906 | 3300013306 | Bacteria | 9758 |
| 337 | Ga0163162_10011757 | 3300013306 | Bacteria | 8538 |
| 338 | Ga0163162_10016001 | 3300013306 | Bacteria | 7332 |
| 339 | Ga0163162_10098561 | 3300013306 | Unclassified | 3012 |
| 340 | Ga0163162_10144974 | 3300013306 | Bacteria | 2490 |
| 341 | Ga0163162_10312777 | 3300013306 | Bacteria | 1703 |
| 342 | Ga0163162_10314110 | 3300013306 | Bacteria | 1700 |
| 343 | Ga0157372_10004643 | 3300013307 | Bacteria | 14598 |
| 344 | Ga0157372_10343093 | 3300013307 | Bacteria | 1740 |
| 345 | Ga0157375_10049802 | 3300013308 | Bacteria | 4106 |
| 346 | Ga0157375_10067012 | 3300013308 | Bacteria | 3586 |
| 347 | Ga0157375_10196996 | 3300013308 | Bacteria | 2169 |
| 348 | Ga0157375_10328158 | 3300013308 | Unclassified | 1695 |
| 349 | Ga0163163_10004395 | 3300014325 | Bacteria | 12012 |
| 350 | Ga0163163_10009284 | 3300014325 | Bacteria | 8772 |
| 351 | Ga0163163_10021104 | 3300014325 | Bacteria | 6144 |
| 352 | Ga0163163_10043112 | 3300014325 | Bacteria | 4422 |
| 353 | Ga0163163_10104899 | 3300014325 | Unclassified | 2852 |
| 354 | Ga0163163_10249018 | 3300014325 | Bacteria | 1827 |
| 355 | Ga0163163_10311915 | 3300014325 | Bacteria | 1626 |
| 356 | Ga0163163_10552382 | 3300014325 | Unclassified | 1214 |
| 357 | Ga0163163_10640946 | 3300014325 | Unclassified | 1126 |
| 358 | Ga0157380_10034342 | 3300014326 | Bacteria | 3912 |
| 359 | Ga0157380_10410147 | 3300014326 | Bacteria | 1288 |
| 360 | Ga0157377_10014866 | 3300014745 | Bacteria | 3970 |
| 361 | Ga0157377_10124174 | 3300014745 | Bacteria | 1568 |
| 362 | Ga0157379_10014334 | 3300014968 | Bacteria | 6956 |
| 363 | Ga0157379_10115018 | 3300014968 | Unclassified | 2419 |
| 364 | Ga0157376_10006817 | 3300014969 | Bacteria | 8086 |
| 365 | Ga0157376_10007899 | 3300014969 | Bacteria | 7632 |
| 366 | Ga0157376_10316380 | 3300014969 | Bacteria | 1483 |
| 367 | Ga0182007_10027242 | 3300015262 | Unclassified | 1972 |
| 368 | Ga0163161_10123664 | 3300017792 | Bacteria | 1946 |
| 369 | Ga0207672_1000062 | 3300025223 | Bacteria | 14385 |
| 370 | Ga0207697_10030617 | 3300025315 | Bacteria | 2202 |
| 371 | Ga0207697_10055723 | 3300025315 | Bacteria | 1639 |
| 372 | Ga0207656_10001825 | 3300025321 | Bacteria | 7073 |
| 373 | Ga0207653_10000065 | 3300025885 | Bacteria | 80727 |
| 374 | Ga0207653_10000070 | 3300025885 | Bacteria | 76652 |
| 375 | Ga0207653_10003408 | 3300025885 | Bacteria | 5016 |
| 376 | Ga0207653_10057557 | 3300025885 | Bacteria | 1305 |
| 377 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 378 | Ga0207710_10000776 | 3300025900 | Bacteria | 17388 |
| 379 | Ga0207710_10030148 | 3300025900 | Bacteria | 2364 |
| 380 | Ga0207688_10080130 | 3300025901 | Bacteria | 1863 |
| 381 | Ga0207680_10073150 | 3300025903 | Bacteria | 2130 |
| 382 | Ga0207647_10011627 | 3300025904 | Bacteria | 6164 |
| 383 | Ga0207685_10000021 | 3300025905 | Bacteria | 131248 |
| 384 | Ga0207699_10000003 | 3300025906 | Bacteria | 577076 |
| 385 | Ga0207645_10277202 | 3300025907 | Bacteria | 1113 |
| 386 | Ga0207643_10002307 | 3300025908 | Bacteria | 10377 |
| 387 | Ga0207643_10166597 | 3300025908 | Bacteria | 1328 |
| 388 | Ga0207684_10000090 | 3300025910 | Bacteria | 171831 |
| 389 | Ga0207684_10000314 | 3300025910 | Bacteria | 68706 |
| 390 | Ga0207684_10000515 | 3300025910 | Bacteria | 47938 |
| 391 | Ga0207684_10007510 | 3300025910 | Bacteria | 9810 |
| 392 | Ga0207684_10010306 | 3300025910 | Bacteria | 8230 |
| 393 | Ga0207684_10019527 | 3300025910 | Bacteria | 5796 |
| 394 | Ga0207684_10037214 | 3300025910 | Bacteria | 4129 |
| 395 | Ga0207684_10045008 | 3300025910 | Unclassified | 3744 |
| 396 | Ga0207684_10046124 | 3300025910 | Bacteria | 3697 |
| 397 | Ga0207684_10166785 | 3300025910 | Bacteria | 1898 |
| 398 | Ga0207684_10236848 | 3300025910 | Bacteria | 1575 |
| 399 | Ga0207707_10000006 | 3300025912 | Bacteria | 374131 |
| 400 | Ga0207707_10002499 | 3300025912 | Bacteria | 16555 |
| 401 | Ga0207707_10063587 | 3300025912 | Unclassified | 3212 |
| 402 | Ga0207695_10173522 | 3300025913 | Bacteria | 2080 |
| 403 | Ga0207671_10007914 | 3300025914 | Bacteria | 9120 |
| 404 | Ga0207671_10155085 | 3300025914 | Bacteria | 1771 |
| 405 | Ga0207663_10000003 | 3300025916 | Bacteria | 458807 |
| 406 | Ga0207660_10007861 | 3300025917 | Bacteria | 6902 |
| 407 | Ga0207660_10312956 | 3300025917 | Unclassified | 1252 |
| 408 | Ga0207662_10083541 | 3300025918 | Bacteria | 1952 |
| 409 | Ga0207662_10095439 | 3300025918 | Unclassified | 1836 |
| 410 | Ga0207662_10103649 | 3300025918 | Bacteria | 1765 |
| 411 | Ga0207662_10154121 | 3300025918 | Bacteria | 1464 |
| 412 | Ga0207657_10037330 | 3300025919 | Unclassified | 4339 |
| 413 | Ga0207652_10009231 | 3300025921 | Bacteria | 7934 |
| 414 | Ga0207652_10108713 | 3300025921 | Bacteria | 2457 |
| 415 | Ga0207646_10000076 | 3300025922 | Bacteria | 135473 |
| 416 | Ga0207646_10001170 | 3300025922 | Bacteria | 33272 |
| 417 | Ga0207646_10002078 | 3300025922 | Bacteria | 24029 |
| 418 | Ga0207646_10002536 | 3300025922 | Bacteria | 21546 |
| 419 | Ga0207646_10013680 | 3300025922 | Bacteria | 7749 |
| 420 | Ga0207646_10017025 | 3300025922 | Bacteria | 6813 |
| 421 | Ga0207646_10212487 | 3300025922 | Bacteria | 1747 |
| 422 | Ga0207646_10357858 | 3300025922 | Unclassified | 1319 |
| 423 | Ga0207681_10031479 | 3300025923 | Bacteria | 3465 |
| 424 | Ga0207681_10261039 | 3300025923 | Unclassified | 1356 |
| 425 | Ga0207681_10427295 | 3300025923 | Bacteria | 1074 |
| 426 | Ga0207694_10006023 | 3300025924 | Bacteria | 9277 |
| 427 | Ga0207650_10000047 | 3300025925 | Bacteria | 175675 |
| 428 | Ga0207650_10010016 | 3300025925 | Bacteria | 6488 |
| 429 | Ga0207650_10012820 | 3300025925 | Bacteria | 5792 |
| 430 | Ga0207659_10202227 | 3300025926 | Bacteria | 1587 |
| 431 | Ga0207659_10275335 | 3300025926 | Bacteria | 1374 |
| 432 | Ga0207687_10114315 | 3300025927 | Bacteria | 2009 |
| 433 | Ga0207644_10001021 | 3300025931 | Bacteria | 17910 |
| 434 | Ga0207644_10301971 | 3300025931 | Bacteria | 1290 |
| 435 | Ga0207690_10010825 | 3300025932 | Bacteria | 5435 |
| 436 | Ga0207690_10298481 | 3300025932 | Bacteria | 1260 |
| 437 | Ga0207706_10079474 | 3300025933 | Archaea | 2884 |
| 438 | Ga0207706_10115665 | 3300025933 | Bacteria | 2359 |
| 439 | Ga0207706_10297609 | 3300025933 | Bacteria | 1406 |
| 440 | Ga0207686_10000010 | 3300025934 | Bacteria | 227471 |
| 441 | Ga0207686_10001178 | 3300025934 | Bacteria | 15109 |
| 442 | Ga0207686_10003853 | 3300025934 | Bacteria | 8043 |
| 443 | Ga0207686_10022322 | 3300025934 | Bacteria | 3644 |
| 444 | Ga0207686_10091840 | 3300025934 | Bacteria | 2006 |
| 445 | Ga0207709_10000052 | 3300025935 | Bacteria | 227471 |
| 446 | Ga0207709_10004105 | 3300025935 | Bacteria | 8481 |
| 447 | Ga0207709_10063888 | 3300025935 | Bacteria | 2309 |
| 448 | Ga0207709_10088396 | 3300025935 | Bacteria | 2017 |
| 449 | Ga0207709_10191552 | 3300025935 | Bacteria | 1453 |
| 450 | Ga0207670_10001863 | 3300025936 | Bacteria | 11025 |
| 451 | Ga0207670_10037820 | 3300025936 | Bacteria | 3147 |
| 452 | Ga0207704_10216174 | 3300025938 | Unclassified | 1415 |
| 453 | Ga0207665_10000006 | 3300025939 | Bacteria | 184957 |
| 454 | Ga0207665_10059897 | 3300025939 | Unclassified | 2578 |
| 455 | Ga0207691_10075993 | 3300025940 | Bacteria | 3027 |
| 456 | Ga0207711_10008789 | 3300025941 | Bacteria | 8447 |
| 457 | Ga0207711_10024161 | 3300025941 | Bacteria | 5087 |
| 458 | Ga0207711_10025330 | 3300025941 | Bacteria | 4977 |
| 459 | Ga0207711_10062470 | 3300025941 | Bacteria | 3212 |
| 460 | Ga0207711_10106862 | 3300025941 | Unclassified | 2484 |
| 461 | Ga0207711_10170115 | 3300025941 | Bacteria | 1977 |
| 462 | Ga0207711_10268390 | 3300025941 | Bacteria | 1569 |
| 463 | Ga0207689_10004703 | 3300025942 | Bacteria | 12325 |
| 464 | Ga0207689_10025437 | 3300025942 | Bacteria | 4962 |
| 465 | Ga0207689_10035192 | 3300025942 | Bacteria | 4160 |
| 466 | Ga0207689_10070732 | 3300025942 | Bacteria | 2866 |
| 467 | Ga0207689_10093966 | 3300025942 | Bacteria | 2463 |
| 468 | Ga0207689_10115682 | 3300025942 | Bacteria | 2205 |
| 469 | Ga0207689_10153416 | 3300025942 | Unclassified | 1898 |
| 470 | Ga0207679_10014681 | 3300025945 | Bacteria | 5156 |
| 471 | Ga0207712_10004222 | 3300025961 | Bacteria | 9065 |
| 472 | Ga0207712_10012477 | 3300025961 | Bacteria | 5430 |
| 473 | Ga0207712_10031326 | 3300025961 | Bacteria | 3581 |
| 474 | Ga0207712_10100961 | 3300025961 | Bacteria | 2145 |
| 475 | Ga0207712_10105819 | 3300025961 | Archaea | 2100 |
| 476 | Ga0207640_10271530 | 3300025981 | Bacteria | 1327 |
| 477 | Ga0207677_10008832 | 3300026023 | Bacteria | 5647 |
| 478 | Ga0207677_10128913 | 3300026023 | Bacteria | 1917 |
| 479 | Ga0207703_10000032 | 3300026035 | Bacteria | 188472 |
| 480 | Ga0207703_10024888 | 3300026035 | Bacteria | 4710 |
| 481 | Ga0207703_10037387 | 3300026035 | Bacteria | 3867 |
| 482 | Ga0207703_10123582 | 3300026035 | Unclassified | 2225 |
| 483 | Ga0207703_10233903 | 3300026035 | Bacteria | 1649 |
| 484 | Ga0207708_10000080 | 3300026075 | Bacteria | 74889 |
| 485 | Ga0207708_10006626 | 3300026075 | Bacteria | 8572 |
| 486 | Ga0207708_10011233 | 3300026075 | Bacteria | 6664 |
| 487 | Ga0207708_10030117 | 3300026075 | Bacteria | 4116 |
| 488 | Ga0207708_10043398 | 3300026075 | Bacteria | 3427 |
| 489 | Ga0207708_10044607 | 3300026075 | Bacteria | 3378 |
| 490 | Ga0207708_10071762 | 3300026075 | Bacteria | 2653 |
| 491 | Ga0207708_10153999 | 3300026075 | Bacteria | 1812 |
| 492 | Ga0207708_10163833 | 3300026075 | Bacteria | 1757 |
| 493 | Ga0207708_10169493 | 3300026075 | Bacteria | 1728 |
| 494 | Ga0207702_10052323 | 3300026078 | Bacteria | 3455 |
| 495 | Ga0207641_10302769 | 3300026088 | Unclassified | 1511 |
| 496 | Ga0207641_10310859 | 3300026088 | Unclassified | 1491 |
| 497 | Ga0207641_10382757 | 3300026088 | Unclassified | 1348 |
| 498 | Ga0207648_10006470 | 3300026089 | Bacteria | 11634 |
| 499 | Ga0207648_10059260 | 3300026089 | Bacteria | 3338 |
| 500 | Ga0207648_10108721 | 3300026089 | Bacteria | 2434 |
| 501 | Ga0207648_10109769 | 3300026089 | Unclassified | 2422 |
| 502 | Ga0207648_10221792 | 3300026089 | Bacteria | 1680 |
| 503 | Ga0207676_10030967 | 3300026095 | Unclassified | 4020 |
| 504 | Ga0207676_10052560 | 3300026095 | Bacteria | 3185 |
| 505 | Ga0207676_10079561 | 3300026095 | Bacteria | 2658 |
| 506 | Ga0207676_10228322 | 3300026095 | Unclassified | 1662 |
| 507 | Ga0207676_10274850 | 3300026095 | Unclassified | 1527 |
| 508 | Ga0207676_10477040 | 3300026095 | Unclassified | 1181 |
| 509 | Ga0207674_10015381 | 3300026116 | Bacteria | 8406 |
| 510 | Ga0207674_10023682 | 3300026116 | Bacteria | 6572 |
| 511 | Ga0207674_10214247 | 3300026116 | Bacteria | 1875 |
| 512 | Ga0207674_10288733 | 3300026116 | Unclassified | 1589 |
| 513 | Ga0207674_10566078 | 3300026116 | Unclassified | 1098 |
| 514 | Ga0207675_100000252 | 3300026118 | Bacteria | 51296 |
| 515 | Ga0207675_100037753 | 3300026118 | Bacteria | 4506 |
| 516 | Ga0207675_100136044 | 3300026118 | Bacteria | 2331 |
| 517 | Ga0207675_100276831 | 3300026118 | Bacteria | 1630 |
| 518 | Ga0207675_100528950 | 3300026118 | Unclassified | 1176 |
| 519 | Ga0207683_10150587 | 3300026121 | Bacteria | 2099 |
| 520 | Ga0207698_10154547 | 3300026142 | Bacteria | 1996 |
| 521 | Ga0207698_10180891 | 3300026142 | Bacteria | 1868 |
| 522 | Ga0207428_10000449 | 3300027907 | Bacteria | 50066 |
| 523 | Ga0207428_10002119 | 3300027907 | Bacteria | 19981 |
| 524 | Ga0207428_10067080 | 3300027907 | Unclassified | 2826 |
| 525 | Ga0268265_10013661 | 3300028380 | Bacteria | 5524 |
| 526 | Ga0268265_10031177 | 3300028380 | Bacteria | 3848 |
| 527 | Ga0268264_10085187 | 3300028381 | Bacteria | 2712 |
| 528 | Ga0268264_10107507 | 3300028381 | Bacteria | 2437 |
| 529 | Ga0268264_10138561 | 3300028381 | Bacteria | 2167 |
| 530 | Ga0268264_10593171 | 3300028381 | Bacteria | 1091 |
| 531 | Ga0307515_10065518 | 3300028794 | Bacteria | 5053 |
| 532 | Ga0265332_10003403 | 3300031238 | Bacteria | 7694 |
| 533 | Ga0307509_10049420 | 3300031507 | Bacteria | 4509 |
| 534 | Ga0307408_100287800 | 3300031548 | Bacteria | 1371 |
| 535 | Ga0307408_100333402 | 3300031548 | Unclassified | 1282 |
| 536 | Ga0307405_10003793 | 3300031731 | Bacteria | 7024 |
| 537 | Ga0307406_10101889 | 3300031901 | Bacteria | 1957 |
| 538 | Ga0307416_100023009 | 3300032002 | Bacteria | 4512 |
| 539 | Ga0307416_100132451 | 3300032002 | Bacteria | 2247 |
| 540 | Ga0373949_0004798 | 3300035090 | Bacteria | 3067 |
| 541 | Ga0373943_0014390 | 3300035170 | Bacteria | 3582 |
| 542 | Ga0373961_0000038 | 3300035241 | Bacteria | 78956 |
| 543 | Ga0373947_0077995 | 3300035725 | Unclassified | 2044 |
| 544 | Ga0373937_0016062 | 3300036401 | Bacteria | 6641 |
| 545 | Ga0395900_0138618 | 3300037418 | Bacteria | 2492 |
| 546 | Ga0395898_0157831 | 3300037466 | Unclassified | 2170 |
| 547 | Ga0395898_0313755 | 3300037466 | Bacteria | 1496 |
| 548 | Ga0242420_009479 | 3300038996 | Unclassified | 1598 |
| 549 | Ga0436365_0715042 | 3300039437 | Bacteria | 6821 |
| 550 | Ga0436365_0896267 | 3300039437 | Unclassified | 4203 |
| 551 | Ga0453683_0023509 | 3300044673 | Bacteria | 3928 |
| 552 | Ga0451576_0453405 | 3300045051 | Unclassified | 1346 |
| 553 | Ga0495639_0045578 | 3300046475 | Unclassified | 1984 |
| 554 | Ga0495647_0012526 | 3300046681 | Bacteria | 2921 |
| 555 | Ga0496102_0130388 | 3300048905 | Bacteria | 2353 |
| 556 | Ga0496103_0143690 | 3300048906 | Bacteria | 1527 |
| 557 | Ga0496104_0054805 | 3300048907 | Bacteria | 3769 |
| 558 | Ga0496104_0365645 | 3300048907 | Unclassified | 1355 |
| 559 | Ga0496106_0118754 | 3300048909 | Bacteria | 2065 |
| 560 | Ga0496106_0183748 | 3300048909 | Bacteria | 1660 |
| 561 | Ga0496108_0070140 | 3300048911 | Bacteria | 2958 |
| 562 | Ga0496108_0160950 | 3300048911 | Unclassified | 1940 |
| 563 | Ga0496109_0000189 | 3300048912 | Bacteria | 61378 |
| 564 | Ga0496112_0059849 | 3300048915 | Bacteria | 3753 |
| 565 | Ga0496112_0123617 | 3300048915 | Bacteria | 2559 |
| 566 | Ga0496113_0111079 | 3300048916 | Unclassified | 2134 |
| 567 | Ga0501291_010775 | 3300049514 | Bacteria | 1307 |
| 568 | Ga0501298_018823 | 3300049521 | Unclassified | 1274 |
| 569 | Ga0501303_000634 | 3300049526 | Unclassified | 2716 |
| 570 | Ga0501038_0002453 | 3300049574 | Bacteria | 17278 |
| 571 | Ga0501038_0174331 | 3300049574 | Unclassified | 1739 |
| 572 | Ga0501072_0017386 | 3300049588 | Bacteria | 5525 |
| 573 | Ga0501076_0027434 | 3300049592 | Bacteria | 4417 |
| 574 | Ga0501217_004442 | 3300049661 | Bacteria | 2884 |
| 575 | Ga0501223_003726 | 3300049663 | Bacteria | 3294 |
| 576 | Ga0501227_000411 | 3300049665 | Bacteria | 9103 |
| 577 | Ga0501233_004582 | 3300049668 | Bacteria | 2540 |
| 578 | Ga0501233_005147 | 3300049668 | Bacteria | 2421 |
| 579 | Ga0501233_008412 | 3300049668 | Bacteria | 1988 |
| 580 | Ga0501235_005013 | 3300049669 | Bacteria | 2873 |
| 581 | Ga0501243_005204 | 3300049675 | Unclassified | 1956 |
| 582 | Ga0501257_047299 | 3300049686 | Unclassified | 1067 |
| 583 | Ga0501225_0011818 | 3300049705 | Unclassified | 2455 |
| 584 | Ga0501079_0083636 | 3300049741 | Bacteria | 2469 |
| 585 | Ga0501081_0103036 | 3300049743 | Bacteria | 2019 |
| 586 | Ga0501045_0162812 | 3300049824 | Bacteria | 1661 |
| 587 | Ga0501226_000354 | 3300049853 | Bacteria | 6691 |
| 588 | nmdc:mga03683_22202_c1 | 3300050489 | Bacteria | 2459 |
| 589 | nmdc:mga00v17_30593_c1 | 3300050491 | Bacteria | 3169 |
| 590 | nmdc:mga0yw44_144913_c1 | 3300050492 | Bacteria | 1546 |
| 591 | nmdc:mga0k408_28733_c2 | 3300050493 | Bacteria | 2342 |
| 592 | nmdc:mga06z11_16105_c1 | 3300050494 | Bacteria | 3358 |
| 593 | nmdc:mga05p37_123888_c1 | 3300050507 | Unclassified | 3175 |
| 594 | nmdc:mga05p37_128718_c1 | 3300050507 | Bacteria | 3108 |
| 595 | nmdc:mga05p37_130459_c1 | 3300050507 | Bacteria | 3084 |
| 596 | nmdc:mga05p37_20401_c1 | 3300050507 | Bacteria | 8017 |
| 597 | nmdc:mga05p37_263110_c1 | 3300050507 | Unclassified | 2063 |
| 598 | nmdc:mga05p37_354573_c1 | 3300050507 | Unclassified | 1726 |
| 599 | nmdc:mga05p37_45148_c1 | 3300050507 | Bacteria | 5421 |
| 600 | nmdc:mga05p37_5670_c1 | 3300050507 | Bacteria | 14680 |
| 601 | nmdc:mga05p37_571092_c1 | 3300050507 | Unclassified | 1283 |
| 602 | nmdc:mga05p37_800061_c1 | 3300050507 | Unclassified | 1032 |
| 603 | nmdc:mga05p37_84943_c1 | 3300050507 | Bacteria | 3899 |
| 604 | nmdc:mga09592_16979_c1 | 3300050508 | Bacteria | 5955 |
| 605 | nmdc:mga09592_249115_c1 | 3300050508 | Unclassified | 1539 |
| 606 | nmdc:mga09592_278932_c1 | 3300050508 | Bacteria | 1449 |
| 607 | nmdc:mga06r32_120557_c1 | 3300050510 | Bacteria | 2587 |
| 608 | nmdc:mga06r32_132872_c1 | 3300050510 | Bacteria | 2462 |
| 609 | nmdc:mga06r32_18754_c1 | 3300050510 | Bacteria | 6340 |
| 610 | nmdc:mga06r32_196920_c1 | 3300050510 | Bacteria | 2002 |
| 611 | nmdc:mga06r32_571762_c1 | 3300050510 | Bacteria | 1103 |
| 612 | nmdc:mga06r32_7254_c1 | 3300050510 | Bacteria | 9986 |
| 613 | nmdc:mga08y16_153019_c1 | 3300050511 | Bacteria | 2397 |
| 614 | nmdc:mga08y16_248160_c1 | 3300050511 | Bacteria | 1839 |
| 615 | nmdc:mga08y16_38799_c1 | 3300050511 | Unclassified | 4999 |
| 616 | nmdc:mga0n895_110201_c1 | 3300050512 | Bacteria | 2768 |
| 617 | nmdc:mga0n895_110536_c1 | 3300050512 | Bacteria | 2764 |
| 618 | nmdc:mga0n895_130851_c1 | 3300050512 | Bacteria | 2534 |
| 619 | nmdc:mga0n895_210719_c1 | 3300050512 | Bacteria | 1973 |
| 620 | nmdc:mga0n895_270775_c1 | 3300050512 | Unclassified | 1723 |
| 621 | nmdc:mga0n895_338998_c1 | 3300050512 | Bacteria | 1523 |
| 622 | nmdc:mga0n895_4533_c1 | 3300050512 | Bacteria | 11435 |
| 623 | nmdc:mga0n895_53735_c1 | 3300050512 | Bacteria | 3959 |
| 624 | nmdc:mga0n895_629438_c1 | 3300050512 | Bacteria | 1073 |
| 625 | nmdc:mga0n895_87329_c1 | 3300050512 | Bacteria | 3116 |
| 626 | nmdc:mga0rr50_11169_c1 | 3300050513 | Bacteria | 5730 |
| 627 | nmdc:mga0rr50_151_c1 | 3300050513 | Bacteria | 37856 |
| 628 | nmdc:mga0rr50_200527_c1 | 3300050513 | Bacteria | 1639 |
| 629 | nmdc:mga0rr50_36995_c1 | 3300050513 | Unclassified | 3520 |
| 630 | nmdc:mga0rr50_55473_c1 | 3300050513 | Bacteria | 2956 |
| 631 | nmdc:mga0rr50_8379_c1 | 3300050513 | Bacteria | 6434 |
| 632 | nmdc:mga08x19_46_c1 | 3300050514 | Bacteria | 145818 |
| 633 | nmdc:mga08x19_61_c1 | 3300050514 | Bacteria | 114972 |
| 634 | nmdc:mga0a205_108363_c1 | 3300050515 | Bacteria | 2676 |
| 635 | nmdc:mga0a205_108810_c1 | 3300050515 | Bacteria | 2670 |
| 636 | nmdc:mga0a205_204527_c1 | 3300050515 | Bacteria | 1864 |
| 637 | nmdc:mga0a205_21437_c1 | 3300050515 | Bacteria | 6112 |
| 638 | nmdc:mga0a205_4945_c1 | 3300050515 | Bacteria | 11986 |
| 639 | nmdc:mga0a205_84799_c1 | 3300050515 | Bacteria | 3060 |
| 640 | nmdc:mga0a205_84870_c1 | 3300050515 | Unclassified | 3059 |
| 641 | nmdc:mga0a205_99790_c1 | 3300050515 | Bacteria | 2802 |
| 642 | Ga0500583_0157830 | 3300053092 | Bacteria | 1130 |
| 643 | Ga0500566_0016621 | 3300053094 | Bacteria | 4319 |
| 644 | Ga0500597_000348 | 3300053120 | Bacteria | 9595 |
| 645 | Ga0500636_0035310 | 3300053177 | Bacteria | 2959 |
| 646 | Ga0501084_0053935 | 3300054114 | Bacteria | 3363 |
| 647 | Ga0501082_0037531 | 3300060353 | Unclassified | 4177 |
| 648 | Ga0501082_0260964 | 3300060353 | Bacteria | 1507 |
| 649 | Ga0530510_0198155 | 3300061734 | Bacteria | 1491 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050513 | nmdc:mga0rr50_11169_c1 | nmdc:mga0rr50_11169_c1_1263_2198 | 311 |
| 2 | 3300050515 | nmdc:mga0a205_21437_c1 | nmdc:mga0a205_21437_c1_986_1969 | 322 |
| 3 | 3300025932 | Ga0207690_10298481 | Ga0207690_102984811 | 323 |
| 4 | 3300026075 | Ga0207708_10043398 | Ga0207708_100433981 | 323 |
| 5 | 3300031548 | Ga0307408_100333402 | Ga0307408_1003334021 | 323 |
| 6 | 3300005441 | Ga0070700_100004838 | Ga0070700_1000048382 | 324 |
| 7 | 3300005616 | Ga0068852_100319007 | Ga0068852_1003190072 | 324 |
| 8 | 3300005617 | Ga0068859_100064763 | Ga0068859_1000647632 | 324 |
| 9 | 3300005843 | Ga0068860_100233533 | Ga0068860_1002335332 | 324 |
| 10 | 3300006931 | Ga0097620_100064764 | Ga0097620_1000647642 | 324 |
| 11 | 3300025315 | Ga0207697_10055723 | Ga0207697_100557232 | 324 |
| 12 | 3300026035 | Ga0207703_10024888 | Ga0207703_100248881 | 324 |
| 13 | 3300026075 | Ga0207708_10006626 | Ga0207708_100066266 | 324 |
| 14 | 3300028381 | Ga0268264_10107507 | Ga0268264_101075072 | 324 |
| 15 | 3300003203 | JGI25406J46586_10027947 | JGI25406J46586_100279472 | 325 |
| 16 | 3300005441 | Ga0070700_100190431 | Ga0070700_1001904312 | 325 |
| 17 | 3300005471 | Ga0070698_100037232 | Ga0070698_1000372323 | 325 |
| 18 | 3300005518 | Ga0070699_100143380 | Ga0070699_1001433802 | 325 |
| 19 | 3300005618 | Ga0068864_100227406 | Ga0068864_1002274061 | 325 |
| 20 | 3300005840 | Ga0068870_10144581 | Ga0068870_101445812 | 325 |
| 21 | 3300005985 | Ga0081539_10000887 | Ga0081539_1000088740 | 325 |
| 22 | 3300025908 | Ga0207643_10166597 | Ga0207643_101665972 | 325 |
| 23 | 3300025918 | Ga0207662_10154121 | Ga0207662_101541212 | 325 |
| 24 | 3300025922 | Ga0207646_10013680 | Ga0207646_100136802 | 325 |
| 25 | 3300026075 | Ga0207708_10169493 | Ga0207708_101694932 | 325 |
| 26 | 3300026116 | Ga0207674_10214247 | Ga0207674_102142472 | 325 |
| 27 | 3300048915 | Ga0496112_0059849 | Ga0496112_0059849_1353_2333 | 325 |
| 28 | 3300053094 | Ga0500566_0016621 | Ga0500566_0016621_2763_3740 | 325 |
| 29 | 3300005577 | Ga0068857_100260180 | Ga0068857_1002601802 | 326 |
| 30 | 3300006852 | Ga0075433_10096947 | Ga0075433_100969472 | 326 |
| 31 | 3300025908 | Ga0207643_10002307 | Ga0207643_100023072 | 326 |
| 32 | 3300050515 | nmdc:mga0a205_108810_c1 | nmdc:mga0a205_108810_c1_1364_2422 | 326 |
| 33 | 2162886007 | SwRhRL2b_contig_3631794 | SwRhRL2b_0387.00006650 | 327 |
| 34 | 3300000532 | CNAas_1001041 | CNAas_10010412 | 327 |
| 35 | 3300001432 | JGI24034J14986_100094 | JGI24034J14986_1000943 | 327 |
| 36 | 3300002074 | JGI24748J21848_1000001 | JGI24748J21848_1000001191 | 327 |
| 37 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_10000001225 | 327 |
| 38 | 3300002459 | JGI24751J29686_10000109 | JGI24751J29686_100001093 | 327 |
| 39 | 3300002459 | JGI24751J29686_10014682 | JGI24751J29686_100146822 | 327 |
| 40 | 3300005288 | Ga0065714_10064496 | Ga0065714_100644969 | 327 |
| 41 | 3300005290 | Ga0065712_10000123 | Ga0065712_1000012344 | 327 |
| 42 | 3300005290 | Ga0065712_10003222 | Ga0065712_100032222 | 327 |
| 43 | 3300005290 | Ga0065712_10008191 | Ga0065712_100081914 | 327 |
| 44 | 3300005290 | Ga0065712_10113064 | Ga0065712_101130643 | 327 |
| 45 | 3300005290 | Ga0065712_10115535 | Ga0065712_101155352 | 327 |
| 46 | 3300005290 | Ga0065712_10151656 | Ga0065712_101516562 | 327 |
| 47 | 3300005293 | Ga0065715_10007224 | Ga0065715_100072242 | 327 |
| 48 | 3300005293 | Ga0065715_10099279 | Ga0065715_100992791 | 327 |
| 49 | 3300005293 | Ga0065715_10102128 | Ga0065715_101021284 | 327 |
| 50 | 3300005293 | Ga0065715_10153163 | Ga0065715_101531632 | 327 |
| 51 | 3300005293 | Ga0065715_10199947 | Ga0065715_101999471 | 327 |
| 52 | 3300005293 | Ga0065715_10261560 | Ga0065715_102615601 | 327 |
| 53 | 3300005295 | Ga0065707_10106495 | Ga0065707_101064952 | 327 |
| 54 | 3300005295 | Ga0065707_10178833 | Ga0065707_101788331 | 327 |
| 55 | 3300005328 | Ga0070676_10183141 | Ga0070676_101831412 | 327 |
| 56 | 3300005330 | Ga0070690_100012341 | Ga0070690_1000123412 | 327 |
| 57 | 3300005330 | Ga0070690_100019832 | Ga0070690_1000198322 | 327 |
| 58 | 3300005331 | Ga0070670_100000876 | Ga0070670_10000087619 | 327 |
| 59 | 3300005331 | Ga0070670_100016061 | Ga0070670_1000160612 | 327 |
| 60 | 3300005331 | Ga0070670_100196000 | Ga0070670_1001960002 | 327 |
| 61 | 3300005331 | Ga0070670_100215218 | Ga0070670_1002152182 | 327 |
| 62 | 3300005334 | Ga0068869_100006969 | Ga0068869_1000069695 | 327 |
| 63 | 3300005334 | Ga0068869_100055707 | Ga0068869_1000557073 | 327 |
| 64 | 3300005334 | Ga0068869_100123637 | Ga0068869_1001236372 | 327 |
| 65 | 3300005335 | Ga0070666_10131065 | Ga0070666_101310652 | 327 |
| 66 | 3300005336 | Ga0070680_100038601 | Ga0070680_1000386012 | 327 |
| 67 | 3300005336 | Ga0070680_100178026 | Ga0070680_1001780262 | 327 |
| 68 | 3300005337 | Ga0070682_100004044 | Ga0070682_1000040444 | 327 |
| 69 | 3300005338 | Ga0068868_100149770 | Ga0068868_1001497702 | 327 |
| 70 | 3300005338 | Ga0068868_100158548 | Ga0068868_1001585483 | 327 |
| 71 | 3300005338 | Ga0068868_100334881 | Ga0068868_1003348811 | 327 |
| 72 | 3300005339 | Ga0070660_100031470 | Ga0070660_1000314704 | 327 |
| 73 | 3300005340 | Ga0070689_100000428 | Ga0070689_10000042814 | 327 |
| 74 | 3300005340 | Ga0070689_100040774 | Ga0070689_1000407742 | 327 |
| 75 | 3300005340 | Ga0070689_100073380 | Ga0070689_1000733802 | 327 |
| 76 | 3300005340 | Ga0070689_100322854 | Ga0070689_1003228541 | 327 |
| 77 | 3300005343 | Ga0070687_100009970 | Ga0070687_1000099702 | 327 |
| 78 | 3300005343 | Ga0070687_100064569 | Ga0070687_1000645692 | 327 |
| 79 | 3300005343 | Ga0070687_100108661 | Ga0070687_1001086612 | 327 |
| 80 | 3300005345 | Ga0070692_10021963 | Ga0070692_100219633 | 327 |
| 81 | 3300005345 | Ga0070692_10092310 | Ga0070692_100923102 | 327 |
| 82 | 3300005353 | Ga0070669_100027390 | Ga0070669_1000273905 | 327 |
| 83 | 3300005353 | Ga0070669_100191842 | Ga0070669_1001918422 | 327 |
| 84 | 3300005354 | Ga0070675_100056278 | Ga0070675_1000562784 | 327 |
| 85 | 3300005354 | Ga0070675_100347512 | Ga0070675_1003475121 | 327 |
| 86 | 3300005355 | Ga0070671_100028519 | Ga0070671_1000285193 | 327 |
| 87 | 3300005355 | Ga0070671_100355497 | Ga0070671_1003554971 | 327 |
| 88 | 3300005356 | Ga0070674_100056702 | Ga0070674_1000567022 | 327 |
| 89 | 3300005364 | Ga0070673_100113909 | Ga0070673_1001139092 | 327 |
| 90 | 3300005364 | Ga0070673_100160918 | Ga0070673_1001609182 | 327 |
| 91 | 3300005364 | Ga0070673_100356340 | Ga0070673_1003563401 | 327 |
| 92 | 3300005365 | Ga0070688_100100120 | Ga0070688_1001001202 | 327 |
| 93 | 3300005366 | Ga0070659_100004392 | Ga0070659_1000043924 | 327 |
| 94 | 3300005406 | Ga0070703_10000016 | Ga0070703_1000001642 | 327 |
| 95 | 3300005406 | Ga0070703_10059597 | Ga0070703_100595971 | 327 |
| 96 | 3300005434 | Ga0070709_10000006 | Ga0070709_100000064 | 327 |
| 97 | 3300005438 | Ga0070701_10072558 | Ga0070701_100725582 | 327 |
| 98 | 3300005438 | Ga0070701_10144232 | Ga0070701_101442321 | 327 |
| 99 | 3300005438 | Ga0070701_10156323 | Ga0070701_101563231 | 327 |
| 100 | 3300005439 | Ga0070711_100000051 | Ga0070711_1000000517 | 327 |
| 101 | 3300005440 | Ga0070705_100000696 | Ga0070705_10000069615 | 327 |
| 102 | 3300005440 | Ga0070705_100023912 | Ga0070705_1000239124 | 327 |
| 103 | 3300005440 | Ga0070705_100026598 | Ga0070705_1000265982 | 327 |
| 104 | 3300005440 | Ga0070705_100047944 | Ga0070705_1000479442 | 327 |
| 105 | 3300005441 | Ga0070700_100000062 | Ga0070700_10000006253 | 327 |
| 106 | 3300005441 | Ga0070700_100003264 | Ga0070700_1000032643 | 327 |
| 107 | 3300005441 | Ga0070700_100008899 | Ga0070700_1000088995 | 327 |
| 108 | 3300005441 | Ga0070700_100250878 | Ga0070700_1002508781 | 327 |
| 109 | 3300005444 | Ga0070694_100007641 | Ga0070694_1000076413 | 327 |
| 110 | 3300005444 | Ga0070694_100010574 | Ga0070694_1000105743 | 327 |
| 111 | 3300005444 | Ga0070694_100019905 | Ga0070694_1000199054 | 327 |
| 112 | 3300005444 | Ga0070694_100022235 | Ga0070694_1000222357 | 327 |
| 113 | 3300005444 | Ga0070694_100089345 | Ga0070694_1000893451 | 327 |
| 114 | 3300005445 | Ga0070708_100020861 | Ga0070708_1000208617 | 327 |
| 115 | 3300005445 | Ga0070708_100056928 | Ga0070708_1000569283 | 327 |
| 116 | 3300005445 | Ga0070708_100060297 | Ga0070708_1000602972 | 327 |
| 117 | 3300005445 | Ga0070708_100129277 | Ga0070708_1001292772 | 327 |
| 118 | 3300005457 | Ga0070662_100029352 | Ga0070662_1000293522 | 327 |
| 119 | 3300005457 | Ga0070662_100257364 | Ga0070662_1002573641 | 327 |
| 120 | 3300005458 | Ga0070681_10003045 | Ga0070681_1000304516 | 327 |
| 121 | 3300005458 | Ga0070681_10012847 | Ga0070681_100128474 | 327 |
| 122 | 3300005458 | Ga0070681_10062544 | Ga0070681_100625442 | 327 |
| 123 | 3300005459 | Ga0068867_100051030 | Ga0068867_1000510303 | 327 |
| 124 | 3300005459 | Ga0068867_100067049 | Ga0068867_1000670493 | 327 |
| 125 | 3300005459 | Ga0068867_100086562 | Ga0068867_1000865622 | 327 |
| 126 | 3300005459 | Ga0068867_100092167 | Ga0068867_1000921671 | 327 |
| 127 | 3300005467 | Ga0070706_100000137 | Ga0070706_10000013743 | 327 |
| 128 | 3300005467 | Ga0070706_100000689 | Ga0070706_10000068916 | 327 |
| 129 | 3300005467 | Ga0070706_100000746 | Ga0070706_10000074622 | 327 |
| 130 | 3300005467 | Ga0070706_100001693 | Ga0070706_1000016936 | 327 |
| 131 | 3300005467 | Ga0070706_100006487 | Ga0070706_1000064878 | 327 |
| 132 | 3300005467 | Ga0070706_100009200 | Ga0070706_1000092009 | 327 |
| 133 | 3300005467 | Ga0070706_100011920 | Ga0070706_1000119206 | 327 |
| 134 | 3300005467 | Ga0070706_100017853 | Ga0070706_1000178534 | 327 |
| 135 | 3300005467 | Ga0070706_100020638 | Ga0070706_1000206386 | 327 |
| 136 | 3300005467 | Ga0070706_100037010 | Ga0070706_1000370104 | 327 |
| 137 | 3300005467 | Ga0070706_100104396 | Ga0070706_1001043962 | 327 |
| 138 | 3300005467 | Ga0070706_100105625 | Ga0070706_1001056251 | 327 |
| 139 | 3300005467 | Ga0070706_100246007 | Ga0070706_1002460071 | 327 |
| 140 | 3300005467 | Ga0070706_100264256 | Ga0070706_1002642561 | 327 |
| 141 | 3300005468 | Ga0070707_100000081 | Ga0070707_10000008117 | 327 |
| 142 | 3300005468 | Ga0070707_100011165 | Ga0070707_1000111653 | 327 |
| 143 | 3300005468 | Ga0070707_100011799 | Ga0070707_1000117994 | 327 |
| 144 | 3300005468 | Ga0070707_100012982 | Ga0070707_1000129824 | 327 |
| 145 | 3300005468 | Ga0070707_100070567 | Ga0070707_1000705673 | 327 |
| 146 | 3300005468 | Ga0070707_100077992 | Ga0070707_1000779923 | 327 |
| 147 | 3300005468 | Ga0070707_100145636 | Ga0070707_1001456362 | 327 |
| 148 | 3300005471 | Ga0070698_100000107 | Ga0070698_10000010735 | 327 |
| 149 | 3300005471 | Ga0070698_100003825 | Ga0070698_10000382513 | 327 |
| 150 | 3300005471 | Ga0070698_100008313 | Ga0070698_1000083132 | 327 |
| 151 | 3300005471 | Ga0070698_100013741 | Ga0070698_1000137413 | 327 |
| 152 | 3300005471 | Ga0070698_100015062 | Ga0070698_1000150624 | 327 |
| 153 | 3300005471 | Ga0070698_100022491 | Ga0070698_1000224917 | 327 |
| 154 | 3300005471 | Ga0070698_100083257 | Ga0070698_1000832573 | 327 |
| 155 | 3300005471 | Ga0070698_100230793 | Ga0070698_1002307931 | 327 |
| 156 | 3300005518 | Ga0070699_100000083 | Ga0070699_10000008377 | 327 |
| 157 | 3300005518 | Ga0070699_100012438 | Ga0070699_1000124381 | 327 |
| 158 | 3300005518 | Ga0070699_100015800 | Ga0070699_1000158002 | 327 |
| 159 | 3300005518 | Ga0070699_100139539 | Ga0070699_1001395391 | 327 |
| 160 | 3300005518 | Ga0070699_100197197 | Ga0070699_1001971972 | 327 |
| 161 | 3300005530 | Ga0070679_100000047 | Ga0070679_1000000472 | 327 |
| 162 | 3300005530 | Ga0070679_100477664 | Ga0070679_1004776641 | 327 |
| 163 | 3300005536 | Ga0070697_100001026 | Ga0070697_10000102613 | 327 |
| 164 | 3300005536 | Ga0070697_100012574 | Ga0070697_1000125743 | 327 |
| 165 | 3300005536 | Ga0070697_100260769 | Ga0070697_1002607692 | 327 |
| 166 | 3300005536 | Ga0070697_100281709 | Ga0070697_1002817091 | 327 |
| 167 | 3300005543 | Ga0070672_100144408 | Ga0070672_1001444083 | 327 |
| 168 | 3300005544 | Ga0070686_100033913 | Ga0070686_1000339134 | 327 |
| 169 | 3300005544 | Ga0070686_100045111 | Ga0070686_1000451112 | 327 |
| 170 | 3300005545 | Ga0070695_100051581 | Ga0070695_1000515812 | 327 |
| 171 | 3300005545 | Ga0070695_100075494 | Ga0070695_1000754942 | 327 |
| 172 | 3300005545 | Ga0070695_100094848 | Ga0070695_1000948483 | 327 |
| 173 | 3300005545 | Ga0070695_100135131 | Ga0070695_1001351311 | 327 |
| 174 | 3300005546 | Ga0070696_100000738 | Ga0070696_10000073818 | 327 |
| 175 | 3300005546 | Ga0070696_100056427 | Ga0070696_1000564272 | 327 |
| 176 | 3300005547 | Ga0070693_100033630 | Ga0070693_1000336304 | 327 |
| 177 | 3300005548 | Ga0070665_100176054 | Ga0070665_1001760542 | 327 |
| 178 | 3300005548 | Ga0070665_100472762 | Ga0070665_1004727622 | 327 |
| 179 | 3300005549 | Ga0070704_100003599 | Ga0070704_1000035997 | 327 |
| 180 | 3300005549 | Ga0070704_100009963 | Ga0070704_1000099633 | 327 |
| 181 | 3300005549 | Ga0070704_100014338 | Ga0070704_1000143383 | 327 |
| 182 | 3300005549 | Ga0070704_100023137 | Ga0070704_1000231374 | 327 |
| 183 | 3300005549 | Ga0070704_100042452 | Ga0070704_1000424524 | 327 |
| 184 | 3300005549 | Ga0070704_100044725 | Ga0070704_1000447253 | 327 |
| 185 | 3300005549 | Ga0070704_100059680 | Ga0070704_1000596802 | 327 |
| 186 | 3300005549 | Ga0070704_100162844 | Ga0070704_1001628442 | 327 |
| 187 | 3300005549 | Ga0070704_100258725 | Ga0070704_1002587251 | 327 |
| 188 | 3300005563 | Ga0068855_100199075 | Ga0068855_1001990753 | 327 |
| 189 | 3300005563 | Ga0068855_100245074 | Ga0068855_1002450741 | 327 |
| 190 | 3300005564 | Ga0070664_100003326 | Ga0070664_10000332610 | 327 |
| 191 | 3300005577 | Ga0068857_100006924 | Ga0068857_10000692411 | 327 |
| 192 | 3300005577 | Ga0068857_100009546 | Ga0068857_1000095462 | 327 |
| 193 | 3300005614 | Ga0068856_100080156 | Ga0068856_1000801563 | 327 |
| 194 | 3300005615 | Ga0070702_100011698 | Ga0070702_1000116982 | 327 |
| 195 | 3300005615 | Ga0070702_100132215 | Ga0070702_1001322152 | 327 |
| 196 | 3300005616 | Ga0068852_100067674 | Ga0068852_1000676745 | 327 |
| 197 | 3300005616 | Ga0068852_100206871 | Ga0068852_1002068712 | 327 |
| 198 | 3300005617 | Ga0068859_100002197 | Ga0068859_10000219714 | 327 |
| 199 | 3300005617 | Ga0068859_100006037 | Ga0068859_10000603714 | 327 |
| 200 | 3300005617 | Ga0068859_100006648 | Ga0068859_1000066489 | 327 |
| 201 | 3300005617 | Ga0068859_100076248 | Ga0068859_1000762483 | 327 |
| 202 | 3300005617 | Ga0068859_100124300 | Ga0068859_1001243002 | 327 |
| 203 | 3300005617 | Ga0068859_100184032 | Ga0068859_1001840323 | 327 |
| 204 | 3300005617 | Ga0068859_100196708 | Ga0068859_1001967082 | 327 |
| 205 | 3300005617 | Ga0068859_100213936 | Ga0068859_1002139362 | 327 |
| 206 | 3300005617 | Ga0068859_100297677 | Ga0068859_1002976772 | 327 |
| 207 | 3300005618 | Ga0068864_100007415 | Ga0068864_1000074155 | 327 |
| 208 | 3300005618 | Ga0068864_100021405 | Ga0068864_1000214055 | 327 |
| 209 | 3300005618 | Ga0068864_100029783 | Ga0068864_1000297837 | 327 |
| 210 | 3300005618 | Ga0068864_100080416 | Ga0068864_1000804162 | 327 |
| 211 | 3300005618 | Ga0068864_100256167 | Ga0068864_1002561671 | 327 |
| 212 | 3300005718 | Ga0068866_10001186 | Ga0068866_100011868 | 327 |
| 213 | 3300005719 | Ga0068861_100022555 | Ga0068861_1000225555 | 327 |
| 214 | 3300005719 | Ga0068861_100022865 | Ga0068861_1000228657 | 327 |
| 215 | 3300005841 | Ga0068863_100067078 | Ga0068863_1000670782 | 327 |
| 216 | 3300005841 | Ga0068863_100078355 | Ga0068863_1000783553 | 327 |
| 217 | 3300005841 | Ga0068863_100306011 | Ga0068863_1003060111 | 327 |
| 218 | 3300005841 | Ga0068863_100414096 | Ga0068863_1004140962 | 327 |
| 219 | 3300005842 | Ga0068858_100000044 | Ga0068858_10000004450 | 327 |
| 220 | 3300005842 | Ga0068858_100011114 | Ga0068858_1000111146 | 327 |
| 221 | 3300005842 | Ga0068858_100077403 | Ga0068858_1000774033 | 327 |
| 222 | 3300005842 | Ga0068858_100084246 | Ga0068858_1000842462 | 327 |
| 223 | 3300005842 | Ga0068858_100106671 | Ga0068858_1001066712 | 327 |
| 224 | 3300005842 | Ga0068858_100115221 | Ga0068858_1001152212 | 327 |
| 225 | 3300005842 | Ga0068858_100246115 | Ga0068858_1002461151 | 327 |
| 226 | 3300005842 | Ga0068858_100328909 | Ga0068858_1003289091 | 327 |
| 227 | 3300005843 | Ga0068860_100027304 | Ga0068860_1000273043 | 327 |
| 228 | 3300005843 | Ga0068860_100103763 | Ga0068860_1001037632 | 327 |
| 229 | 3300005843 | Ga0068860_100132324 | Ga0068860_1001323243 | 327 |
| 230 | 3300005843 | Ga0068860_100140083 | Ga0068860_1001400831 | 327 |
| 231 | 3300005843 | Ga0068860_100141115 | Ga0068860_1001411152 | 327 |
| 232 | 3300005843 | Ga0068860_100431934 | Ga0068860_1004319341 | 327 |
| 233 | 3300005844 | Ga0068862_100008290 | Ga0068862_1000082903 | 327 |
| 234 | 3300005844 | Ga0068862_100014370 | Ga0068862_1000143705 | 327 |
| 235 | 3300005844 | Ga0068862_100278425 | Ga0068862_1002784252 | 327 |
| 236 | 3300005937 | Ga0081455_10047437 | Ga0081455_100474373 | 327 |
| 237 | 3300005937 | Ga0081455_10100978 | Ga0081455_101009782 | 327 |
| 238 | 3300005983 | Ga0081540_1070278 | Ga0081540_10702783 | 327 |
| 239 | 3300006038 | Ga0075365_10028836 | Ga0075365_100288361 | 327 |
| 240 | 3300006051 | Ga0075364_10035347 | Ga0075364_100353472 | 327 |
| 241 | 3300006173 | Ga0070716_100000004 | Ga0070716_10000000497 | 327 |
| 242 | 3300006173 | Ga0070716_100216352 | Ga0070716_1002163522 | 327 |
| 243 | 3300006175 | Ga0070712_100050786 | Ga0070712_1000507863 | 327 |
| 244 | 3300006177 | Ga0075362_10002309 | Ga0075362_100023092 | 327 |
| 245 | 3300006178 | Ga0075367_10014809 | Ga0075367_100148094 | 327 |
| 246 | 3300006195 | Ga0075366_10051168 | Ga0075366_100511682 | 327 |
| 247 | 3300006237 | Ga0097621_100009292 | Ga0097621_1000092922 | 327 |
| 248 | 3300006237 | Ga0097621_100018054 | Ga0097621_1000180542 | 327 |
| 249 | 3300006237 | Ga0097621_100043674 | Ga0097621_1000436744 | 327 |
| 250 | 3300006358 | Ga0068871_100021032 | Ga0068871_1000210324 | 327 |
| 251 | 3300006358 | Ga0068871_100021401 | Ga0068871_1000214012 | 327 |
| 252 | 3300006844 | Ga0075428_100009182 | Ga0075428_1000091822 | 327 |
| 253 | 3300006844 | Ga0075428_100015913 | Ga0075428_1000159134 | 327 |
| 254 | 3300006844 | Ga0075428_100096868 | Ga0075428_1000968682 | 327 |
| 255 | 3300006844 | Ga0075428_100169084 | Ga0075428_1001690841 | 327 |
| 256 | 3300006844 | Ga0075428_100336825 | Ga0075428_1003368253 | 327 |
| 257 | 3300006847 | Ga0075431_100013940 | Ga0075431_1000139405 | 327 |
| 258 | 3300006847 | Ga0075431_100016154 | Ga0075431_1000161544 | 327 |
| 259 | 3300006847 | Ga0075431_100041399 | Ga0075431_1000413992 | 327 |
| 260 | 3300006852 | Ga0075433_10095985 | Ga0075433_100959852 | 327 |
| 261 | 3300006852 | Ga0075433_10104884 | Ga0075433_101048842 | 327 |
| 262 | 3300006852 | Ga0075433_10238704 | Ga0075433_102387042 | 327 |
| 263 | 3300006871 | Ga0075434_100034377 | Ga0075434_1000343778 | 327 |
| 264 | 3300006871 | Ga0075434_100092528 | Ga0075434_1000925281 | 327 |
| 265 | 3300006871 | Ga0075434_100203541 | Ga0075434_1002035413 | 327 |
| 266 | 3300006871 | Ga0075434_100341969 | Ga0075434_1003419691 | 327 |
| 267 | 3300006880 | Ga0075429_100044853 | Ga0075429_1000448533 | 327 |
| 268 | 3300006881 | Ga0068865_100161034 | Ga0068865_1001610342 | 327 |
| 269 | 3300006914 | Ga0075436_100001301 | Ga0075436_1000013017 | 327 |
| 270 | 3300006914 | Ga0075436_100004655 | Ga0075436_1000046554 | 327 |
| 271 | 3300006914 | Ga0075436_100245711 | Ga0075436_1002457112 | 327 |
| 272 | 3300006931 | Ga0097620_100002197 | Ga0097620_10000219714 | 327 |
| 273 | 3300006931 | Ga0097620_100006037 | Ga0097620_10000603714 | 327 |
| 274 | 3300006931 | Ga0097620_100006648 | Ga0097620_1000066489 | 327 |
| 275 | 3300006931 | Ga0097620_100076249 | Ga0097620_1000762493 | 327 |
| 276 | 3300006931 | Ga0097620_100124297 | Ga0097620_1001242972 | 327 |
| 277 | 3300006931 | Ga0097620_100184024 | Ga0097620_1001840243 | 327 |
| 278 | 3300006931 | Ga0097620_100196705 | Ga0097620_1001967052 | 327 |
| 279 | 3300006931 | Ga0097620_100213937 | Ga0097620_1002139372 | 327 |
| 280 | 3300006931 | Ga0097620_100297680 | Ga0097620_1002976802 | 327 |
| 281 | 3300007076 | Ga0075435_100000292 | Ga0075435_10000029212 | 327 |
| 282 | 3300007076 | Ga0075435_100046663 | Ga0075435_1000466632 | 327 |
| 283 | 3300007076 | Ga0075435_100069186 | Ga0075435_1000691862 | 327 |
| 284 | 3300007076 | Ga0075435_100080087 | Ga0075435_1000800874 | 327 |
| 285 | 3300007076 | Ga0075435_100085714 | Ga0075435_1000857142 | 327 |
| 286 | 3300009093 | Ga0105240_10072884 | Ga0105240_100728846 | 327 |
| 287 | 3300009094 | Ga0111539_10058991 | Ga0111539_100589912 | 327 |
| 288 | 3300009094 | Ga0111539_10060008 | Ga0111539_100600083 | 327 |
| 289 | 3300009094 | Ga0111539_10200113 | Ga0111539_102001132 | 327 |
| 290 | 3300009094 | Ga0111539_10279905 | Ga0111539_102799052 | 327 |
| 291 | 3300009098 | Ga0105245_10253483 | Ga0105245_102534831 | 327 |
| 292 | 3300009101 | Ga0105247_10000004 | Ga0105247_10000004262 | 327 |
| 293 | 3300009101 | Ga0105247_10001464 | Ga0105247_1000146415 | 327 |
| 294 | 3300009101 | Ga0105247_10009326 | Ga0105247_100093262 | 327 |
| 295 | 3300009101 | Ga0105247_10298939 | Ga0105247_102989392 | 327 |
| 296 | 3300009147 | Ga0114129_10003077 | Ga0114129_100030779 | 327 |
| 297 | 3300009147 | Ga0114129_10007145 | Ga0114129_100071456 | 327 |
| 298 | 3300009147 | Ga0114129_10013377 | Ga0114129_100133777 | 327 |
| 299 | 3300009147 | Ga0114129_10028310 | Ga0114129_100283106 | 327 |
| 300 | 3300009147 | Ga0114129_10031498 | Ga0114129_100314987 | 327 |
| 301 | 3300009147 | Ga0114129_10052996 | Ga0114129_100529964 | 327 |
| 302 | 3300009147 | Ga0114129_10074786 | Ga0114129_100747864 | 327 |
| 303 | 3300009147 | Ga0114129_10095175 | Ga0114129_100951752 | 327 |
| 304 | 3300009147 | Ga0114129_10106750 | Ga0114129_101067502 | 327 |
| 305 | 3300009147 | Ga0114129_10272910 | Ga0114129_102729102 | 327 |
| 306 | 3300009147 | Ga0114129_10292442 | Ga0114129_102924422 | 327 |
| 307 | 3300009148 | Ga0105243_10000240 | Ga0105243_1000024014 | 327 |
| 308 | 3300009148 | Ga0105243_10000573 | Ga0105243_1000057316 | 327 |
| 309 | 3300009148 | Ga0105243_10035191 | Ga0105243_100351915 | 327 |
| 310 | 3300009148 | Ga0105243_10247541 | Ga0105243_102475411 | 327 |
| 311 | 3300009174 | Ga0105241_10017940 | Ga0105241_100179402 | 327 |
| 312 | 3300009174 | Ga0105241_10133211 | Ga0105241_101332111 | 327 |
| 313 | 3300009176 | Ga0105242_10000222 | Ga0105242_1000022223 | 327 |
| 314 | 3300009176 | Ga0105242_10001271 | Ga0105242_1000127110 | 327 |
| 315 | 3300009176 | Ga0105242_10010557 | Ga0105242_100105572 | 327 |
| 316 | 3300009176 | Ga0105242_10015359 | Ga0105242_100153593 | 327 |
| 317 | 3300009176 | Ga0105242_10017782 | Ga0105242_100177824 | 327 |
| 318 | 3300009176 | Ga0105242_10308045 | Ga0105242_103080453 | 327 |
| 319 | 3300009177 | Ga0105248_10008970 | Ga0105248_100089705 | 327 |
| 320 | 3300009177 | Ga0105248_10022191 | Ga0105248_100221915 | 327 |
| 321 | 3300009177 | Ga0105248_10055195 | Ga0105248_100551953 | 327 |
| 322 | 3300009177 | Ga0105248_10084538 | Ga0105248_100845382 | 327 |
| 323 | 3300009177 | Ga0105248_10109336 | Ga0105248_101093362 | 327 |
| 324 | 3300009177 | Ga0105248_10160290 | Ga0105248_101602902 | 327 |
| 325 | 3300009177 | Ga0105248_10172833 | Ga0105248_101728332 | 327 |
| 326 | 3300009177 | Ga0105248_10177888 | Ga0105248_101778882 | 327 |
| 327 | 3300009177 | Ga0105248_10207042 | Ga0105248_102070423 | 327 |
| 328 | 3300009177 | Ga0105248_10271234 | Ga0105248_102712342 | 327 |
| 329 | 3300009545 | Ga0105237_10000334 | Ga0105237_1000033412 | 327 |
| 330 | 3300009545 | Ga0105237_10109188 | Ga0105237_101091882 | 327 |
| 331 | 3300009551 | Ga0105238_10010300 | Ga0105238_100103005 | 327 |
| 332 | 3300009553 | Ga0105249_10006116 | Ga0105249_100061167 | 327 |
| 333 | 3300009553 | Ga0105249_10018220 | Ga0105249_100182203 | 327 |
| 334 | 3300009553 | Ga0105249_10020906 | Ga0105249_100209064 | 327 |
| 335 | 3300009553 | Ga0105249_10029641 | Ga0105249_100296414 | 327 |
| 336 | 3300009553 | Ga0105249_10046928 | Ga0105249_100469283 | 327 |
| 337 | 3300009553 | Ga0105249_10063970 | Ga0105249_100639702 | 327 |
| 338 | 3300009553 | Ga0105249_10106369 | Ga0105249_101063692 | 327 |
| 339 | 3300010375 | Ga0105239_10102080 | Ga0105239_101020802 | 327 |
| 340 | 3300010375 | Ga0105239_10698847 | Ga0105239_106988471 | 327 |
| 341 | 3300011119 | Ga0105246_10027558 | Ga0105246_100275582 | 327 |
| 342 | 3300013100 | Ga0157373_10004904 | Ga0157373_100049048 | 327 |
| 343 | 3300013100 | Ga0157373_10065994 | Ga0157373_100659942 | 327 |
| 344 | 3300013102 | Ga0157371_10065740 | Ga0157371_100657402 | 327 |
| 345 | 3300013296 | Ga0157374_10026240 | Ga0157374_100262401 | 327 |
| 346 | 3300013297 | Ga0157378_10000025 | Ga0157378_1000002555 | 327 |
| 347 | 3300013297 | Ga0157378_10026893 | Ga0157378_100268932 | 327 |
| 348 | 3300013297 | Ga0157378_10043708 | Ga0157378_100437081 | 327 |
| 349 | 3300013297 | Ga0157378_10058112 | Ga0157378_100581123 | 327 |
| 350 | 3300013297 | Ga0157378_10070099 | Ga0157378_100700992 | 327 |
| 351 | 3300013297 | Ga0157378_10072694 | Ga0157378_100726942 | 327 |
| 352 | 3300013297 | Ga0157378_10075670 | Ga0157378_100756702 | 327 |
| 353 | 3300013297 | Ga0157378_10405712 | Ga0157378_104057122 | 327 |
| 354 | 3300013306 | Ga0163162_10008906 | Ga0163162_100089069 | 327 |
| 355 | 3300013306 | Ga0163162_10011757 | Ga0163162_100117573 | 327 |
| 356 | 3300013306 | Ga0163162_10016001 | Ga0163162_100160012 | 327 |
| 357 | 3300013306 | Ga0163162_10098561 | Ga0163162_100985611 | 327 |
| 358 | 3300013306 | Ga0163162_10144974 | Ga0163162_101449743 | 327 |
| 359 | 3300013306 | Ga0163162_10312777 | Ga0163162_103127772 | 327 |
| 360 | 3300013306 | Ga0163162_10314110 | Ga0163162_103141102 | 327 |
| 361 | 3300013307 | Ga0157372_10004643 | Ga0157372_1000464319 | 327 |
| 362 | 3300013307 | Ga0157372_10343093 | Ga0157372_103430932 | 327 |
| 363 | 3300013308 | Ga0157375_10049802 | Ga0157375_100498023 | 327 |
| 364 | 3300013308 | Ga0157375_10067012 | Ga0157375_100670122 | 327 |
| 365 | 3300013308 | Ga0157375_10196996 | Ga0157375_101969963 | 327 |
| 366 | 3300013308 | Ga0157375_10328158 | Ga0157375_103281582 | 327 |
| 367 | 3300014325 | Ga0163163_10004395 | Ga0163163_100043953 | 327 |
| 368 | 3300014325 | Ga0163163_10009284 | Ga0163163_100092847 | 327 |
| 369 | 3300014325 | Ga0163163_10021104 | Ga0163163_100211042 | 327 |
| 370 | 3300014325 | Ga0163163_10043112 | Ga0163163_100431122 | 327 |
| 371 | 3300014325 | Ga0163163_10104899 | Ga0163163_101048992 | 327 |
| 372 | 3300014325 | Ga0163163_10249018 | Ga0163163_102490182 | 327 |
| 373 | 3300014325 | Ga0163163_10311915 | Ga0163163_103119151 | 327 |
| 374 | 3300014325 | Ga0163163_10552382 | Ga0163163_105523822 | 327 |
| 375 | 3300014325 | Ga0163163_10640946 | Ga0163163_106409461 | 327 |
| 376 | 3300014326 | Ga0157380_10034342 | Ga0157380_100343424 | 327 |
| 377 | 3300014326 | Ga0157380_10410147 | Ga0157380_104101471 | 327 |
| 378 | 3300014745 | Ga0157377_10014866 | Ga0157377_100148663 | 327 |
| 379 | 3300014745 | Ga0157377_10124174 | Ga0157377_101241741 | 327 |
| 380 | 3300014968 | Ga0157379_10014334 | Ga0157379_100143346 | 327 |
| 381 | 3300014968 | Ga0157379_10115018 | Ga0157379_101150182 | 327 |
| 382 | 3300014969 | Ga0157376_10006817 | Ga0157376_100068171 | 327 |
| 383 | 3300014969 | Ga0157376_10007899 | Ga0157376_100078992 | 327 |
| 384 | 3300014969 | Ga0157376_10316380 | Ga0157376_103163801 | 327 |
| 385 | 3300015262 | Ga0182007_10027242 | Ga0182007_100272422 | 327 |
| 386 | 3300017792 | Ga0163161_10123664 | Ga0163161_101236642 | 327 |
| 387 | 3300025223 | Ga0207672_1000062 | Ga0207672_10000624 | 327 |
| 388 | 3300025315 | Ga0207697_10030617 | Ga0207697_100306171 | 327 |
| 389 | 3300025321 | Ga0207656_10001825 | Ga0207656_100018259 | 327 |
| 390 | 3300025885 | Ga0207653_10000065 | Ga0207653_1000006514 | 327 |
| 391 | 3300025885 | Ga0207653_10000070 | Ga0207653_1000007015 | 327 |
| 392 | 3300025885 | Ga0207653_10003408 | Ga0207653_100034083 | 327 |
| 393 | 3300025885 | Ga0207653_10057557 | Ga0207653_100575571 | 327 |
| 394 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002750 | 327 |
| 395 | 3300025900 | Ga0207710_10000776 | Ga0207710_100007763 | 327 |
| 396 | 3300025900 | Ga0207710_10030148 | Ga0207710_100301483 | 327 |
| 397 | 3300025901 | Ga0207688_10080130 | Ga0207688_100801302 | 327 |
| 398 | 3300025903 | Ga0207680_10073150 | Ga0207680_100731502 | 327 |
| 399 | 3300025904 | Ga0207647_10011627 | Ga0207647_100116273 | 327 |
| 400 | 3300025905 | Ga0207685_10000021 | Ga0207685_1000002167 | 327 |
| 401 | 3300025906 | Ga0207699_10000003 | Ga0207699_10000003250 | 327 |
| 402 | 3300025907 | Ga0207645_10277202 | Ga0207645_102772021 | 327 |
| 403 | 3300025910 | Ga0207684_10000090 | Ga0207684_10000090156 | 327 |
| 404 | 3300025910 | Ga0207684_10000314 | Ga0207684_1000031442 | 327 |
| 405 | 3300025910 | Ga0207684_10000515 | Ga0207684_1000051523 | 327 |
| 406 | 3300025910 | Ga0207684_10007510 | Ga0207684_100075103 | 327 |
| 407 | 3300025910 | Ga0207684_10010306 | Ga0207684_100103065 | 327 |
| 408 | 3300025910 | Ga0207684_10019527 | Ga0207684_100195275 | 327 |
| 409 | 3300025910 | Ga0207684_10037214 | Ga0207684_100372142 | 327 |
| 410 | 3300025910 | Ga0207684_10045008 | Ga0207684_100450081 | 327 |
| 411 | 3300025910 | Ga0207684_10046124 | Ga0207684_100461243 | 327 |
| 412 | 3300025910 | Ga0207684_10166785 | Ga0207684_101667852 | 327 |
| 413 | 3300025910 | Ga0207684_10236848 | Ga0207684_102368482 | 327 |
| 414 | 3300025912 | Ga0207707_10000006 | Ga0207707_10000006311 | 327 |
| 415 | 3300025912 | Ga0207707_10002499 | Ga0207707_1000249915 | 327 |
| 416 | 3300025912 | Ga0207707_10063587 | Ga0207707_100635873 | 327 |
| 417 | 3300025913 | Ga0207695_10173522 | Ga0207695_101735222 | 327 |
| 418 | 3300025914 | Ga0207671_10007914 | Ga0207671_1000791411 | 327 |
| 419 | 3300025914 | Ga0207671_10155085 | Ga0207671_101550851 | 327 |
| 420 | 3300025916 | Ga0207663_10000003 | Ga0207663_10000003165 | 327 |
| 421 | 3300025917 | Ga0207660_10007861 | Ga0207660_100078617 | 327 |
| 422 | 3300025917 | Ga0207660_10312956 | Ga0207660_103129561 | 327 |
| 423 | 3300025918 | Ga0207662_10083541 | Ga0207662_100835412 | 327 |
| 424 | 3300025918 | Ga0207662_10095439 | Ga0207662_100954392 | 327 |
| 425 | 3300025918 | Ga0207662_10103649 | Ga0207662_101036492 | 327 |
| 426 | 3300025919 | Ga0207657_10037330 | Ga0207657_100373305 | 327 |
| 427 | 3300025921 | Ga0207652_10009231 | Ga0207652_100092312 | 327 |
| 428 | 3300025921 | Ga0207652_10108713 | Ga0207652_101087132 | 327 |
| 429 | 3300025922 | Ga0207646_10000076 | Ga0207646_1000007623 | 327 |
| 430 | 3300025922 | Ga0207646_10001170 | Ga0207646_1000117011 | 327 |
| 431 | 3300025922 | Ga0207646_10002078 | Ga0207646_100020788 | 327 |
| 432 | 3300025922 | Ga0207646_10002536 | Ga0207646_1000253618 | 327 |
| 433 | 3300025922 | Ga0207646_10017025 | Ga0207646_100170253 | 327 |
| 434 | 3300025922 | Ga0207646_10212487 | Ga0207646_102124871 | 327 |
| 435 | 3300025922 | Ga0207646_10357858 | Ga0207646_103578581 | 327 |
| 436 | 3300025923 | Ga0207681_10031479 | Ga0207681_100314792 | 327 |
| 437 | 3300025923 | Ga0207681_10261039 | Ga0207681_102610391 | 327 |
| 438 | 3300025923 | Ga0207681_10427295 | Ga0207681_104272951 | 327 |
| 439 | 3300025924 | Ga0207694_10006023 | Ga0207694_100060236 | 327 |
| 440 | 3300025925 | Ga0207650_10000047 | Ga0207650_1000004730 | 327 |
| 441 | 3300025925 | Ga0207650_10010016 | Ga0207650_100100166 | 327 |
| 442 | 3300025925 | Ga0207650_10012820 | Ga0207650_100128203 | 327 |
| 443 | 3300025926 | Ga0207659_10202227 | Ga0207659_102022271 | 327 |
| 444 | 3300025926 | Ga0207659_10275335 | Ga0207659_102753351 | 327 |
| 445 | 3300025927 | Ga0207687_10114315 | Ga0207687_101143152 | 327 |
| 446 | 3300025931 | Ga0207644_10001021 | Ga0207644_100010213 | 327 |
| 447 | 3300025931 | Ga0207644_10301971 | Ga0207644_103019711 | 327 |
| 448 | 3300025932 | Ga0207690_10010825 | Ga0207690_100108253 | 327 |
| 449 | 3300025933 | Ga0207706_10079474 | Ga0207706_100794743 | 327 |
| 450 | 3300025933 | Ga0207706_10115665 | Ga0207706_101156652 | 327 |
| 451 | 3300025933 | Ga0207706_10297609 | Ga0207706_102976092 | 327 |
| 452 | 3300025934 | Ga0207686_10000010 | Ga0207686_10000010184 | 327 |
| 453 | 3300025934 | Ga0207686_10001178 | Ga0207686_100011789 | 327 |
| 454 | 3300025934 | Ga0207686_10003853 | Ga0207686_100038535 | 327 |
| 455 | 3300025934 | Ga0207686_10022322 | Ga0207686_100223222 | 327 |
| 456 | 3300025934 | Ga0207686_10091840 | Ga0207686_100918401 | 327 |
| 457 | 3300025935 | Ga0207709_10000052 | Ga0207709_10000052184 | 327 |
| 458 | 3300025935 | Ga0207709_10004105 | Ga0207709_100041053 | 327 |
| 459 | 3300025935 | Ga0207709_10063888 | Ga0207709_100638881 | 327 |
| 460 | 3300025935 | Ga0207709_10088396 | Ga0207709_100883962 | 327 |
| 461 | 3300025935 | Ga0207709_10191552 | Ga0207709_101915522 | 327 |
| 462 | 3300025936 | Ga0207670_10001863 | Ga0207670_100018632 | 327 |
| 463 | 3300025936 | Ga0207670_10037820 | Ga0207670_100378202 | 327 |
| 464 | 3300025938 | Ga0207704_10216174 | Ga0207704_102161741 | 327 |
| 465 | 3300025939 | Ga0207665_10000006 | Ga0207665_10000006116 | 327 |
| 466 | 3300025939 | Ga0207665_10059897 | Ga0207665_100598974 | 327 |
| 467 | 3300025940 | Ga0207691_10075993 | Ga0207691_100759934 | 327 |
| 468 | 3300025941 | Ga0207711_10008789 | Ga0207711_1000878914 | 327 |
| 469 | 3300025941 | Ga0207711_10024161 | Ga0207711_100241613 | 327 |
| 470 | 3300025941 | Ga0207711_10025330 | Ga0207711_100253304 | 327 |
| 471 | 3300025941 | Ga0207711_10062470 | Ga0207711_100624702 | 327 |
| 472 | 3300025941 | Ga0207711_10106862 | Ga0207711_101068622 | 327 |
| 473 | 3300025941 | Ga0207711_10170115 | Ga0207711_101701152 | 327 |
| 474 | 3300025941 | Ga0207711_10268390 | Ga0207711_102683902 | 327 |
| 475 | 3300025942 | Ga0207689_10004703 | Ga0207689_100047038 | 327 |
| 476 | 3300025942 | Ga0207689_10025437 | Ga0207689_100254372 | 327 |
| 477 | 3300025942 | Ga0207689_10035192 | Ga0207689_100351925 | 327 |
| 478 | 3300025942 | Ga0207689_10070732 | Ga0207689_100707323 | 327 |
| 479 | 3300025942 | Ga0207689_10093966 | Ga0207689_100939662 | 327 |
| 480 | 3300025942 | Ga0207689_10115682 | Ga0207689_101156823 | 327 |
| 481 | 3300025942 | Ga0207689_10153416 | Ga0207689_101534161 | 327 |
| 482 | 3300025945 | Ga0207679_10014681 | Ga0207679_100146815 | 327 |
| 483 | 3300025961 | Ga0207712_10004222 | Ga0207712_100042226 | 327 |
| 484 | 3300025961 | Ga0207712_10012477 | Ga0207712_100124775 | 327 |
| 485 | 3300025961 | Ga0207712_10031326 | Ga0207712_100313263 | 327 |
| 486 | 3300025961 | Ga0207712_10100961 | Ga0207712_101009612 | 327 |
| 487 | 3300025961 | Ga0207712_10105819 | Ga0207712_101058192 | 327 |
| 488 | 3300025981 | Ga0207640_10271530 | Ga0207640_102715301 | 327 |
| 489 | 3300026023 | Ga0207677_10008832 | Ga0207677_100088323 | 327 |
| 490 | 3300026023 | Ga0207677_10128913 | Ga0207677_101289132 | 327 |
| 491 | 3300026035 | Ga0207703_10000032 | Ga0207703_10000032102 | 327 |
| 492 | 3300026035 | Ga0207703_10037387 | Ga0207703_100373873 | 327 |
| 493 | 3300026035 | Ga0207703_10123582 | Ga0207703_101235822 | 327 |
| 494 | 3300026035 | Ga0207703_10233903 | Ga0207703_102339031 | 327 |
| 495 | 3300026075 | Ga0207708_10000080 | Ga0207708_1000008016 | 327 |
| 496 | 3300026075 | Ga0207708_10011233 | Ga0207708_100112336 | 327 |
| 497 | 3300026075 | Ga0207708_10030117 | Ga0207708_100301174 | 327 |
| 498 | 3300026075 | Ga0207708_10044607 | Ga0207708_100446072 | 327 |
| 499 | 3300026075 | Ga0207708_10071762 | Ga0207708_100717623 | 327 |
| 500 | 3300026075 | Ga0207708_10153999 | Ga0207708_101539992 | 327 |
| 501 | 3300026075 | Ga0207708_10163833 | Ga0207708_101638332 | 327 |
| 502 | 3300026078 | Ga0207702_10052323 | Ga0207702_100523232 | 327 |
| 503 | 3300026088 | Ga0207641_10302769 | Ga0207641_103027691 | 327 |
| 504 | 3300026088 | Ga0207641_10310859 | Ga0207641_103108591 | 327 |
| 505 | 3300026088 | Ga0207641_10382757 | Ga0207641_103827571 | 327 |
| 506 | 3300026089 | Ga0207648_10006470 | Ga0207648_100064705 | 327 |
| 507 | 3300026089 | Ga0207648_10059260 | Ga0207648_100592602 | 327 |
| 508 | 3300026089 | Ga0207648_10108721 | Ga0207648_101087212 | 327 |
| 509 | 3300026089 | Ga0207648_10109769 | Ga0207648_101097693 | 327 |
| 510 | 3300026089 | Ga0207648_10221792 | Ga0207648_102217922 | 327 |
| 511 | 3300026095 | Ga0207676_10030967 | Ga0207676_100309675 | 327 |
| 512 | 3300026095 | Ga0207676_10052560 | Ga0207676_100525601 | 327 |
| 513 | 3300026095 | Ga0207676_10079561 | Ga0207676_100795613 | 327 |
| 514 | 3300026095 | Ga0207676_10228322 | Ga0207676_102283222 | 327 |
| 515 | 3300026095 | Ga0207676_10274850 | Ga0207676_102748502 | 327 |
| 516 | 3300026095 | Ga0207676_10477040 | Ga0207676_104770402 | 327 |
| 517 | 3300026116 | Ga0207674_10015381 | Ga0207674_100153812 | 327 |
| 518 | 3300026116 | Ga0207674_10023682 | Ga0207674_100236827 | 327 |
| 519 | 3300026116 | Ga0207674_10288733 | Ga0207674_102887332 | 327 |
| 520 | 3300026116 | Ga0207674_10566078 | Ga0207674_105660781 | 327 |
| 521 | 3300026118 | Ga0207675_100000252 | Ga0207675_10000025223 | 327 |
| 522 | 3300026118 | Ga0207675_100037753 | Ga0207675_1000377532 | 327 |
| 523 | 3300026118 | Ga0207675_100136044 | Ga0207675_1001360441 | 327 |
| 524 | 3300026118 | Ga0207675_100276831 | Ga0207675_1002768312 | 327 |
| 525 | 3300026118 | Ga0207675_100528950 | Ga0207675_1005289501 | 327 |
| 526 | 3300026121 | Ga0207683_10150587 | Ga0207683_101505872 | 327 |
| 527 | 3300026142 | Ga0207698_10154547 | Ga0207698_101545472 | 327 |
| 528 | 3300026142 | Ga0207698_10180891 | Ga0207698_101808912 | 327 |
| 529 | 3300027907 | Ga0207428_10000449 | Ga0207428_100004495 | 327 |
| 530 | 3300027907 | Ga0207428_10002119 | Ga0207428_1000211917 | 327 |
| 531 | 3300027907 | Ga0207428_10067080 | Ga0207428_100670802 | 327 |
| 532 | 3300028380 | Ga0268265_10013661 | Ga0268265_100136616 | 327 |
| 533 | 3300028380 | Ga0268265_10031177 | Ga0268265_100311773 | 327 |
| 534 | 3300028381 | Ga0268264_10085187 | Ga0268264_100851872 | 327 |
| 535 | 3300028381 | Ga0268264_10138561 | Ga0268264_101385612 | 327 |
| 536 | 3300028381 | Ga0268264_10593171 | Ga0268264_105931711 | 327 |
| 537 | 3300028794 | Ga0307515_10065518 | Ga0307515_100655183 | 327 |
| 538 | 3300031238 | Ga0265332_10003403 | Ga0265332_100034035 | 327 |
| 539 | 3300031507 | Ga0307509_10049420 | Ga0307509_100494202 | 327 |
| 540 | 3300031548 | Ga0307408_100287800 | Ga0307408_1002878002 | 327 |
| 541 | 3300031731 | Ga0307405_10003793 | Ga0307405_100037937 | 327 |
| 542 | 3300031901 | Ga0307406_10101889 | Ga0307406_101018892 | 327 |
| 543 | 3300032002 | Ga0307416_100023009 | Ga0307416_1000230095 | 327 |
| 544 | 3300032002 | Ga0307416_100132451 | Ga0307416_1001324512 | 327 |
| 545 | 3300035090 | Ga0373949_0004798 | Ga0373949_0004798_1991_2974 | 327 |
| 546 | 3300035170 | Ga0373943_0014390 | Ga0373943_0014390_2151_3251 | 327 |
| 547 | 3300035241 | Ga0373961_0000038 | Ga0373961_0000038_5071_6054 | 327 |
| 548 | 3300035725 | Ga0373947_0077995 | Ga0373947_0077995_654_1754 | 327 |
| 549 | 3300036401 | Ga0373937_0016062 | Ga0373937_0016062_68_1081 | 327 |
| 550 | 3300037418 | Ga0395900_0138618 | Ga0395900_0138618_1176_2159 | 327 |
| 551 | 3300037466 | Ga0395898_0157831 | Ga0395898_0157831_329_1312 | 327 |
| 552 | 3300037466 | Ga0395898_0313755 | Ga0395898_0313755_43_1026 | 327 |
| 553 | 3300038996 | Ga0242420_009479 | Ga0242420_009479_557_1540 | 327 |
| 554 | 3300039437 | Ga0436365_0715042 | Ga0436365_0715042_3818_4942 | 327 |
| 555 | 3300039437 | Ga0436365_0896267 | Ga0436365_0896267_61_1173 | 327 |
| 556 | 3300044673 | Ga0453683_0023509 | Ga0453683_0023509_2260_3273 | 327 |
| 557 | 3300045051 | Ga0451576_0453405 | Ga0451576_0453405_141_1124 | 327 |
| 558 | 3300046475 | Ga0495639_0045578 | Ga0495639_0045578_877_1866 | 327 |
| 559 | 3300046681 | Ga0495647_0012526 | Ga0495647_0012526_848_1837 | 327 |
| 560 | 3300048905 | Ga0496102_0130388 | Ga0496102_0130388_641_1633 | 327 |
| 561 | 3300048906 | Ga0496103_0143690 | Ga0496103_0143690_125_1117 | 327 |
| 562 | 3300048907 | Ga0496104_0054805 | Ga0496104_0054805_1474_2466 | 327 |
| 563 | 3300048907 | Ga0496104_0365645 | Ga0496104_0365645_237_1223 | 327 |
| 564 | 3300048909 | Ga0496106_0118754 | Ga0496106_0118754_332_1315 | 327 |
| 565 | 3300048909 | Ga0496106_0183748 | Ga0496106_0183748_140_1147 | 327 |
| 566 | 3300048911 | Ga0496108_0070140 | Ga0496108_0070140_754_1737 | 327 |
| 567 | 3300048911 | Ga0496108_0160950 | Ga0496108_0160950_827_1810 | 327 |
| 568 | 3300048912 | Ga0496109_0000189 | Ga0496109_0000189_13121_14203 | 327 |
| 569 | 3300048915 | Ga0496112_0123617 | Ga0496112_0123617_635_1618 | 327 |
| 570 | 3300048916 | Ga0496113_0111079 | Ga0496113_0111079_1002_1994 | 327 |
| 571 | 3300049514 | Ga0501291_010775 | Ga0501291_010775_299_1285 | 327 |
| 572 | 3300049521 | Ga0501298_018823 | Ga0501298_018823_275_1261 | 327 |
| 573 | 3300049526 | Ga0501303_000634 | Ga0501303_000634_1266_2252 | 327 |
| 574 | 3300049574 | Ga0501038_0002453 | Ga0501038_0002453_15234_16220 | 327 |
| 575 | 3300049574 | Ga0501038_0174331 | Ga0501038_0174331_664_1653 | 327 |
| 576 | 3300049588 | Ga0501072_0017386 | Ga0501072_0017386_1298_2287 | 327 |
| 577 | 3300049592 | Ga0501076_0027434 | Ga0501076_0027434_601_1593 | 327 |
| 578 | 3300049661 | Ga0501217_004442 | Ga0501217_004442_135_1121 | 327 |
| 579 | 3300049663 | Ga0501223_003726 | Ga0501223_003726_268_1260 | 327 |
| 580 | 3300049665 | Ga0501227_000411 | Ga0501227_000411_2430_3413 | 327 |
| 581 | 3300049668 | Ga0501233_004582 | Ga0501233_004582_109_1101 | 327 |
| 582 | 3300049668 | Ga0501233_005147 | Ga0501233_005147_1003_1986 | 327 |
| 583 | 3300049668 | Ga0501233_008412 | Ga0501233_008412_162_1145 | 327 |
| 584 | 3300049669 | Ga0501235_005013 | Ga0501235_005013_1164_2150 | 327 |
| 585 | 3300049675 | Ga0501243_005204 | Ga0501243_005204_524_1510 | 327 |
| 586 | 3300049686 | Ga0501257_047299 | Ga0501257_047299_62_1054 | 327 |
| 587 | 3300049705 | Ga0501225_0011818 | Ga0501225_0011818_962_1948 | 327 |
| 588 | 3300049741 | Ga0501079_0083636 | Ga0501079_0083636_671_1663 | 327 |
| 589 | 3300049743 | Ga0501081_0103036 | Ga0501081_0103036_312_1304 | 327 |
| 590 | 3300049824 | Ga0501045_0162812 | Ga0501045_0162812_17_1009 | 327 |
| 591 | 3300049853 | Ga0501226_000354 | Ga0501226_000354_3646_4629 | 327 |
| 592 | 3300050489 | nmdc:mga03683_22202_c1 | nmdc:mga03683_22202_c1_1026_2090 | 327 |
| 593 | 3300050491 | nmdc:mga00v17_30593_c1 | nmdc:mga00v17_30593_c1_1880_2944 | 327 |
| 594 | 3300050492 | nmdc:mga0yw44_144913_c1 | nmdc:mga0yw44_144913_c1_177_1292 | 327 |
| 595 | 3300050493 | nmdc:mga0k408_28733_c2 | nmdc:mga0k408_28733_c2_848_1912 | 327 |
| 596 | 3300050494 | nmdc:mga06z11_16105_c1 | nmdc:mga06z11_16105_c1_341_1405 | 327 |
| 597 | 3300050507 | nmdc:mga05p37_123888_c1 | nmdc:mga05p37_123888_c1_1818_2810 | 327 |
| 598 | 3300050507 | nmdc:mga05p37_128718_c1 | nmdc:mga05p37_128718_c1_796_1788 | 327 |
| 599 | 3300050507 | nmdc:mga05p37_130459_c1 | nmdc:mga05p37_130459_c1_573_1646 | 327 |
| 600 | 3300050507 | nmdc:mga05p37_20401_c1 | nmdc:mga05p37_20401_c1_5205_6287 | 327 |
| 601 | 3300050507 | nmdc:mga05p37_263110_c1 | nmdc:mga05p37_263110_c1_145_1128 | 327 |
| 602 | 3300050507 | nmdc:mga05p37_354573_c1 | nmdc:mga05p37_354573_c1_477_1556 | 327 |
| 603 | 3300050507 | nmdc:mga05p37_45148_c1 | nmdc:mga05p37_45148_c1_3929_4912 | 327 |
| 604 | 3300050507 | nmdc:mga05p37_5670_c1 | nmdc:mga05p37_5670_c1_8288_9274 | 327 |
| 605 | 3300050507 | nmdc:mga05p37_571092_c1 | nmdc:mga05p37_571092_c1_263_1249 | 327 |
| 606 | 3300050507 | nmdc:mga05p37_800061_c1 | nmdc:mga05p37_800061_c1_32_1015 | 327 |
| 607 | 3300050507 | nmdc:mga05p37_84943_c1 | nmdc:mga05p37_84943_c1_724_1806 | 327 |
| 608 | 3300050508 | nmdc:mga09592_16979_c1 | nmdc:mga09592_16979_c1_1264_2247 | 327 |
| 609 | 3300050508 | nmdc:mga09592_249115_c1 | nmdc:mga09592_249115_c1_255_1241 | 327 |
| 610 | 3300050508 | nmdc:mga09592_278932_c1 | nmdc:mga09592_278932_c1_256_1245 | 327 |
| 611 | 3300050510 | nmdc:mga06r32_120557_c1 | nmdc:mga06r32_120557_c1_1280_2362 | 327 |
| 612 | 3300050510 | nmdc:mga06r32_132872_c1 | nmdc:mga06r32_132872_c1_866_1849 | 327 |
| 613 | 3300050510 | nmdc:mga06r32_18754_c1 | nmdc:mga06r32_18754_c1_4984_6081 | 327 |
| 614 | 3300050510 | nmdc:mga06r32_196920_c1 | nmdc:mga06r32_196920_c1_682_1674 | 327 |
| 615 | 3300050510 | nmdc:mga06r32_571762_c1 | nmdc:mga06r32_571762_c1_89_1072 | 327 |
| 616 | 3300050510 | nmdc:mga06r32_7254_c1 | nmdc:mga06r32_7254_c1_6157_7236 | 327 |
| 617 | 3300050511 | nmdc:mga08y16_153019_c1 | nmdc:mga08y16_153019_c1_1042_2025 | 327 |
| 618 | 3300050511 | nmdc:mga08y16_248160_c1 | nmdc:mga08y16_248160_c1_514_1614 | 327 |
| 619 | 3300050511 | nmdc:mga08y16_38799_c1 | nmdc:mga08y16_38799_c1_1824_2807 | 327 |
| 620 | 3300050512 | nmdc:mga0n895_110201_c1 | nmdc:mga0n895_110201_c1_909_1901 | 327 |
| 621 | 3300050512 | nmdc:mga0n895_110536_c1 | nmdc:mga0n895_110536_c1_1008_1991 | 327 |
| 622 | 3300050512 | nmdc:mga0n895_130851_c1 | nmdc:mga0n895_130851_c1_474_1457 | 327 |
| 623 | 3300050512 | nmdc:mga0n895_210719_c1 | nmdc:mga0n895_210719_c1_115_1101 | 327 |
| 624 | 3300050512 | nmdc:mga0n895_270775_c1 | nmdc:mga0n895_270775_c1_391_1374 | 327 |
| 625 | 3300050512 | nmdc:mga0n895_338998_c1 | nmdc:mga0n895_338998_c1_105_1088 | 327 |
| 626 | 3300050512 | nmdc:mga0n895_4533_c1 | nmdc:mga0n895_4533_c1_8410_9393 | 327 |
| 627 | 3300050512 | nmdc:mga0n895_53735_c1 | nmdc:mga0n895_53735_c1_1644_2636 | 327 |
| 628 | 3300050512 | nmdc:mga0n895_629438_c1 | nmdc:mga0n895_629438_c1_21_1007 | 327 |
| 629 | 3300050512 | nmdc:mga0n895_87329_c1 | nmdc:mga0n895_87329_c1_1317_2396 | 327 |
| 630 | 3300050513 | nmdc:mga0rr50_151_c1 | nmdc:mga0rr50_151_c1_28370_29359 | 327 |
| 631 | 3300050513 | nmdc:mga0rr50_200527_c1 | nmdc:mga0rr50_200527_c1_10_996 | 327 |
| 632 | 3300050513 | nmdc:mga0rr50_36995_c1 | nmdc:mga0rr50_36995_c1_1438_2421 | 327 |
| 633 | 3300050513 | nmdc:mga0rr50_55473_c1 | nmdc:mga0rr50_55473_c1_257_1357 | 327 |
| 634 | 3300050513 | nmdc:mga0rr50_8379_c1 | nmdc:mga0rr50_8379_c1_1687_2670 | 327 |
| 635 | 3300050514 | nmdc:mga08x19_46_c1 | nmdc:mga08x19_46_c1_134424_135407 | 327 |
| 636 | 3300050514 | nmdc:mga08x19_61_c1 | nmdc:mga08x19_61_c1_28367_29356 | 327 |
| 637 | 3300050515 | nmdc:mga0a205_108363_c1 | nmdc:mga0a205_108363_c1_77_1060 | 327 |
| 638 | 3300050515 | nmdc:mga0a205_204527_c1 | nmdc:mga0a205_204527_c1_513_1592 | 327 |
| 639 | 3300050515 | nmdc:mga0a205_4945_c1 | nmdc:mga0a205_4945_c1_5440_6423 | 327 |
| 640 | 3300050515 | nmdc:mga0a205_84799_c1 | nmdc:mga0a205_84799_c1_911_1894 | 327 |
| 641 | 3300050515 | nmdc:mga0a205_84870_c1 | nmdc:mga0a205_84870_c1_146_1129 | 327 |
| 642 | 3300050515 | nmdc:mga0a205_99790_c1 | nmdc:mga0a205_99790_c1_493_1476 | 327 |
| 643 | 3300053092 | Ga0500583_0157830 | Ga0500583_0157830_59_1042 | 327 |
| 644 | 3300053120 | Ga0500597_000348 | Ga0500597_000348_8398_9381 | 327 |
| 645 | 3300053177 | Ga0500636_0035310 | Ga0500636_0035310_136_1119 | 327 |
| 646 | 3300054114 | Ga0501084_0053935 | Ga0501084_0053935_497_1486 | 327 |
| 647 | 3300060353 | Ga0501082_0037531 | Ga0501082_0037531_2825_3814 | 327 |
| 648 | 3300060353 | Ga0501082_0260964 | Ga0501082_0260964_28_1020 | 327 |
| 649 | 3300061734 | Ga0530510_0198155 | Ga0530510_0198155_332_1315 | 327 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pwy-assembly2.cif.gz_C | structure of human dimeric acmsd in complex with the inhibitor tes-1025 | 0.8901 | 2 | 323 |
| 4ign-assembly2.cif.gz_B | 2.32 angstrom x-ray crystal structure of r47a mutant of human acmsd | 0.888 | 1 | 323 |
| 4ofc-assembly1.cif.gz_A | 2.0 angstroms x-ray crystal structure of human 2-amino-3-carboxymuconate-6-semialdehye decarboxylase | 0.8853 | 1 | 323 |
| 4lal-assembly2.cif.gz_D | crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil | 0.8832 | 1 | 323 |
| 4hk7-assembly1.cif.gz_C | crystal structure of cordyceps militaris idcase in complex with uracil | 0.8781 | 1 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lalD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8832 | 1 | 323 | 3.20.20.140 |
| 4eraA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8809 | 2 | 323 | 3.20.20.140 |
| 4ofcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8805 | 1 | 323 | 3.20.20.140 |
| 3nurA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8757 | 1 | 323 | 3.20.20.140 |
| 4icmA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8754 | 2 | 323 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2J9A6-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9981 | 159 | 323 |
GO:0005829
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A2V8QDW8-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9977 | 84 | 327 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A2V8QDW8-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9896 | 84 | 327 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A7C4H3Y7-F1-model_v4 | Amidohydrolase | 0.983 | 1 | 323 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A3C1G6X0-F1-model_v4 | 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase | 0.9826 | 2 | 323 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar