F472481

General Info

Members Datasets Scaffolds Average Seq Length
649 265 1298 224

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_47256_c1|nmdc:mga05p37_47256_c1_2037_2792
Length 251
Sequence VVRRSSFEPRTPNVERRTSNDEVLRMVTGIIGRKVGMTQVFDPDGTVHPATVIKAGPCVVVQAKTAQTDGYEAVQLGFVEDTPTRANKPTAGVFKKANVPPTRIRREVRLAPGGDPLKAGDSVKVSIFANGDRVDVVGTGRGKGFQGVVRRHHFAGGAATHGSMFHRAPGSIGASSFPSRVVKGMRAAGRMGGGRVTIRNLKVLQVDADNNLLVVQGGIPGAPSGYLIVRKAVAAKRLKVAQVEKPKKGKK

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
180 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 4.93
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_47256_c1 3300050507 Bacteria 5293
2 Ga0058862_12868945 3300004803 Bacteria 1419
3 Ga0065715_10148756 3300005293 Bacteria 1746
4 Ga0065707_10088640 3300005295 Bacteria 4590
5 Ga0065707_10198123 3300005295 Bacteria 1324
6 Ga0070676_10056321 3300005328 Bacteria 2323
7 Ga0070676_10117316 3300005328 Bacteria 1666
8 Ga0070690_100024490 3300005330 Bacteria 3710
9 Ga0070670_100086249 3300005331 Bacteria 2698
10 Ga0070670_100460668 3300005331 Bacteria 1128
11 Ga0070670_100518216 3300005331 Bacteria 1061
12 Ga0070670_100654566 3300005331 Bacteria 943
13 Ga0070677_10018203 3300005333 Bacteria 2528
14 Ga0070666_10007961 3300005335 Bacteria 6552
15 Ga0070666_10087708 3300005335 Bacteria 2133
16 Ga0068868_100022803 3300005338 Bacteria 4731
17 Ga0068868_100166447 3300005338 Bacteria 1823
18 Ga0068868_100828378 3300005338 Bacteria 837
19 Ga0070660_100002494 3300005339 Bacteria 12634
20 Ga0070660_100178724 3300005339 Bacteria 1717
21 Ga0070689_100086406 3300005340 Bacteria 2467
22 Ga0070689_100294828 3300005340 Bacteria 1349
23 Ga0070689_100300772 3300005340 Bacteria 1335
24 Ga0070691_10002062 3300005341 Bacteria 8874
25 Ga0070687_100086807 3300005343 Bacteria 1721
26 Ga0070661_100115297 3300005344 Bacteria 2009
27 Ga0070692_10275432 3300005345 Bacteria 1018
28 Ga0070669_100021577 3300005353 Bacteria 4602
29 Ga0070669_100022030 3300005353 Bacteria 4557
30 Ga0070669_100023184 3300005353 Bacteria 4444
31 Ga0070669_100215834 3300005353 Bacteria 1515
32 Ga0070669_100392438 3300005353 Bacteria 1134
33 Ga0070675_100000056 3300005354 Bacteria 66985
34 Ga0070675_100118742 3300005354 Bacteria 2245
35 Ga0070675_100559581 3300005354 Bacteria 1035
36 Ga0070671_100062286 3300005355 Bacteria 3106
37 Ga0070671_100216084 3300005355 Bacteria 1626
38 Ga0070671_100320131 3300005355 Bacteria 1321
39 Ga0070674_100124500 3300005356 Bacteria 1912
40 Ga0070674_100483042 3300005356 Bacteria 1028
41 Ga0070674_100619733 3300005356 Bacteria 917
42 Ga0070673_100070041 3300005364 Bacteria 2813
43 Ga0070673_100083082 3300005364 Bacteria 2601
44 Ga0070673_100230745 3300005364 Bacteria 1605
45 Ga0070673_100337781 3300005364 Bacteria 1334
46 Ga0070688_100006557 3300005365 Bacteria 6228
47 Ga0070688_100057670 3300005365 Bacteria 2442
48 Ga0070659_100032175 3300005366 Bacteria 4067
49 Ga0070667_100051704 3300005367 Bacteria 3464
50 Ga0070667_100225934 3300005367 Bacteria 1668
51 Ga0070709_10177632 3300005434 Bacteria 1493
52 Ga0070713_100021361 3300005436 Bacteria 4977
53 Ga0070700_100007525 3300005441 Bacteria 5888
54 Ga0070700_100255760 3300005441 Bacteria 1259
55 Ga0070694_100057536 3300005444 Bacteria 2643
56 Ga0070694_100182154 3300005444 Bacteria 1554
57 Ga0070694_100374008 3300005444 Bacteria 1110
58 Ga0070708_100238013 3300005445 Bacteria 1709
59 Ga0070708_100323119 3300005445 Bacteria 1454
60 Ga0070708_100325974 3300005445 Bacteria 1447
61 Ga0070678_100017395 3300005456 Bacteria 4628
62 Ga0070678_100561909 3300005456 Bacteria 1014
63 Ga0070681_10003988 3300005458 Bacteria 13923
64 Ga0070681_10101353 3300005458 Bacteria 2825
65 Ga0070681_10717799 3300005458 Bacteria 916
66 Ga0068867_100045942 3300005459 Bacteria 3205
67 Ga0068867_100102213 3300005459 Bacteria 2190
68 Ga0070685_10048153 3300005466 Bacteria 2454
69 Ga0070685_10503169 3300005466 Bacteria 858
70 Ga0070706_100377799 3300005467 Bacteria 1320
71 Ga0070706_100699789 3300005467 Bacteria 940
72 Ga0070707_100514006 3300005468 Bacteria 1160
73 Ga0070707_100863744 3300005468 Bacteria 869
74 Ga0070698_100065708 3300005471 Bacteria 3652
75 Ga0070698_100082852 3300005471 Bacteria 3199
76 Ga0070698_100658939 3300005471 Unclassified 988
77 Ga0070699_100007183 3300005518 Bacteria 9684
78 Ga0070699_100172352 3300005518 Bacteria 1918
79 Ga0070699_100729604 3300005518 Unclassified 906
80 Ga0070679_100021144 3300005530 Bacteria 6348
81 Ga0070679_100093200 3300005530 Bacteria 2999
82 Ga0070697_100701490 3300005536 Bacteria 893
83 Ga0068853_100375142 3300005539 Bacteria 1327
84 Ga0070672_100050903 3300005543 Bacteria 3228
85 Ga0070672_100098083 3300005543 Bacteria 2373
86 Ga0070686_100190149 3300005544 Bacteria 1465
87 Ga0070686_100291887 3300005544 Bacteria 1206
88 Ga0070695_100001475 3300005545 Bacteria 13049
89 Ga0070695_100018764 3300005545 Bacteria 4203
90 Ga0070695_100123039 3300005545 Bacteria 1778
91 Ga0070696_100025486 3300005546 Bacteria 4021
92 Ga0070696_100461766 3300005546 Bacteria 1004
93 Ga0070665_100004733 3300005548 Bacteria 14164
94 Ga0070704_100076902 3300005549 Bacteria 2443
95 Ga0070704_100491295 3300005549 Bacteria 1064
96 Ga0068855_100037327 3300005563 Bacteria 5778
97 Ga0068855_100281965 3300005563 Bacteria 1845
98 Ga0068857_100206501 3300005577 Bacteria 1792
99 Ga0068857_100539246 3300005577 Bacteria 1098
100 Ga0068854_100053971 3300005578 Bacteria 2888
101 Ga0068854_100426432 3300005578 Bacteria 1103
102 Ga0068854_100878188 3300005578 Bacteria 787
103 Ga0070702_100027610 3300005615 Bacteria 3065
104 Ga0068859_100004442 3300005617 Bacteria 14311
105 Ga0068859_100150479 3300005617 Bacteria 2403
106 Ga0068859_100317447 3300005617 Bacteria 1652
107 Ga0068859_100381030 3300005617 Bacteria 1506
108 Ga0068864_100144634 3300005618 Bacteria 2148
109 Ga0068861_100014830 3300005719 Bacteria 5476
110 Ga0068861_100117834 3300005719 Bacteria 2138
111 Ga0068861_101187918 3300005719 Unclassified 737
112 Ga0068870_10109190 3300005840 Bacteria 1577
113 Ga0068863_100031597 3300005841 Bacteria 5051
114 Ga0068863_100233856 3300005841 Bacteria 1773
115 Ga0068863_100437218 3300005841 Bacteria 1283
116 Ga0068863_100866158 3300005841 Bacteria 903
117 Ga0068858_100001254 3300005842 Bacteria 26256
118 Ga0068858_100103098 3300005842 Bacteria 2661
119 Ga0068858_100230540 3300005842 Bacteria 1756
120 Ga0068858_100241061 3300005842 Bacteria 1716
121 Ga0068858_100303919 3300005842 Bacteria 1522
122 Ga0068858_100372577 3300005842 Bacteria 1369
123 Ga0068858_100504071 3300005842 Bacteria 1169
124 Ga0068858_100527106 3300005842 Bacteria 1143
125 Ga0068858_100719764 3300005842 Bacteria 972
126 Ga0068860_100224236 3300005843 Bacteria 1826
127 Ga0068860_100285944 3300005843 Bacteria 1612
128 Ga0068862_100035030 3300005844 Bacteria 4249
129 Ga0068862_100076825 3300005844 Bacteria 2890
130 Ga0068862_100246112 3300005844 Bacteria 1628
131 Ga0068862_100395763 3300005844 Bacteria 1291
132 Ga0068862_100557715 3300005844 Bacteria 1095
133 Ga0068862_100985515 3300005844 Bacteria 833
134 Ga0081455_10324352 3300005937 Bacteria 1096
135 Ga0097621_100002125 3300006237 Bacteria 13554
136 Ga0097621_100010444 3300006237 Bacteria 6799
137 Ga0097621_100037182 3300006237 Bacteria 3898
138 Ga0097621_100134502 3300006237 Bacteria 2107
139 Ga0097621_100180688 3300006237 Bacteria 1823
140 Ga0097621_100234281 3300006237 Bacteria 1603
141 Ga0068871_100004003 3300006358 Bacteria 10194
142 Ga0068871_100042856 3300006358 Bacteria 3635
143 Ga0068871_100198358 3300006358 Bacteria 1732
144 Ga0068871_100354940 3300006358 Bacteria 1298
145 Ga0075428_100000009 3300006844 Bacteria 266370
146 Ga0075428_100200184 3300006844 Bacteria 2159
147 Ga0075428_100636566 3300006844 Bacteria 1138
148 Ga0075430_100403042 3300006846 Bacteria 1129
149 Ga0075433_10070530 3300006852 Bacteria 3071
150 Ga0075433_10287836 3300006852 Bacteria 1455
151 Ga0075433_10295428 3300006852 Bacteria 1435
152 Ga0075433_10305098 3300006852 Bacteria 1410
153 Ga0075434_100037241 3300006871 Bacteria 4816
154 Ga0075434_100039316 3300006871 Bacteria 4687
155 Ga0075434_100078975 3300006871 Bacteria 3287
156 Ga0075434_100119178 3300006871 Bacteria 2653
157 Ga0075434_100650059 3300006871 Bacteria 1073
158 Ga0075434_100774571 3300006871 Bacteria 976
159 Ga0068865_100018643 3300006881 Bacteria 4481
160 Ga0068865_100075068 3300006881 Bacteria 2410
161 Ga0068865_100300560 3300006881 Bacteria 1284
162 Ga0068865_100361079 3300006881 Bacteria 1179
163 Ga0075436_100018250 3300006914 Bacteria 4806
164 Ga0075436_100029534 3300006914 Bacteria 3770
165 Ga0075436_100067908 3300006914 Bacteria 2463
166 Ga0075436_100314325 3300006914 Bacteria 1124
167 Ga0075436_100490797 3300006914 Unclassified 898
168 Ga0097620_100004442 3300006931 Bacteria 14311
169 Ga0097620_100150478 3300006931 Bacteria 2403
170 Ga0097620_100317439 3300006931 Bacteria 1652
171 Ga0097620_100381022 3300006931 Bacteria 1506
172 Ga0075435_100001694 3300007076 Bacteria 14328
173 Ga0075435_100014113 3300007076 Bacteria 5961
174 Ga0075435_100035522 3300007076 Bacteria 3955
175 Ga0075435_100192284 3300007076 Bacteria 1728
176 Ga0105240_10868157 3300009093 Bacteria 973
177 Ga0111539_10000010 3300009094 Bacteria 366246
178 Ga0111539_10062867 3300009094 Bacteria 4393
179 Ga0111539_10119740 3300009094 Bacteria 3085
180 Ga0111539_10141587 3300009094 Bacteria 2816
181 Ga0111539_10186761 3300009094 Bacteria 2420
182 Ga0105245_10029630 3300009098 Bacteria 4838
183 Ga0105245_10156252 3300009098 Bacteria 2160
184 Ga0105245_10733832 3300009098 Bacteria 1023
185 Ga0105247_10020905 3300009101 Bacteria 3937
186 Ga0114129_10035392 3300009147 Bacteria 7054
187 Ga0114129_10044203 3300009147 Bacteria 6266
188 Ga0114129_10085193 3300009147 Bacteria 4384
189 Ga0114129_10085526 3300009147 Bacteria 4375
190 Ga0114129_10108910 3300009147 Bacteria 3824
191 Ga0114129_10116502 3300009147 Bacteria 3682
192 Ga0114129_10159287 3300009147 Bacteria 3085
193 Ga0114129_10301542 3300009147 Bacteria 2135
194 Ga0114129_10344498 3300009147 Bacteria 1975
195 Ga0114129_10694239 3300009147 Bacteria 1309
196 Ga0114129_10930333 3300009147 Bacteria 1099
197 Ga0114129_11014654 3300009147 Bacteria 1044
198 Ga0114129_11371980 3300009147 Bacteria 873
199 Ga0105242_10056210 3300009176 Bacteria 3220
200 Ga0105242_10081339 3300009176 Bacteria 2709
201 Ga0105248_10068147 3300009177 Bacteria 3996
202 Ga0105248_10068539 3300009177 Bacteria 3983
203 Ga0105248_10118213 3300009177 Bacteria 2990
204 Ga0105248_10173672 3300009177 Bacteria 2429
205 Ga0105248_10226681 3300009177 Bacteria 2104
206 Ga0105248_10269459 3300009177 Bacteria 1917
207 Ga0105248_10439178 3300009177 Bacteria 1470
208 Ga0105248_10705193 3300009177 Bacteria 1139
209 Ga0105248_10816031 3300009177 Bacteria 1053
210 Ga0105248_10888477 3300009177 Unclassified 1006
211 Ga0105238_10294031 3300009551 Bacteria 1607
212 Ga0105238_10734185 3300009551 Bacteria 1001
213 Ga0105249_10304663 3300009553 Bacteria 1599
214 Ga0105249_10581813 3300009553 Bacteria 1173
215 Ga0105249_11191173 3300009553 Bacteria 833
216 Ga0105249_11295091 3300009553 Bacteria 800
217 Ga0105246_10256874 3300011119 Bacteria 1390
218 Ga0105246_10286348 3300011119 Bacteria 1324
219 Ga0157374_10101783 3300013296 Bacteria 2754
220 Ga0157374_10195041 3300013296 Bacteria 1982
221 Ga0157374_11324788 3300013296 Bacteria 742
222 Ga0157378_10513642 3300013297 Bacteria 1199
223 Ga0157378_10887925 3300013297 Bacteria 921
224 Ga0163162_10298202 3300013306 Bacteria 1744
225 Ga0163162_10392854 3300013306 Bacteria 1520
226 Ga0157375_10145849 3300013308 Bacteria 2498
227 Ga0157375_11033207 3300013308 Bacteria 960
228 Ga0163163_10002082 3300014325 Bacteria 16891
229 Ga0163163_10057002 3300014325 Bacteria 3863
230 Ga0157380_10095124 3300014326 Bacteria 2467
231 Ga0157380_10100236 3300014326 Bacteria 2411
232 Ga0157380_10184921 3300014326 Bacteria 1834
233 Ga0157380_10270933 3300014326 Bacteria 1548
234 Ga0157380_10344572 3300014326 Bacteria 1392
235 Ga0157380_10432716 3300014326 Bacteria 1258
236 Ga0157377_10076435 3300014745 Bacteria 1947
237 Ga0157377_10125933 3300014745 Bacteria 1558
238 Ga0157379_10112269 3300014968 Bacteria 2449
239 Ga0157379_10199463 3300014968 Bacteria 1809
240 Ga0157379_10877108 3300014968 Unclassified 850
241 Ga0157376_10127341 3300014969 Bacteria 2267
242 Ga0157376_10250435 3300014969 Bacteria 1654
243 Ga0157376_10477923 3300014969 Bacteria 1220
244 Ga0157376_10591702 3300014969 Bacteria 1103
245 Ga0157376_10669859 3300014969 Bacteria 1040
246 Ga0163161_10202565 3300017792 Bacteria 1530
247 Ga0207682_10078805 3300025893 Bacteria 1408
248 Ga0207682_10152949 3300025893 Bacteria 1041
249 Ga0207710_10062804 3300025900 Bacteria 1689
250 Ga0207688_10098344 3300025901 Bacteria 1687
251 Ga0207688_10344001 3300025901 Bacteria 918
252 Ga0207688_10368336 3300025901 Bacteria 887
253 Ga0207680_10132033 3300025903 Bacteria 1647
254 Ga0207680_10266861 3300025903 Bacteria 1186
255 Ga0207699_10138538 3300025906 Bacteria 1596
256 Ga0207645_10025357 3300025907 Bacteria 3837
257 Ga0207645_10136165 3300025907 Bacteria 1599
258 Ga0207645_10145449 3300025907 Bacteria 1545
259 Ga0207645_10463346 3300025907 Bacteria 856
260 Ga0207643_10040769 3300025908 Bacteria 2615
261 Ga0207643_10133984 3300025908 Bacteria 1476
262 Ga0207684_10284990 3300025910 Bacteria 1425
263 Ga0207684_10614260 3300025910 Bacteria 928
264 Ga0207707_10029898 3300025912 Bacteria 4764
265 Ga0207707_10171817 3300025912 Bacteria 1894
266 Ga0207707_10623613 3300025912 Bacteria 911
267 Ga0207660_10258450 3300025917 Bacteria 1376
268 Ga0207657_10023830 3300025919 Bacteria 5688
269 Ga0207652_10038402 3300025921 Bacteria 4059
270 Ga0207652_10049237 3300025921 Bacteria 3607
271 Ga0207652_10171151 3300025921 Bacteria 1949
272 Ga0207646_10396512 3300025922 Bacteria 1247
273 Ga0207646_10486694 3300025922 Bacteria 1112
274 Ga0207646_10529864 3300025922 Bacteria 1060
275 Ga0207646_10752339 3300025922 Bacteria 870
276 Ga0207681_10012225 3300025923 Bacteria 5293
277 Ga0207681_10452325 3300025923 Bacteria 1045
278 Ga0207694_10474663 3300025924 Bacteria 1046
279 Ga0207650_10046615 3300025925 Bacteria 3192
280 Ga0207650_10135007 3300025925 Bacteria 1934
281 Ga0207650_10143586 3300025925 Bacteria 1878
282 Ga0207650_10513509 3300025925 Unclassified 1002
283 Ga0207659_10001199 3300025926 Bacteria 15459
284 Ga0207659_10073835 3300025926 Bacteria 2499
285 Ga0207687_10037873 3300025927 Bacteria 3293
286 Ga0207687_10268417 3300025927 Bacteria 1363
287 Ga0207687_10808214 3300025927 Bacteria 800
288 Ga0207644_10325590 3300025931 Bacteria 1243
289 Ga0207644_10337002 3300025931 Bacteria 1222
290 Ga0207690_10056308 3300025932 Bacteria 2652
291 Ga0207690_10199402 3300025932 Bacteria 1519
292 Ga0207690_10393920 3300025932 Bacteria 1103
293 Ga0207706_10086266 3300025933 Bacteria 2759
294 Ga0207706_10133405 3300025933 Bacteria 2184
295 Ga0207706_10402678 3300025933 Bacteria 1186
296 Ga0207686_10014161 3300025934 Bacteria 4433
297 Ga0207686_10035004 3300025934 Bacteria 3011
298 Ga0207686_10515550 3300025934 Bacteria 930
299 Ga0207709_10232912 3300025935 Bacteria 1335
300 Ga0207709_10548569 3300025935 Bacteria 909
301 Ga0207670_10095007 3300025936 Bacteria 2116
302 Ga0207670_10166240 3300025936 Bacteria 1651
303 Ga0207670_10414443 3300025936 Bacteria 1080
304 Ga0207669_10096802 3300025937 Bacteria 1938
305 Ga0207669_10490764 3300025937 Bacteria 981
306 Ga0207669_10493741 3300025937 Bacteria 978
307 Ga0207669_10505032 3300025937 Bacteria 968
308 Ga0207669_10683612 3300025937 Bacteria 842
309 Ga0207704_10015955 3300025938 Bacteria 3845
310 Ga0207704_10206955 3300025938 Bacteria 1441
311 Ga0207704_10515429 3300025938 Bacteria 966
312 Ga0207691_10056618 3300025940 Bacteria 3571
313 Ga0207691_10170084 3300025940 Bacteria 1909
314 Ga0207711_10026307 3300025941 Bacteria 4881
315 Ga0207711_10043374 3300025941 Bacteria 3836
316 Ga0207711_10079895 3300025941 Bacteria 2855
317 Ga0207711_10124821 3300025941 Bacteria 2301
318 Ga0207711_10275202 3300025941 Bacteria 1550
319 Ga0207711_10396222 3300025941 Bacteria 1282
320 Ga0207711_10627744 3300025941 Bacteria 1002
321 Ga0207711_10670643 3300025941 Bacteria 967
322 Ga0207679_10458425 3300025945 Bacteria 1132
323 Ga0207667_10017236 3300025949 Bacteria 8137
324 Ga0207651_10022734 3300025960 Bacteria 3842
325 Ga0207651_10206494 3300025960 Bacteria 1578
326 Ga0207651_10324072 3300025960 Bacteria 1289
327 Ga0207651_10335557 3300025960 Bacteria 1269
328 Ga0207712_10549824 3300025961 Bacteria 993
329 Ga0207668_10088555 3300025972 Bacteria 2267
330 Ga0207668_10412446 3300025972 Bacteria 1144
331 Ga0207640_10024624 3300025981 Bacteria 3634
332 Ga0207640_10187877 3300025981 Bacteria 1555
333 Ga0207658_10203324 3300025986 Bacteria 1655
334 Ga0207677_10382713 3300026023 Bacteria 1188
335 Ga0207677_10426603 3300026023 Bacteria 1131
336 Ga0207677_10513009 3300026023 Bacteria 1039
337 Ga0207677_10541419 3300026023 Bacteria 1013
338 Ga0207703_10011094 3300026035 Bacteria 7018
339 Ga0207703_10032896 3300026035 Bacteria 4107
340 Ga0207703_10168968 3300026035 Bacteria 1922
341 Ga0207703_10211141 3300026035 Bacteria 1731
342 Ga0207703_10666541 3300026035 Bacteria 988
343 Ga0207708_10024133 3300026075 Bacteria 4599
344 Ga0207708_10090794 3300026075 Bacteria 2355
345 Ga0207708_10167655 3300026075 Bacteria 1737
346 Ga0207708_10515650 3300026075 Bacteria 1004
347 Ga0207641_10012689 3300026088 Bacteria 6907
348 Ga0207641_10097009 3300026088 Bacteria 2590
349 Ga0207641_10547293 3300026088 Bacteria 1128
350 Ga0207648_10060929 3300026089 Bacteria 3290
351 Ga0207648_10109550 3300026089 Bacteria 2424
352 Ga0207648_10138120 3300026089 Bacteria 2147
353 Ga0207648_10138502 3300026089 Bacteria 2144
354 Ga0207648_10409053 3300026089 Bacteria 1230
355 Ga0207648_10449184 3300026089 Bacteria 1174
356 Ga0207676_10080558 3300026095 Bacteria 2643
357 Ga0207676_10369515 3300026095 Bacteria 1332
358 Ga0207676_10629627 3300026095 Bacteria 1033
359 Ga0207674_10230545 3300026116 Bacteria 1799
360 Ga0207674_10461518 3300026116 Bacteria 1227
361 Ga0207674_10499895 3300026116 Bacteria 1175
362 Ga0207675_100022779 3300026118 Bacteria 5829
363 Ga0207675_100329466 3300026118 Bacteria 1492
364 Ga0207675_100344471 3300026118 Bacteria 1459
365 Ga0207675_100896165 3300026118 Bacteria 903
366 Ga0207675_100931251 3300026118 Bacteria 886
367 Ga0207675_101023732 3300026118 Bacteria 845
368 Ga0207683_10011262 3300026121 Bacteria 7625
369 Ga0207683_10097063 3300026121 Bacteria 2628
370 Ga0207683_10114972 3300026121 Bacteria 2412
371 Ga0207683_10703655 3300026121 Bacteria 937
372 Ga0207428_10000034 3300027907 Bacteria 231306
373 Ga0207428_10064962 3300027907 Bacteria 2880
374 Ga0207428_10128212 3300027907 Bacteria 1942
375 Ga0207428_10224828 3300027907 Bacteria 1406
376 Ga0207428_10270582 3300027907 Bacteria 1263
377 Ga0268266_10020238 3300028379 Bacteria 5674
378 Ga0268266_10125397 3300028379 Bacteria 2290
379 Ga0268266_10234038 3300028379 Bacteria 1693
380 Ga0268265_10009567 3300028380 Bacteria 6545
381 Ga0268265_10021292 3300028380 Bacteria 4539
382 Ga0268265_10149451 3300028380 Bacteria 1968
383 Ga0268265_10445247 3300028380 Bacteria 1208
384 Ga0268265_10566985 3300028380 Bacteria 1080
385 Ga0268265_10746857 3300028380 Bacteria 949
386 Ga0268265_10758831 3300028380 Bacteria 942
387 Ga0268265_10933077 3300028380 Bacteria 854
388 Ga0268264_10324141 3300028381 Bacteria 1458
389 Ga0268264_10771390 3300028381 Bacteria 959
390 Ga0265318_10019047 3300028577 Bacteria 2789
391 Ga0265320_10127889 3300031240 Bacteria 1155
392 Ga0265331_10169509 3300031250 Bacteria 988
393 Ga0265316_10353151 3300031344 Bacteria 1064
394 Ga0307513_10317368 3300031456 Bacteria 1318
395 Ga0307408_100027848 3300031548 Bacteria 3899
396 Ga0265314_10012999 3300031711 Bacteria 6759
397 Ga0265314_10106718 3300031711 Bacteria 1788
398 Ga0307410_10563212 3300031852 Bacteria 946
399 Ga0307407_10493553 3300031903 Bacteria 896
400 Ga0307416_100079796 3300032002 Bacteria 2760
401 Ga0307416_100297540 3300032002 Bacteria 1602
402 Ga0373958_0000045 3300034819 Bacteria 12165
403 Ga0373959_0000960 3300034820 Bacteria 4811
404 Ga0373938_0002274 3300034957 Bacteria 3086
405 Ga0373928_0000984 3300035084 Bacteria 5581
406 Ga0373929_0000739 3300035085 Bacteria 6326
407 Ga0373940_0001699 3300035088 Bacteria 4069
408 Ga0373944_0112545 3300035089 Bacteria 931
409 Ga0373949_0000597 3300035090 Bacteria 11806
410 Ga0373951_0001047 3300035091 Bacteria 7422
411 Ga0373952_0002781 3300035092 Bacteria 3160
412 Ga0373923_0027029 3300035111 Bacteria 2286
413 Ga0373932_0001521 3300035112 Bacteria 6426
414 Ga0373936_0099321 3300035113 Bacteria 1227
415 Ga0373936_0145852 3300035113 Bacteria 1024
416 Ga0373936_0163254 3300035113 Unclassified 971
417 Ga0373939_0000664 3300035114 Bacteria 8537
418 Ga0373941_0003571 3300035115 Bacteria 3536
419 Ga0373945_0071453 3300035116 Bacteria 1314
420 Ga0373945_0076214 3300035116 Bacteria 1278
421 Ga0373956_0108859 3300035119 Bacteria 1289
422 Ga0373960_0000548 3300035121 Bacteria 7573
423 Ga0373943_0025830 3300035170 Bacteria 2747
424 Ga0373943_0034669 3300035170 Bacteria 2409
425 Ga0373943_0157836 3300035170 Bacteria 1233
426 Ga0373946_0037317 3300035171 Bacteria 1974
427 Ga0373955_0015565 3300035172 Bacteria 3726
428 Ga0373955_0056889 3300035172 Bacteria 2147
429 Ga0373955_0174044 3300035172 Bacteria 1275
430 Ga0373942_0002097 3300035207 Bacteria 4949
431 Ga0373961_0002290 3300035241 Bacteria 5004
432 Ga0373961_0016477 3300035241 Bacteria 1905
433 Ga0373961_0037526 3300035241 Bacteria 1385
434 Ga0373962_0005865 3300035242 Bacteria 2964
435 Ga0373962_0014754 3300035242 Bacteria 1995
436 Ga0373924_0007555 3300035410 Bacteria 3929
437 Ga0373931_0002441 3300035691 Bacteria 8234
438 Ga0373935_0051220 3300035692 Bacteria 2622
439 Ga0373935_0067109 3300035692 Bacteria 2306
440 Ga0373935_0082801 3300035692 Bacteria 2088
441 Ga0373935_0354067 3300035692 Bacteria 1047
442 Ga0373927_0189276 3300035695 Bacteria 1350
443 Ga0373927_0259001 3300035695 Bacteria 1144
444 Ga0373933_0116377 3300035724 Bacteria 1671
445 Ga0373937_0002194 3300036401 Bacteria 16322
446 Ga0373937_0074384 3300036401 Bacteria 3135
447 Ga0373937_0237915 3300036401 Bacteria 1715
448 Ga0373937_0311538 3300036401 Bacteria 1489
449 Ga0373937_0368089 3300036401 Bacteria 1363
450 Ga0373937_0805276 3300036401 Unclassified 887
451 Ga0373925_0012029 3300037068 Bacteria 6267
452 Ga0373925_0458048 3300037068 Bacteria 1045
453 Ga0373925_0792418 3300037068 Bacteria 781
454 Ga0439433_0056982 3300041999 Bacteria 928
455 Ga0450896_012028 3300042133 Bacteria 1222
456 Ga0451577_1063393 3300042876 Bacteria 725
457 Ga0466963_0288586 3300044694 Bacteria 1153
458 Ga0453684_0823180 3300044712 Bacteria 1000
459 Ga0466957_0420533 3300044842 Bacteria 917
460 Ga0451576_0033830 3300045051 Bacteria 5431
461 Ga0451576_0484870 3300045051 Bacteria 1299
462 Ga0495592_0042517 3300046454 Bacteria 3403
463 Ga0495603_0335905 3300046455 Bacteria 867
464 Ga0495629_0156046 3300046459 Bacteria 1586
465 Ga0495629_0225622 3300046459 Bacteria 1292
466 Ga0495580_0308218 3300046472 Bacteria 1077
467 Ga0495582_0056155 3300046473 Bacteria 2170
468 Ga0495639_0188243 3300046475 Bacteria 1007
469 Ga0495664_0245453 3300046477 Bacteria 1083
470 Ga0495664_0425059 3300046477 Bacteria 797
471 Ga0495608_0017988 3300046511 Bacteria 4883
472 Ga0495608_0486012 3300046511 Bacteria 749
473 Ga0495628_0121648 3300046516 Bacteria 2002
474 Ga0495628_0274041 3300046516 Bacteria 1254
475 Ga0495628_0431545 3300046516 Unclassified 959
476 Ga0495630_0064109 3300046517 Bacteria 2760
477 Ga0495630_0617748 3300046517 Bacteria 831
478 Ga0495640_0251102 3300046533 Bacteria 1108
479 Ga0495586_0050280 3300046535 Bacteria 2256
480 Ga0495586_0202625 3300046535 Bacteria 1125
481 Ga0495621_0142406 3300046539 Bacteria 939
482 Ga0495645_0006287 3300046543 Bacteria 8236
483 Ga0495645_0034339 3300046543 Bacteria 3700
484 Ga0495645_0212448 3300046543 Bacteria 1306
485 Ga0495633_0252884 3300046558 Bacteria 804
486 Ga0495667_0137321 3300046559 Bacteria 1576
487 Ga0495667_0425881 3300046559 Bacteria 835
488 Ga0495634_0099519 3300046642 Bacteria 1880
489 Ga0495635_0119563 3300046663 Bacteria 1798
490 Ga0495635_0182817 3300046663 Bacteria 1425
491 Ga0495635_0193402 3300046663 Bacteria 1381
492 Ga0495599_0066947 3300046678 Bacteria 2244
493 Ga0495647_0022919 3300046681 Bacteria 2260
494 Ga0495647_0111465 3300046681 Bacteria 1142
495 Ga0495647_0158943 3300046681 Unclassified 973
496 Ga0495647_0160266 3300046681 Bacteria 969
497 Ga0495658_0028361 3300046683 Bacteria 3021
498 Ga0495658_0074700 3300046683 Bacteria 1976
499 Ga0495658_0170917 3300046683 Bacteria 1345
500 Ga0495658_0619156 3300046683 Bacteria 693
501 Ga0495669_0082681 3300046684 Bacteria 1475
502 Ga0495669_0185220 3300046684 Bacteria 993
503 Ga0495613_0004017 3300046689 Bacteria 11011
504 Ga0495613_0170295 3300046689 Bacteria 1546
505 Ga0495670_0194225 3300046691 Bacteria 1074
506 Ga0495649_0227310 3300046694 Bacteria 964
507 Ga0495581_0245042 3300047315 Bacteria 1048
508 Ga0495581_0402728 3300047315 Bacteria 798
509 Ga0495604_0016858 3300047317 Bacteria 5841
510 Ga0495604_0124318 3300047317 Bacteria 1863
511 Ga0495674_0044793 3300047319 Bacteria 3932
512 Ga0495674_0136433 3300047319 Bacteria 2064
513 Ga0495674_0357475 3300047319 Bacteria 1185
514 Ga0495676_0184078 3300047321 Bacteria 1462
515 Ga0495676_0188420 3300047321 Bacteria 1441
516 Ga0495684_0001687 3300047471 Bacteria 17745
517 Ga0495684_0077826 3300047471 Bacteria 2517
518 Ga0495593_0159996 3300047673 Bacteria 1137
519 Ga0496101_0033269 3300048904 Bacteria 3635
520 Ga0496101_0701918 3300048904 Bacteria 799
521 Ga0496102_0056520 3300048905 Bacteria 3580
522 Ga0496102_0072515 3300048905 Bacteria 3165
523 Ga0496102_0372196 3300048905 Bacteria 1344
524 Ga0496102_0577578 3300048905 Bacteria 1047
525 Ga0496104_0157268 3300048907 Bacteria 2181
526 Ga0496104_0311568 3300048907 Bacteria 1487
527 Ga0496105_0058065 3300048908 Bacteria 3194
528 Ga0496106_0293312 3300048909 Bacteria 1304
529 Ga0496106_0364295 3300048909 Bacteria 1161
530 Ga0496106_0450279 3300048909 Bacteria 1034
531 Ga0496108_0035573 3300048911 Bacteria 4141
532 Ga0496108_0205736 3300048911 Bacteria 1708
533 Ga0496108_0350497 3300048911 Bacteria 1288
534 Ga0496109_0116370 3300048912 Bacteria 2488
535 Ga0496109_0308468 3300048912 Bacteria 1493
536 Ga0496110_0165129 3300048913 Bacteria 2008
537 Ga0496110_0216631 3300048913 Bacteria 1741
538 Ga0496110_0776802 3300048913 Bacteria 862
539 Ga0496112_0138763 3300048915 Bacteria 2401
540 Ga0496112_0330484 3300048915 Bacteria 1468
541 Ga0496112_0398981 3300048915 Bacteria 1315
542 Ga0496112_0771461 3300048915 Unclassified 887
543 Ga0496113_0105914 3300048916 Bacteria 2184
544 Ga0496113_0216095 3300048916 Bacteria 1527
545 Ga0496113_0317182 3300048916 Bacteria 1249
546 Ga0496114_0041390 3300048917 Bacteria 3818
547 Ga0496114_0044186 3300048917 Bacteria 3696
548 Ga0496114_0079554 3300048917 Bacteria 2767
549 Ga0496114_0210795 3300048917 Bacteria 1704
550 Ga0496114_0785324 3300048917 Bacteria 831
551 Ga0501031_0004685 3300049568 Bacteria 8873
552 Ga0501032_0004614 3300049569 Bacteria 10362
553 Ga0501033_0087057 3300049570 Bacteria 2286
554 Ga0501034_0013252 3300049571 Bacteria 8494
555 Ga0501034_0027678 3300049571 Bacteria 5764
556 Ga0501036_0052563 3300049572 Bacteria 3450
557 Ga0501036_0073692 3300049572 Bacteria 2886
558 Ga0501038_0091578 3300049574 Bacteria 2547
559 Ga0501039_0320937 3300049575 Bacteria 1217
560 Ga0501041_0196608 3300049577 Bacteria 1264
561 Ga0501042_0036543 3300049578 Bacteria 3485
562 Ga0501042_0235934 3300049578 Bacteria 1320
563 Ga0501043_0238640 3300049579 Bacteria 1402
564 Ga0501046_0008350 3300049580 Bacteria 9032
565 Ga0501046_0311037 3300049580 Bacteria 1149
566 Ga0501047_0074722 3300049581 Bacteria 3262
567 Ga0501047_0094773 3300049581 Bacteria 2864
568 Ga0501047_0108884 3300049581 Bacteria 2653
569 Ga0501048_0672392 3300049582 Bacteria 743
570 Ga0501068_0165310 3300049584 Bacteria 1395
571 Ga0501069_0005714 3300049585 Bacteria 6482
572 Ga0501071_0039355 3300049587 Bacteria 3382
573 Ga0501072_0063471 3300049588 Bacteria 2914
574 Ga0501072_0439949 3300049588 Bacteria 1033
575 Ga0501073_0445016 3300049589 Bacteria 896
576 Ga0501074_0077806 3300049590 Bacteria 2381
577 Ga0501074_0274511 3300049590 Bacteria 1198
578 Ga0501075_0249335 3300049591 Bacteria 1353
579 Ga0501075_0320695 3300049591 Bacteria 1181
580 Ga0501076_0096285 3300049592 Bacteria 2384
581 Ga0501076_0332211 3300049592 Bacteria 1247
582 Ga0501080_0254109 3300049742 Bacteria 1602
583 Ga0501080_0434221 3300049742 Bacteria 1178
584 Ga0501083_0178433 3300049744 Bacteria 1387
585 Ga0501044_0003452 3300049823 Bacteria 17800
586 Ga0501044_0271144 3300049823 Bacteria 1632
587 Ga0501045_0012622 3300049824 Bacteria 5949
588 Ga0501045_0173855 3300049824 Bacteria 1604
589 Ga0501045_0567104 3300049824 Bacteria 842
590 nmdc:mga07m45_202941_c1 3300050496 Bacteria 1153
591 nmdc:mga05p37_102472_c1 3300050507 Bacteria 3525
592 nmdc:mga05p37_108815_c1 3300050507 Bacteria 3409
593 nmdc:mga05p37_109876_c1 3300050507 Bacteria 3392
594 nmdc:mga05p37_1444535_c1 3300050507 Bacteria 689
595 nmdc:mga05p37_18820_c1 3300050507 Bacteria 8346
596 nmdc:mga05p37_2249_c1 3300050507 Bacteria 22479
597 nmdc:mga05p37_365207_c1 3300050507 Bacteria 1696
598 nmdc:mga05p37_43335_c1 3300050507 Bacteria 5536
599 nmdc:mga05p37_4833_c1 3300050507 Bacteria 15759
600 nmdc:mga05p37_703005_c1 3300050507 Bacteria 1122
601 nmdc:mga05p37_890312_c1 3300050507 Bacteria 961
602 nmdc:mga0qj67_285247_c1 3300050509 Bacteria 1338
603 nmdc:mga0qj67_412447_c1 3300050509 Bacteria 1089
604 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
605 nmdc:mga08y16_193356_c1 3300050511 Bacteria 2110
606 nmdc:mga08y16_25354_c1 3300050511 Bacteria 6252
607 nmdc:mga08y16_440485_c1 3300050511 Bacteria 1330
608 nmdc:mga08y16_51490_c1 3300050511 Bacteria 4308
609 nmdc:mga08y16_80231_c1 3300050511 Bacteria 3402
610 nmdc:mga0n895_14_c1 3300050512 Bacteria 102430
611 nmdc:mga0n895_23375_c1 3300050512 Bacteria 5810
612 nmdc:mga0n895_542108_c1 3300050512 Bacteria 1170
613 nmdc:mga0n895_671696_c1 3300050512 Bacteria 1033
614 nmdc:mga0n895_70970_c1 3300050512 Bacteria 3453
615 nmdc:mga0rr50_1773_c1 3300050513 Bacteria 11923
616 nmdc:mga0rr50_192641_c1 3300050513 Bacteria 1672
617 nmdc:mga0rr50_247712_c1 3300050513 Bacteria 1479
618 nmdc:mga0rr50_254687_c1 3300050513 Bacteria 1459
619 nmdc:mga0rr50_26301_c1 3300050513 Bacteria 4058
620 nmdc:mga0rr50_46593_c1 3300050513 Bacteria 3193
621 nmdc:mga0rr50_760396_c1 3300050513 Bacteria 827
622 nmdc:mga08x19_15262_c1 3300050514 Bacteria 2306
623 nmdc:mga08x19_224233_c1 3300050514 Bacteria 1292
624 nmdc:mga08x19_24027_c1 3300050514 Bacteria 3784
625 nmdc:mga08x19_306985_c1 3300050514 Bacteria 1103
626 nmdc:mga08x19_312571_c1 3300050514 Bacteria 1093
627 nmdc:mga08x19_35737_c1 3300050514 Bacteria 3145
628 nmdc:mga08x19_42012_c1 3300050514 Bacteria 2913
629 nmdc:mga08x19_627171_c1 3300050514 Bacteria 762
630 nmdc:mga0a205_101446_c1 3300050515 Bacteria 2361
631 nmdc:mga0a205_193457_c1 3300050515 Bacteria 1925
632 nmdc:mga0a205_216150_c1 3300050515 Bacteria 1804
633 nmdc:mga0a205_59155_c1 3300050515 Bacteria 3702
634 nmdc:mga0a205_61976_c1 3300050515 Bacteria 3614
635 Ga0495601_0019030 3300053077 Bacteria 4184
636 Ga0495601_0200098 3300053077 Bacteria 1305
637 Ga0495655_0059126 3300053083 Bacteria 1040
638 Ga0495595_0020969 3300053084 Bacteria 2850
639 Ga0495595_0188405 3300053084 Bacteria 1025
640 Ga0495619_0005476 3300053085 Bacteria 8049
641 Ga0495619_0013677 3300053085 Bacteria 5116
642 Ga0495619_0108208 3300053085 Bacteria 1897
643 Ga0495619_0391122 3300053085 Unclassified 961
644 Ga0501084_0068779 3300054114 Bacteria 2964
645 Ga0501084_0240297 3300054114 Bacteria 1529
646 Ga0501082_0381107 3300060353 Bacteria 1230
647 Ga0501082_0896984 3300060353 Bacteria 775
648 Ga0501082_0960056 3300060353 Bacteria 747
649 Ga0501082_0960967 3300060353 Bacteria 747
650 nmdc:mga05p37_47256_c1
651 Ga0058862_12868945
652 Ga0065715_10148756
653 Ga0065707_10088640
654 Ga0065707_10198123
655 Ga0070676_10056321
656 Ga0070676_10117316
657 Ga0070690_100024490
658 Ga0070670_100086249
659 Ga0070670_100460668
660 Ga0070670_100518216
661 Ga0070670_100654566
662 Ga0070677_10018203
663 Ga0070666_10007961
664 Ga0070666_10087708
665 Ga0068868_100022803
666 Ga0068868_100166447
667 Ga0068868_100828378
668 Ga0070660_100002494
669 Ga0070660_100178724
670 Ga0070689_100086406
671 Ga0070689_100294828
672 Ga0070689_100300772
673 Ga0070691_10002062
674 Ga0070687_100086807
675 Ga0070661_100115297
676 Ga0070692_10275432
677 Ga0070669_100021577
678 Ga0070669_100022030
679 Ga0070669_100023184
680 Ga0070669_100215834
681 Ga0070669_100392438
682 Ga0070675_100000056
683 Ga0070675_100118742
684 Ga0070675_100559581
685 Ga0070671_100062286
686 Ga0070671_100216084
687 Ga0070671_100320131
688 Ga0070674_100124500
689 Ga0070674_100483042
690 Ga0070674_100619733
691 Ga0070673_100070041
692 Ga0070673_100083082
693 Ga0070673_100230745
694 Ga0070673_100337781
695 Ga0070688_100006557
696 Ga0070688_100057670
697 Ga0070659_100032175
698 Ga0070667_100051704
699 Ga0070667_100225934
700 Ga0070709_10177632
701 Ga0070713_100021361
702 Ga0070700_100007525
703 Ga0070700_100255760
704 Ga0070694_100057536
705 Ga0070694_100182154
706 Ga0070694_100374008
707 Ga0070708_100238013
708 Ga0070708_100323119
709 Ga0070708_100325974
710 Ga0070678_100017395
711 Ga0070678_100561909
712 Ga0070681_10003988
713 Ga0070681_10101353
714 Ga0070681_10717799
715 Ga0068867_100045942
716 Ga0068867_100102213
717 Ga0070685_10048153
718 Ga0070685_10503169
719 Ga0070706_100377799
720 Ga0070706_100699789
721 Ga0070707_100514006
722 Ga0070707_100863744
723 Ga0070698_100065708
724 Ga0070698_100082852
725 Ga0070698_100658939
726 Ga0070699_100007183
727 Ga0070699_100172352
728 Ga0070699_100729604
729 Ga0070679_100021144
730 Ga0070679_100093200
731 Ga0070697_100701490
732 Ga0068853_100375142
733 Ga0070672_100050903
734 Ga0070672_100098083
735 Ga0070686_100190149
736 Ga0070686_100291887
737 Ga0070695_100001475
738 Ga0070695_100018764
739 Ga0070695_100123039
740 Ga0070696_100025486
741 Ga0070696_100461766
742 Ga0070665_100004733
743 Ga0070704_100076902
744 Ga0070704_100491295
745 Ga0068855_100037327
746 Ga0068855_100281965
747 Ga0068857_100206501
748 Ga0068857_100539246
749 Ga0068854_100053971
750 Ga0068854_100426432
751 Ga0068854_100878188
752 Ga0070702_100027610
753 Ga0068859_100004442
754 Ga0068859_100150479
755 Ga0068859_100317447
756 Ga0068859_100381030
757 Ga0068864_100144634
758 Ga0068861_100014830
759 Ga0068861_100117834
760 Ga0068861_101187918
761 Ga0068870_10109190
762 Ga0068863_100031597
763 Ga0068863_100233856
764 Ga0068863_100437218
765 Ga0068863_100866158
766 Ga0068858_100001254
767 Ga0068858_100103098
768 Ga0068858_100230540
769 Ga0068858_100241061
770 Ga0068858_100303919
771 Ga0068858_100372577
772 Ga0068858_100504071
773 Ga0068858_100527106
774 Ga0068858_100719764
775 Ga0068860_100224236
776 Ga0068860_100285944
777 Ga0068862_100035030
778 Ga0068862_100076825
779 Ga0068862_100246112
780 Ga0068862_100395763
781 Ga0068862_100557715
782 Ga0068862_100985515
783 Ga0081455_10324352
784 Ga0097621_100002125
785 Ga0097621_100010444
786 Ga0097621_100037182
787 Ga0097621_100134502
788 Ga0097621_100180688
789 Ga0097621_100234281
790 Ga0068871_100004003
791 Ga0068871_100042856
792 Ga0068871_100198358
793 Ga0068871_100354940
794 Ga0075428_100000009
795 Ga0075428_100200184
796 Ga0075428_100636566
797 Ga0075430_100403042
798 Ga0075433_10070530
799 Ga0075433_10287836
800 Ga0075433_10295428
801 Ga0075433_10305098
802 Ga0075434_100037241
803 Ga0075434_100039316
804 Ga0075434_100078975
805 Ga0075434_100119178
806 Ga0075434_100650059
807 Ga0075434_100774571
808 Ga0068865_100018643
809 Ga0068865_100075068
810 Ga0068865_100300560
811 Ga0068865_100361079
812 Ga0075436_100018250
813 Ga0075436_100029534
814 Ga0075436_100067908
815 Ga0075436_100314325
816 Ga0075436_100490797
817 Ga0097620_100004442
818 Ga0097620_100150478
819 Ga0097620_100317439
820 Ga0097620_100381022
821 Ga0075435_100001694
822 Ga0075435_100014113
823 Ga0075435_100035522
824 Ga0075435_100192284
825 Ga0105240_10868157
826 Ga0111539_10000010
827 Ga0111539_10062867
828 Ga0111539_10119740
829 Ga0111539_10141587
830 Ga0111539_10186761
831 Ga0105245_10029630
832 Ga0105245_10156252
833 Ga0105245_10733832
834 Ga0105247_10020905
835 Ga0114129_10035392
836 Ga0114129_10044203
837 Ga0114129_10085193
838 Ga0114129_10085526
839 Ga0114129_10108910
840 Ga0114129_10116502
841 Ga0114129_10159287
842 Ga0114129_10301542
843 Ga0114129_10344498
844 Ga0114129_10694239
845 Ga0114129_10930333
846 Ga0114129_11014654
847 Ga0114129_11371980
848 Ga0105242_10056210
849 Ga0105242_10081339
850 Ga0105248_10068147
851 Ga0105248_10068539
852 Ga0105248_10118213
853 Ga0105248_10173672
854 Ga0105248_10226681
855 Ga0105248_10269459
856 Ga0105248_10439178
857 Ga0105248_10705193
858 Ga0105248_10816031
859 Ga0105248_10888477
860 Ga0105238_10294031
861 Ga0105238_10734185
862 Ga0105249_10304663
863 Ga0105249_10581813
864 Ga0105249_11191173
865 Ga0105249_11295091
866 Ga0105246_10256874
867 Ga0105246_10286348
868 Ga0157374_10101783
869 Ga0157374_10195041
870 Ga0157374_11324788
871 Ga0157378_10513642
872 Ga0157378_10887925
873 Ga0163162_10298202
874 Ga0163162_10392854
875 Ga0157375_10145849
876 Ga0157375_11033207
877 Ga0163163_10002082
878 Ga0163163_10057002
879 Ga0157380_10095124
880 Ga0157380_10100236
881 Ga0157380_10184921
882 Ga0157380_10270933
883 Ga0157380_10344572
884 Ga0157380_10432716
885 Ga0157377_10076435
886 Ga0157377_10125933
887 Ga0157379_10112269
888 Ga0157379_10199463
889 Ga0157379_10877108
890 Ga0157376_10127341
891 Ga0157376_10250435
892 Ga0157376_10477923
893 Ga0157376_10591702
894 Ga0157376_10669859
895 Ga0163161_10202565
896 Ga0207682_10078805
897 Ga0207682_10152949
898 Ga0207710_10062804
899 Ga0207688_10098344
900 Ga0207688_10344001
901 Ga0207688_10368336
902 Ga0207680_10132033
903 Ga0207680_10266861
904 Ga0207699_10138538
905 Ga0207645_10025357
906 Ga0207645_10136165
907 Ga0207645_10145449
908 Ga0207645_10463346
909 Ga0207643_10040769
910 Ga0207643_10133984
911 Ga0207684_10284990
912 Ga0207684_10614260
913 Ga0207707_10029898
914 Ga0207707_10171817
915 Ga0207707_10623613
916 Ga0207660_10258450
917 Ga0207657_10023830
918 Ga0207652_10038402
919 Ga0207652_10049237
920 Ga0207652_10171151
921 Ga0207646_10396512
922 Ga0207646_10486694
923 Ga0207646_10529864
924 Ga0207646_10752339
925 Ga0207681_10012225
926 Ga0207681_10452325
927 Ga0207694_10474663
928 Ga0207650_10046615
929 Ga0207650_10135007
930 Ga0207650_10143586
931 Ga0207650_10513509
932 Ga0207659_10001199
933 Ga0207659_10073835
934 Ga0207687_10037873
935 Ga0207687_10268417
936 Ga0207687_10808214
937 Ga0207644_10325590
938 Ga0207644_10337002
939 Ga0207690_10056308
940 Ga0207690_10199402
941 Ga0207690_10393920
942 Ga0207706_10086266
943 Ga0207706_10133405
944 Ga0207706_10402678
945 Ga0207686_10014161
946 Ga0207686_10035004
947 Ga0207686_10515550
948 Ga0207709_10232912
949 Ga0207709_10548569
950 Ga0207670_10095007
951 Ga0207670_10166240
952 Ga0207670_10414443
953 Ga0207669_10096802
954 Ga0207669_10490764
955 Ga0207669_10493741
956 Ga0207669_10505032
957 Ga0207669_10683612
958 Ga0207704_10015955
959 Ga0207704_10206955
960 Ga0207704_10515429
961 Ga0207691_10056618
962 Ga0207691_10170084
963 Ga0207711_10026307
964 Ga0207711_10043374
965 Ga0207711_10079895
966 Ga0207711_10124821
967 Ga0207711_10275202
968 Ga0207711_10396222
969 Ga0207711_10627744
970 Ga0207711_10670643
971 Ga0207679_10458425
972 Ga0207667_10017236
973 Ga0207651_10022734
974 Ga0207651_10206494
975 Ga0207651_10324072
976 Ga0207651_10335557
977 Ga0207712_10549824
978 Ga0207668_10088555
979 Ga0207668_10412446
980 Ga0207640_10024624
981 Ga0207640_10187877
982 Ga0207658_10203324
983 Ga0207677_10382713
984 Ga0207677_10426603
985 Ga0207677_10513009
986 Ga0207677_10541419
987 Ga0207703_10011094
988 Ga0207703_10032896
989 Ga0207703_10168968
990 Ga0207703_10211141
991 Ga0207703_10666541
992 Ga0207708_10024133
993 Ga0207708_10090794
994 Ga0207708_10167655
995 Ga0207708_10515650
996 Ga0207641_10012689
997 Ga0207641_10097009
998 Ga0207641_10547293
999 Ga0207648_10060929
1000 Ga0207648_10109550
1001 Ga0207648_10138120
1002 Ga0207648_10138502
1003 Ga0207648_10409053
1004 Ga0207648_10449184
1005 Ga0207676_10080558
1006 Ga0207676_10369515
1007 Ga0207676_10629627
1008 Ga0207674_10230545
1009 Ga0207674_10461518
1010 Ga0207674_10499895
1011 Ga0207675_100022779
1012 Ga0207675_100329466
1013 Ga0207675_100344471
1014 Ga0207675_100896165
1015 Ga0207675_100931251
1016 Ga0207675_101023732
1017 Ga0207683_10011262
1018 Ga0207683_10097063
1019 Ga0207683_10114972
1020 Ga0207683_10703655
1021 Ga0207428_10000034
1022 Ga0207428_10064962
1023 Ga0207428_10128212
1024 Ga0207428_10224828
1025 Ga0207428_10270582
1026 Ga0268266_10020238
1027 Ga0268266_10125397
1028 Ga0268266_10234038
1029 Ga0268265_10009567
1030 Ga0268265_10021292
1031 Ga0268265_10149451
1032 Ga0268265_10445247
1033 Ga0268265_10566985
1034 Ga0268265_10746857
1035 Ga0268265_10758831
1036 Ga0268265_10933077
1037 Ga0268264_10324141
1038 Ga0268264_10771390
1039 Ga0265318_10019047
1040 Ga0265320_10127889
1041 Ga0265331_10169509
1042 Ga0265316_10353151
1043 Ga0307513_10317368
1044 Ga0307408_100027848
1045 Ga0265314_10012999
1046 Ga0265314_10106718
1047 Ga0307410_10563212
1048 Ga0307407_10493553
1049 Ga0307416_100079796
1050 Ga0307416_100297540
1051 Ga0373958_0000045
1052 Ga0373959_0000960
1053 Ga0373938_0002274
1054 Ga0373928_0000984
1055 Ga0373929_0000739
1056 Ga0373940_0001699
1057 Ga0373944_0112545
1058 Ga0373949_0000597
1059 Ga0373951_0001047
1060 Ga0373952_0002781
1061 Ga0373923_0027029
1062 Ga0373932_0001521
1063 Ga0373936_0099321
1064 Ga0373936_0145852
1065 Ga0373936_0163254
1066 Ga0373939_0000664
1067 Ga0373941_0003571
1068 Ga0373945_0071453
1069 Ga0373945_0076214
1070 Ga0373956_0108859
1071 Ga0373960_0000548
1072 Ga0373943_0025830
1073 Ga0373943_0034669
1074 Ga0373943_0157836
1075 Ga0373946_0037317
1076 Ga0373955_0015565
1077 Ga0373955_0056889
1078 Ga0373955_0174044
1079 Ga0373942_0002097
1080 Ga0373961_0002290
1081 Ga0373961_0016477
1082 Ga0373961_0037526
1083 Ga0373962_0005865
1084 Ga0373962_0014754
1085 Ga0373924_0007555
1086 Ga0373931_0002441
1087 Ga0373935_0051220
1088 Ga0373935_0067109
1089 Ga0373935_0082801
1090 Ga0373935_0354067
1091 Ga0373927_0189276
1092 Ga0373927_0259001
1093 Ga0373933_0116377
1094 Ga0373937_0002194
1095 Ga0373937_0074384
1096 Ga0373937_0237915
1097 Ga0373937_0311538
1098 Ga0373937_0368089
1099 Ga0373937_0805276
1100 Ga0373925_0012029
1101 Ga0373925_0458048
1102 Ga0373925_0792418
1103 Ga0439433_0056982
1104 Ga0450896_012028
1105 Ga0451577_1063393
1106 Ga0466963_0288586
1107 Ga0453684_0823180
1108 Ga0466957_0420533
1109 Ga0451576_0033830
1110 Ga0451576_0484870
1111 Ga0495592_0042517
1112 Ga0495603_0335905
1113 Ga0495629_0156046
1114 Ga0495629_0225622
1115 Ga0495580_0308218
1116 Ga0495582_0056155
1117 Ga0495639_0188243
1118 Ga0495664_0245453
1119 Ga0495664_0425059
1120 Ga0495608_0017988
1121 Ga0495608_0486012
1122 Ga0495628_0121648
1123 Ga0495628_0274041
1124 Ga0495628_0431545
1125 Ga0495630_0064109
1126 Ga0495630_0617748
1127 Ga0495640_0251102
1128 Ga0495586_0050280
1129 Ga0495586_0202625
1130 Ga0495621_0142406
1131 Ga0495645_0006287
1132 Ga0495645_0034339
1133 Ga0495645_0212448
1134 Ga0495633_0252884
1135 Ga0495667_0137321
1136 Ga0495667_0425881
1137 Ga0495634_0099519
1138 Ga0495635_0119563
1139 Ga0495635_0182817
1140 Ga0495635_0193402
1141 Ga0495599_0066947
1142 Ga0495647_0022919
1143 Ga0495647_0111465
1144 Ga0495647_0158943
1145 Ga0495647_0160266
1146 Ga0495658_0028361
1147 Ga0495658_0074700
1148 Ga0495658_0170917
1149 Ga0495658_0619156
1150 Ga0495669_0082681
1151 Ga0495669_0185220
1152 Ga0495613_0004017
1153 Ga0495613_0170295
1154 Ga0495670_0194225
1155 Ga0495649_0227310
1156 Ga0495581_0245042
1157 Ga0495581_0402728
1158 Ga0495604_0016858
1159 Ga0495604_0124318
1160 Ga0495674_0044793
1161 Ga0495674_0136433
1162 Ga0495674_0357475
1163 Ga0495676_0184078
1164 Ga0495676_0188420
1165 Ga0495684_0001687
1166 Ga0495684_0077826
1167 Ga0495593_0159996
1168 Ga0496101_0033269
1169 Ga0496101_0701918
1170 Ga0496102_0056520
1171 Ga0496102_0072515
1172 Ga0496102_0372196
1173 Ga0496102_0577578
1174 Ga0496104_0157268
1175 Ga0496104_0311568
1176 Ga0496105_0058065
1177 Ga0496106_0293312
1178 Ga0496106_0364295
1179 Ga0496106_0450279
1180 Ga0496108_0035573
1181 Ga0496108_0205736
1182 Ga0496108_0350497
1183 Ga0496109_0116370
1184 Ga0496109_0308468
1185 Ga0496110_0165129
1186 Ga0496110_0216631
1187 Ga0496110_0776802
1188 Ga0496112_0138763
1189 Ga0496112_0330484
1190 Ga0496112_0398981
1191 Ga0496112_0771461
1192 Ga0496113_0105914
1193 Ga0496113_0216095
1194 Ga0496113_0317182
1195 Ga0496114_0041390
1196 Ga0496114_0044186
1197 Ga0496114_0079554
1198 Ga0496114_0210795
1199 Ga0496114_0785324
1200 Ga0501031_0004685
1201 Ga0501032_0004614
1202 Ga0501033_0087057
1203 Ga0501034_0013252
1204 Ga0501034_0027678
1205 Ga0501036_0052563
1206 Ga0501036_0073692
1207 Ga0501038_0091578
1208 Ga0501039_0320937
1209 Ga0501041_0196608
1210 Ga0501042_0036543
1211 Ga0501042_0235934
1212 Ga0501043_0238640
1213 Ga0501046_0008350
1214 Ga0501046_0311037
1215 Ga0501047_0074722
1216 Ga0501047_0094773
1217 Ga0501047_0108884
1218 Ga0501048_0672392
1219 Ga0501068_0165310
1220 Ga0501069_0005714
1221 Ga0501071_0039355
1222 Ga0501072_0063471
1223 Ga0501072_0439949
1224 Ga0501073_0445016
1225 Ga0501074_0077806
1226 Ga0501074_0274511
1227 Ga0501075_0249335
1228 Ga0501075_0320695
1229 Ga0501076_0096285
1230 Ga0501076_0332211
1231 Ga0501080_0254109
1232 Ga0501080_0434221
1233 Ga0501083_0178433
1234 Ga0501044_0003452
1235 Ga0501044_0271144
1236 Ga0501045_0012622
1237 Ga0501045_0173855
1238 Ga0501045_0567104
1239 nmdc:mga07m45_202941_c1
1240 nmdc:mga05p37_102472_c1
1241 nmdc:mga05p37_108815_c1
1242 nmdc:mga05p37_109876_c1
1243 nmdc:mga05p37_1444535_c1
1244 nmdc:mga05p37_18820_c1
1245 nmdc:mga05p37_2249_c1
1246 nmdc:mga05p37_365207_c1
1247 nmdc:mga05p37_43335_c1
1248 nmdc:mga05p37_4833_c1
1249 nmdc:mga05p37_703005_c1
1250 nmdc:mga05p37_890312_c1
1251 nmdc:mga0qj67_285247_c1
1252 nmdc:mga0qj67_412447_c1
1253 nmdc:mga08y16_10_c1
1254 nmdc:mga08y16_193356_c1
1255 nmdc:mga08y16_25354_c1
1256 nmdc:mga08y16_440485_c1
1257 nmdc:mga08y16_51490_c1
1258 nmdc:mga08y16_80231_c1
1259 nmdc:mga0n895_14_c1
1260 nmdc:mga0n895_23375_c1
1261 nmdc:mga0n895_542108_c1
1262 nmdc:mga0n895_671696_c1
1263 nmdc:mga0n895_70970_c1
1264 nmdc:mga0rr50_1773_c1
1265 nmdc:mga0rr50_192641_c1
1266 nmdc:mga0rr50_247712_c1
1267 nmdc:mga0rr50_254687_c1
1268 nmdc:mga0rr50_26301_c1
1269 nmdc:mga0rr50_46593_c1
1270 nmdc:mga0rr50_760396_c1
1271 nmdc:mga08x19_15262_c1
1272 nmdc:mga08x19_224233_c1
1273 nmdc:mga08x19_24027_c1
1274 nmdc:mga08x19_306985_c1
1275 nmdc:mga08x19_312571_c1
1276 nmdc:mga08x19_35737_c1
1277 nmdc:mga08x19_42012_c1
1278 nmdc:mga08x19_627171_c1
1279 nmdc:mga0a205_101446_c1
1280 nmdc:mga0a205_193457_c1
1281 nmdc:mga0a205_216150_c1
1282 nmdc:mga0a205_59155_c1
1283 nmdc:mga0a205_61976_c1
1284 Ga0495601_0019030
1285 Ga0495601_0200098
1286 Ga0495655_0059126
1287 Ga0495595_0020969
1288 Ga0495595_0188405
1289 Ga0495619_0005476
1290 Ga0495619_0013677
1291 Ga0495619_0108208
1292 Ga0495619_0391122
1293 Ga0501084_0068779
1294 Ga0501084_0240297
1295 Ga0501082_0381107
1296 Ga0501082_0896984
1297 Ga0501082_0960056
1298 Ga0501082_0960967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

118

212

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.907 4 209
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9068 3 210
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.9066 4 209
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.8963 4 209
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8961 3 210
ID Description Score Start End Superfamily
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8791 3 208 2.40.30.10
af_Q9XXQ7_29_375_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.8389 7 30 3.90.70.10
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8275 34 85 3.30.160.810
1vw3C02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.823 33 98 3.30.160.810
af_Q54I61_95_160_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8136 33 95 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A533RXT6-F1-model_v4 50S ribosomal protein L3 0.9175 1 104 GO:0003735
GO:0006412
GO:0022625
AF-A0A2E8NF35-F1-model_v4 50S ribosomal protein L3 0.9022 5 107 GO:0003735
GO:0006412
GO:0022625
AF-A0A485AH68-F1-model_v4 50S ribosomal protein L3 0.8968 1 102 GO:0003735
GO:0006412
GO:0022625
AF-A0A835GWP7-F1-model_v4 50S ribosomal protein L3 0.8945 5 121 GO:0003735
GO:0005762
GO:0006412
AF-A0A7Y1SZQ3-F1-model_v4 50S ribosomal protein L3 0.8936 5 122 GO:0003735
GO:0005840
GO:0006412

Map