F472447

General Info

Members Datasets Scaffolds Average Seq Length
649 257 1298 111

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10911917|Ga0163162_109119171
Length 113
Sequence VAGILRGEIRWADLNPIRGNEQAGLRPVLILSHDVFNERSGTVIAVALTSQPQRAGFPLTLEITAARLPKSRSWVKISQIRTLAIERIGKRLGRASPEEMGQVIEGLNEILGA

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
146 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
157 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
166 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
167 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
168 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
187 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
193 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
253 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 0.31
Rhizosphere 97.84
Stem 0
Stem Tuber 0
Unclassified 35.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10911917 3300013306 Bacteria 991
2 MRS1b_contig_5170368 2162886011 Unclassified 837
3 MBSR1b_contig_13570300 2162886012 Bacteria 912
4 MBSR1b_contig_6330342 2162886012 Unclassified 837
5 Ga0058862_11096336 3300004803 Unclassified 707
6 Ga0065714_10064422 3300005288 Bacteria 270668
7 Ga0065712_10067728 3300005290 Bacteria 178215
8 Ga0065715_10327425 3300005293 Unclassified 990
9 Ga0065707_10128050 3300005295 Bacteria 1972
10 Ga0070658_10266236 3300005327 Bacteria 1456
11 Ga0070690_100020180 3300005330 Bacteria 4057
12 Ga0070670_100375613 3300005331 Bacteria 1252
13 Ga0070677_10011843 3300005333 Bacteria 3018
14 Ga0070682_101340836 3300005337 Unclassified 609
15 Ga0070689_100002792 3300005340 Bacteria 11468
16 Ga0070689_100255388 3300005340 Bacteria 1447
17 Ga0070689_101567391 3300005340 Unclassified 598
18 Ga0070661_100489151 3300005344 Bacteria 983
19 Ga0070661_101817158 3300005344 Bacteria 517
20 Ga0070692_10750846 3300005345 Bacteria 661
21 Ga0070668_100806044 3300005347 Unclassified 834
22 Ga0070668_101072735 3300005347 Unclassified 726
23 Ga0070669_100030553 3300005353 Bacteria 3888
24 Ga0070669_100900906 3300005353 Unclassified 755
25 Ga0070675_100000115 3300005354 Bacteria 46929
26 Ga0070671_100000047 3300005355 Bacteria 84234
27 Ga0070674_100027215 3300005356 Bacteria 3745
28 Ga0070674_100586189 3300005356 Unclassified 940
29 Ga0070673_100011261 3300005364 Bacteria 6099
30 Ga0070673_100296337 3300005364 Unclassified 1423
31 Ga0070688_100293595 3300005365 Bacteria 1172
32 Ga0070688_101322000 3300005365 Unclassified 582
33 Ga0070667_100225333 3300005367 Unclassified 1670
34 Ga0070709_10290905 3300005434 Bacteria 1190
35 Ga0070713_100043854 3300005436 Unclassified 3659
36 Ga0070713_100109680 3300005436 Bacteria 2405
37 Ga0070701_11018244 3300005438 Unclassified 579
38 Ga0070700_100339851 3300005441 Bacteria 1109
39 Ga0070700_100376788 3300005441 Unclassified 1060
40 Ga0070700_100732409 3300005441 Unclassified 789
41 Ga0070694_100795809 3300005444 Unclassified 775
42 Ga0070708_100106008 3300005445 Bacteria 2580
43 Ga0070708_100214996 3300005445 Bacteria 1802
44 Ga0070708_100366590 3300005445 Bacteria 1358
45 Ga0070708_100529416 3300005445 Unclassified 1112
46 Ga0070708_100654729 3300005445 Bacteria 990
47 Ga0070708_101370927 3300005445 Unclassified 660
48 Ga0070678_101388801 3300005456 Bacteria 655
49 Ga0070662_101219942 3300005457 Unclassified 647
50 Ga0070681_11130899 3300005458 Unclassified 704
51 Ga0068867_100173799 3300005459 Bacteria 1708
52 Ga0068867_100314034 3300005459 Bacteria 1296
53 Ga0068867_101023531 3300005459 Bacteria 750
54 Ga0068867_101913824 3300005459 Unclassified 559
55 Ga0068867_102043232 3300005459 Unclassified 542
56 Ga0068867_102050679 3300005459 Unclassified 541
57 Ga0070706_100077359 3300005467 Bacteria 3079
58 Ga0070706_100235524 3300005467 Bacteria 1709
59 Ga0070706_100277672 3300005467 Bacteria 1563
60 Ga0070706_100551961 3300005467 Bacteria 1072
61 Ga0070706_100846291 3300005467 Bacteria 846
62 Ga0070706_100901305 3300005467 Bacteria 817
63 Ga0070706_101079647 3300005467 Unclassified 739
64 Ga0070706_101180940 3300005467 Unclassified 703
65 Ga0070706_101325494 3300005467 Unclassified 660
66 Ga0070706_101708982 3300005467 Unclassified 573
67 Ga0070707_100216412 3300005468 Bacteria 1867
68 Ga0070707_100384368 3300005468 Bacteria 1363
69 Ga0070707_100464489 3300005468 Bacteria 1227
70 Ga0070707_100476477 3300005468 Bacteria 1209
71 Ga0070707_101061530 3300005468 Unclassified 776
72 Ga0070707_102004236 3300005468 Unclassified 546
73 Ga0070698_100064014 3300005471 Bacteria 3706
74 Ga0070698_100066654 3300005471 Bacteria 3623
75 Ga0070698_100493006 3300005471 Bacteria 1163
76 Ga0070698_100514386 3300005471 Bacteria 1135
77 Ga0070698_100705952 3300005471 Bacteria 951
78 Ga0070698_100783455 3300005471 Bacteria 897
79 Ga0070698_100952792 3300005471 Unclassified 805
80 Ga0070699_100037696 3300005518 Bacteria 4185
81 Ga0070699_100068699 3300005518 Bacteria 3078
82 Ga0070699_100205295 3300005518 Unclassified 1753
83 Ga0070699_100213840 3300005518 Bacteria 1717
84 Ga0070699_100479443 3300005518 Unclassified 1129
85 Ga0070699_100491408 3300005518 Bacteria 1114
86 Ga0070699_100777346 3300005518 Bacteria 876
87 Ga0070699_100990918 3300005518 Unclassified 770
88 Ga0070699_101259934 3300005518 Unclassified 678
89 Ga0070699_101674002 3300005518 Bacteria 583
90 Ga0070697_100068790 3300005536 Bacteria 2899
91 Ga0070697_100084144 3300005536 Unclassified 2623
92 Ga0070697_100192983 3300005536 Bacteria 1729
93 Ga0070697_100275947 3300005536 Unclassified 1441
94 Ga0070697_100496285 3300005536 Unclassified 1067
95 Ga0070697_100507034 3300005536 Unclassified 1055
96 Ga0070697_100817884 3300005536 Unclassified 825
97 Ga0070697_101005993 3300005536 Bacteria 741
98 Ga0070697_101285256 3300005536 Bacteria 653
99 Ga0068853_100144685 3300005539 Bacteria 2136
100 Ga0070672_101974112 3300005543 Unclassified 525
101 Ga0070686_100108758 3300005544 Bacteria 1885
102 Ga0070686_100265732 3300005544 Bacteria 1259
103 Ga0070686_100338955 3300005544 Bacteria 1126
104 Ga0070686_100859134 3300005544 Bacteria 735
105 Ga0070695_100759528 3300005545 Bacteria 774
106 Ga0070695_100900571 3300005545 Unclassified 714
107 Ga0070696_100942700 3300005546 Bacteria 718
108 Ga0070693_100243247 3300005547 Bacteria 1189
109 Ga0070665_100118721 3300005548 Unclassified 2647
110 Ga0070704_100123971 3300005549 Bacteria 1990
111 Ga0070704_102027909 3300005549 Bacteria 534
112 Ga0068857_100027715 3300005577 Bacteria 4997
113 Ga0068857_100139295 3300005577 Bacteria 2192
114 Ga0068854_100012885 3300005578 Bacteria 5477
115 Ga0068854_100392239 3300005578 Unclassified 1147
116 Ga0068852_101038331 3300005616 Unclassified 839
117 Ga0068859_100189555 3300005617 Bacteria 2140
118 Ga0068859_100722094 3300005617 Unclassified 1086
119 Ga0068859_101023142 3300005617 Bacteria 907
120 Ga0068859_101162720 3300005617 Unclassified 849
121 Ga0068859_101822691 3300005617 Unclassified 672
122 Ga0068864_100718903 3300005618 Bacteria 977
123 Ga0068864_101182898 3300005618 Unclassified 763
124 Ga0068864_101340484 3300005618 Unclassified 716
125 Ga0068866_10059414 3300005718 Bacteria 1978
126 Ga0068870_10093243 3300005840 Bacteria 1688
127 Ga0068863_100941873 3300005841 Bacteria 865
128 Ga0068863_101438255 3300005841 Bacteria 697
129 Ga0068858_100002107 3300005842 Bacteria 20202
130 Ga0068858_100259810 3300005842 Bacteria 1650
131 Ga0068858_100297991 3300005842 Unclassified 1538
132 Ga0068860_100087154 3300005843 Bacteria 2972
133 Ga0068860_102263441 3300005843 Unclassified 564
134 Ga0068862_100003981 3300005844 Bacteria 12539
135 Ga0068862_100342251 3300005844 Bacteria 1385
136 Ga0081455_10030093 3300005937 Bacteria 4939
137 Ga0081455_10050571 3300005937 Unclassified 3573
138 Ga0081539_10111211 3300005985 Unclassified 1378
139 Ga0081539_10158795 3300005985 Unclassified 1080
140 Ga0070717_10000300 3300006028 Bacteria 32563
141 Ga0070717_10270251 3300006028 Bacteria 1506
142 Ga0070717_11759718 3300006028 Unclassified 560
143 Ga0070712_100079059 3300006175 Bacteria 2376
144 Ga0097621_102155995 3300006237 Bacteria 533
145 Ga0075370_10798784 3300006353 Unclassified 575
146 Ga0068871_100106829 3300006358 Bacteria 2350
147 Ga0075428_100027169 3300006844 Bacteria 6336
148 Ga0075428_100057608 3300006844 Unclassified 4253
149 Ga0075428_100393499 3300006844 Bacteria 1485
150 Ga0075428_100946251 3300006844 Unclassified 913
151 Ga0075430_100103171 3300006846 Bacteria 2381
152 Ga0075430_100129236 3300006846 Bacteria 2105
153 Ga0075430_100173206 3300006846 Viruses 1795
154 Ga0075430_100178598 3300006846 Bacteria 1766
155 Ga0075431_100053505 3300006847 Bacteria 4162
156 Ga0075431_100054322 3300006847 Unclassified 4130
157 Ga0075431_100106924 3300006847 Unclassified 2886
158 Ga0075431_100232081 3300006847 Bacteria 1880
159 Ga0075431_100875305 3300006847 Unclassified 869
160 Ga0075431_101112614 3300006847 Bacteria 754
161 Ga0075433_10126631 3300006852 Bacteria 2268
162 Ga0075433_10144037 3300006852 Bacteria 2118
163 Ga0075434_100019694 3300006871 Bacteria 6531
164 Ga0075434_100044299 3300006871 Bacteria 4414
165 Ga0075434_100370438 3300006871 Unclassified 1453
166 Ga0075434_100439895 3300006871 Bacteria 1325
167 Ga0075434_100729086 3300006871 Bacteria 1008
168 Ga0075429_100063731 3300006880 Bacteria 3211
169 Ga0075429_100408776 3300006880 Unclassified 1189
170 Ga0068865_101344297 3300006881 Unclassified 636
171 Ga0075436_100000288 3300006914 Bacteria 31977
172 Ga0075436_100020167 3300006914 Bacteria 4575
173 Ga0075436_100083901 3300006914 Bacteria 2211
174 Ga0075436_100102830 3300006914 Bacteria 1990
175 Ga0075436_100426479 3300006914 Bacteria 963
176 Ga0075436_100474808 3300006914 Bacteria 913
177 Ga0097620_100189554 3300006931 Bacteria 2140
178 Ga0097620_100722176 3300006931 Unclassified 1086
179 Ga0097620_101023154 3300006931 Bacteria 907
180 Ga0097620_101163042 3300006931 Unclassified 849
181 Ga0097620_101822984 3300006931 Unclassified 672
182 Ga0075435_100000070 3300007076 Bacteria 52706
183 Ga0075435_100085912 3300007076 Bacteria 2590
184 Ga0075435_100134799 3300007076 Bacteria 2068
185 Ga0099794_10157550 3300007265 Bacteria 1154
186 Ga0099794_10268707 3300007265 Unclassified 881
187 Ga0111539_10737059 3300009094 Unclassified 1147
188 Ga0105245_10000010 3300009098 Bacteria 278233
189 Ga0105245_10054587 3300009098 Bacteria 3588
190 Ga0105247_10015418 3300009101 Bacteria 4578
191 Ga0114129_10010995 3300009147 Bacteria 12896
192 Ga0114129_10039691 3300009147 Bacteria 6638
193 Ga0114129_10076641 3300009147 Bacteria 4654
194 Ga0114129_10089720 3300009147 Unclassified 4261
195 Ga0114129_10237139 3300009147 Bacteria 2454
196 Ga0114129_10259933 3300009147 Bacteria 2327
197 Ga0114129_10343121 3300009147 Bacteria 1980
198 Ga0114129_10658732 3300009147 Bacteria 1350
199 Ga0114129_11103249 3300009147 Unclassified 993
200 Ga0114129_11930863 3300009147 Unclassified 715
201 Ga0105241_10449179 3300009174 Bacteria 1140
202 Ga0105248_10073923 3300009177 Bacteria 3831
203 Ga0105248_11547801 3300009177 Unclassified 751
204 Ga0105248_11712900 3300009177 Bacteria 713
205 Ga0105237_11130304 3300009545 Bacteria 790
206 Ga0105249_10039226 3300009553 Unclassified 4300
207 Ga0105249_10751585 3300009553 Bacteria 1037
208 Ga0105249_10852271 3300009553 Unclassified 977
209 Ga0105239_11910956 3300010375 Unclassified 688
210 Ga0105246_10553213 3300011119 Bacteria 986
211 Ga0157371_11250151 3300013102 Bacteria 573
212 Ga0157374_10000012 3300013296 Bacteria 462353
213 Ga0157374_10380826 3300013296 Bacteria 1405
214 Ga0157378_10069189 3300013297 Bacteria 3166
215 Ga0157378_10428642 3300013297 Bacteria 1308
216 Ga0157378_12836667 3300013297 Unclassified 537
217 Ga0163162_10239323 3300013306 Bacteria 1946
218 Ga0157372_10630557 3300013307 Bacteria 1249
219 Ga0157375_10001182 3300013308 Bacteria 22544
220 Ga0157375_11834713 3300013308 Bacteria 719
221 Ga0163163_12813735 3300014325 Bacteria 543
222 Ga0157380_10026352 3300014326 Unclassified 4414
223 Ga0157380_10249607 3300014326 Bacteria 1605
224 Ga0157380_10396234 3300014326 Bacteria 1308
225 Ga0157380_11150482 3300014326 Unclassified 817
226 Ga0157380_12114758 3300014326 Unclassified 626
227 Ga0157377_10000002 3300014745 Bacteria 473827
228 Ga0157377_10005848 3300014745 Bacteria 5817
229 Ga0157379_10093850 3300014968 Bacteria 2692
230 Ga0157379_10176224 3300014968 Bacteria 1931
231 Ga0157379_10416768 3300014968 Bacteria 1236
232 Ga0157379_12450428 3300014968 Unclassified 521
233 Ga0157376_10233988 3300014969 Bacteria 1708
234 Ga0213873_10146223 3300021358 Bacteria 709
235 Ga0213876_10320411 3300021384 Unclassified 824
236 Ga0207682_10032960 3300025893 Unclassified 2083
237 Ga0207688_10090384 3300025901 Bacteria 1757
238 Ga0207699_10762544 3300025906 Unclassified 710
239 Ga0207643_10250322 3300025908 Bacteria 1091
240 Ga0207705_10047163 3300025909 Bacteria 3098
241 Ga0207705_10113590 3300025909 Bacteria 2003
242 Ga0207705_11066123 3300025909 Bacteria 623
243 Ga0207684_10066662 3300025910 Unclassified 3058
244 Ga0207684_10242774 3300025910 Bacteria 1554
245 Ga0207684_10423364 3300025910 Bacteria 1144
246 Ga0207684_10598181 3300025910 Unclassified 942
247 Ga0207684_10620730 3300025910 Bacteria 922
248 Ga0207684_10674898 3300025910 Bacteria 879
249 Ga0207684_10858707 3300025910 Unclassified 765
250 Ga0207684_10995409 3300025910 Unclassified 702
251 Ga0207684_11118088 3300025910 Bacteria 655
252 Ga0207684_11359985 3300025910 Unclassified 583
253 Ga0207654_10357827 3300025911 Bacteria 1006
254 Ga0207649_11302621 3300025920 Bacteria 575
255 Ga0207652_10524339 3300025921 Bacteria 1066
256 Ga0207646_10187096 3300025922 Unclassified 1870
257 Ga0207646_10211008 3300025922 Bacteria 1754
258 Ga0207646_10964881 3300025922 Unclassified 754
259 Ga0207681_10120216 3300025923 Bacteria 1925
260 Ga0207650_10000173 3300025925 Bacteria 76023
261 Ga0207650_10241352 3300025925 Bacteria 1460
262 Ga0207659_10001456 3300025926 Bacteria 14141
263 Ga0207659_10038184 3300025926 Unclassified 3338
264 Ga0207687_10000005 3300025927 Bacteria 770649
265 Ga0207687_10017869 3300025927 Bacteria 4679
266 Ga0207700_10012181 3300025928 Bacteria 5532
267 Ga0207700_10131064 3300025928 Bacteria 2047
268 Ga0207644_10000055 3300025931 Bacteria 84281
269 Ga0207670_10000940 3300025936 Bacteria 15346
270 Ga0207670_10204242 3300025936 Bacteria 1503
271 Ga0207670_11164163 3300025936 Unclassified 652
272 Ga0207669_10608583 3300025937 Unclassified 889
273 Ga0207665_10067933 3300025939 Unclassified 2428
274 Ga0207691_10037984 3300025940 Unclassified 4457
275 Ga0207691_10102015 3300025940 Bacteria 2560
276 Ga0207711_10284581 3300025941 Bacteria 1523
277 Ga0207689_10063420 3300025942 Bacteria 3040
278 Ga0207661_11285935 3300025944 Unclassified 672
279 Ga0207679_11700133 3300025945 Unclassified 577
280 Ga0207651_10342570 3300025960 Unclassified 1256
281 Ga0207651_10812491 3300025960 Unclassified 829
282 Ga0207712_10307758 3300025961 Bacteria 1303
283 Ga0207712_10418346 3300025961 Bacteria 1130
284 Ga0207712_10501578 3300025961 Bacteria 1038
285 Ga0207712_10570232 3300025961 Unclassified 976
286 Ga0207712_11342408 3300025961 Unclassified 639
287 Ga0207668_10167975 3300025972 Bacteria 1718
288 Ga0207668_10724043 3300025972 Unclassified 876
289 Ga0207668_11053193 3300025972 Unclassified 728
290 Ga0207640_10114854 3300025981 Bacteria 1916
291 Ga0207658_10424562 3300025986 Bacteria 1173
292 Ga0207658_10496305 3300025986 Unclassified 1087
293 Ga0207677_11354611 3300026023 Bacteria 655
294 Ga0207703_10001621 3300026035 Bacteria 20273
295 Ga0207703_10366129 3300026035 Bacteria 1330
296 Ga0207708_10563735 3300026075 Unclassified 962
297 Ga0207708_10577595 3300026075 Unclassified 950
298 Ga0207641_10196383 3300026088 Unclassified 1858
299 Ga0207641_11580424 3300026088 Bacteria 658
300 Ga0207648_10175231 3300026089 Bacteria 1896
301 Ga0207648_10498318 3300026089 Bacteria 1114
302 Ga0207648_11100827 3300026089 Unclassified 745
303 Ga0207676_11707549 3300026095 Unclassified 628
304 Ga0207676_12452833 3300026095 Unclassified 518
305 Ga0207674_10061476 3300026116 Bacteria 3795
306 Ga0207674_10153494 3300026116 Bacteria 2259
307 Ga0207675_101511349 3300026118 Unclassified 692
308 Ga0207683_12154137 3300026121 Bacteria 506
309 Ga0209966_1032141 3300027695 Unclassified 1067
310 Ga0207428_10276336 3300027907 Bacteria 1248
311 Ga0207428_10378387 3300027907 Bacteria 1039
312 Ga0268265_10007416 3300028380 Bacteria 7410
313 Ga0268265_11061775 3300028380 Unclassified 802
314 Ga0268264_10066081 3300028381 Bacteria 3049
315 Ga0268264_10354319 3300028381 Bacteria 1398
316 Ga0265337_1006131 3300028556 Bacteria 4680
317 Ga0265326_10006056 3300028558 Bacteria 3782
318 Ga0265334_10016762 3300028573 Bacteria 3030
319 Ga0265334_10088683 3300028573 Unclassified 1131
320 Ga0265318_10023317 3300028577 Bacteria 2467
321 Ga0265318_10124220 3300028577 Bacteria 949
322 Ga0265323_10004342 3300028653 Bacteria 6114
323 Ga0265323_10016893 3300028653 Bacteria 2842
324 Ga0265323_10167981 3300028653 Unclassified 698
325 Ga0265322_10010107 3300028654 Bacteria 2737
326 Ga0265322_10028218 3300028654 Unclassified 1604
327 Ga0265338_10011501 3300028800 Bacteria 10215
328 Ga0265338_10047033 3300028800 Bacteria 3945
329 Ga0265338_10052234 3300028800 Bacteria 3670
330 Ga0265338_10091681 3300028800 Bacteria 2509
331 Ga0265338_10540037 3300028800 Bacteria 817
332 Ga0307511_10061266 3300030521 Unclassified 2869
333 Ga0265330_10002756 3300031235 Bacteria 9443
334 Ga0265330_10053443 3300031235 Bacteria 1767
335 Ga0265320_10020489 3300031240 Bacteria 3584
336 Ga0265320_10027507 3300031240 Bacteria 2963
337 Ga0265320_10467772 3300031240 Unclassified 557
338 Ga0265329_10001041 3300031242 Bacteria 13751
339 Ga0265340_10082757 3300031247 Bacteria 1509
340 Ga0265316_10000080 3300031344 Bacteria 100625
341 Ga0265316_10000331 3300031344 Bacteria 52879
342 Ga0265316_10005706 3300031344 Bacteria 12029
343 Ga0265316_10023689 3300031344 Bacteria 5154
344 Ga0265316_10031838 3300031344 Bacteria 4309
345 Ga0265316_10063134 3300031344 Bacteria 2873
346 Ga0265316_10079552 3300031344 Bacteria 2515
347 Ga0265316_10174890 3300031344 Unclassified 1600
348 Ga0265316_10277005 3300031344 Bacteria 1226
349 Ga0307408_101607377 3300031548 Bacteria 617
350 Ga0265313_10106640 3300031595 Unclassified 1237
351 Ga0265313_10183080 3300031595 Bacteria 879
352 Ga0316575_10083681 3300031665 Unclassified 1288
353 Ga0316579_10236580 3300031691 Unclassified 883
354 Ga0265314_10158442 3300031711 Bacteria 1380
355 Ga0265314_10248480 3300031711 Unclassified 1022
356 Ga0265314_10454010 3300031711 Unclassified 682
357 Ga0265314_10461798 3300031711 Bacteria 675
358 Ga0265342_10001972 3300031712 Bacteria 18333
359 Ga0265342_10006620 3300031712 Bacteria 8601
360 Ga0265342_10404083 3300031712 Unclassified 705
361 Ga0265342_10578369 3300031712 Unclassified 568
362 Ga0316576_10000867 3300031727 Bacteria 15338
363 Ga0316576_10011972 3300031727 Bacteria 5709
364 Ga0316576_10064829 3300031727 Bacteria 2683
365 Ga0316576_10084637 3300031727 Unclassified 2357
366 Ga0316576_10126300 3300031727 Bacteria 1922
367 Ga0316578_10001095 3300031728 Bacteria 10529
368 Ga0316578_10094777 3300031728 Bacteria 1785
369 Ga0316578_10225431 3300031728 Unclassified 1126
370 Ga0316578_10291881 3300031728 Unclassified 976
371 Ga0316578_10912248 3300031728 Bacteria 507
372 Ga0316577_10010207 3300031733 Bacteria 5064
373 Ga0316577_10015563 3300031733 Bacteria 4185
374 Ga0316577_10018956 3300031733 Unclassified 3807
375 Ga0316577_10048518 3300031733 Bacteria 2371
376 Ga0316577_10103423 3300031733 Bacteria 1597
377 Ga0316577_10562668 3300031733 Unclassified 648
378 Ga0316577_10798053 3300031733 Bacteria 536
379 Ga0316577_10805213 3300031733 Unclassified 533
380 Ga0307416_100439104 3300032002 Unclassified 1355
381 Ga0307411_10235814 3300032005 Unclassified 1429
382 Ga0316583_10060759 3300032133 Unclassified 1324
383 Ga0316583_10063067 3300032133 Bacteria 1298
384 Ga0316583_10121205 3300032133 Unclassified 911
385 Ga0316585_10034113 3300032137 Unclassified 1607
386 Ga0316585_10061865 3300032137 Unclassified 1210
387 Ga0316580_10015466 3300032139 Unclassified 2334
388 Ga0316592_1099540 3300033524 Unclassified 668
389 Ga0316588_1097030 3300033528 Unclassified 737
390 Ga0316587_1042176 3300033529 Bacteria 826
391 Ga0373941_0009362 3300035115 Bacteria 2465
392 Ga0373953_0336098 3300035117 Bacteria 661
393 Ga0373955_0368586 3300035172 Unclassified 871
394 Ga0316574_0017761 3300035398 Bacteria 4170
395 Ga0316574_0063504 3300035398 Unclassified 2322
396 Ga0316574_0108659 3300035398 Bacteria 1777
397 Ga0316574_0687503 3300035398 Unclassified 628
398 Ga0373933_0142690 3300035724 Bacteria 1513
399 Ga0373937_0306821 3300036401 Bacteria 1501
400 Ga0265778_046555 3300036457 Unclassified 587
401 Ga0316582_0055036 3300036647 Bacteria 2535
402 Ga0316582_0062437 3300036647 Unclassified 2392
403 Ga0316582_0227440 3300036647 Unclassified 1276
404 Ga0316582_0412161 3300036647 Unclassified 931
405 Ga0316582_0492694 3300036647 Unclassified 845
406 Ga0316582_0496626 3300036647 Bacteria 841
407 Ga0316584_0000084 3300036712 Bacteria 37166
408 Ga0316584_0013613 3300036712 Bacteria 5764
409 Ga0316584_0137302 3300036712 Unclassified 1824
410 Ga0316584_0155344 3300036712 Bacteria 1701
411 Ga0316584_0376890 3300036712 Bacteria 1015
412 Ga0316584_0626660 3300036712 Unclassified 743
413 Ga0395899_0200587 3300037312 Bacteria 1391
414 Ga0395900_0108842 3300037418 Bacteria 2847
415 Ga0395898_0790563 3300037466 Bacteria 889
416 Ga0395905_0206609 3300037471 Bacteria 1840
417 Ga0436364_0333747 3300037853 Unclassified 995
418 Ga0395901_0086040 3300038443 Bacteria 3287
419 Ga0395901_1534913 3300038443 Bacteria 621
420 Ga0400489_95740 3300039093 Bacteria 2277
421 Ga0400487_36034 3300039110 Bacteria 1071
422 Ga0436365_1846846 3300039437 Unclassified 824
423 Ga0436363_0320031 3300039450 Bacteria 953
424 Ga0436362_0155917 3300039453 Bacteria 2820
425 Ga0436362_0206005 3300039453 Unclassified 636
426 Ga0436362_0280990 3300039453 Bacteria 597
427 Ga0439439_0039200 3300041406 Bacteria 1224
428 Ga0451839_0352286 3300041496 Bacteria 3424
429 Ga0439450_045003 3300042008 Bacteria 1035
430 Ga0439462_0041043 3300042015 Bacteria 1235
431 Ga0450922_016057 3300042124 Bacteria 748
432 Ga0451577_0000016 3300042876 Bacteria 531002
433 Ga0451577_0024815 3300042876 Bacteria 5448
434 Ga0451577_0051017 3300042876 Bacteria 3693
435 Ga0451577_0291688 3300042876 Bacteria 1478
436 Ga0451577_0589719 3300042876 Bacteria 1009
437 Ga0451577_0713191 3300042876 Unclassified 908
438 Ga0453683_0025324 3300044673 Bacteria 3771
439 Ga0453683_0056775 3300044673 Bacteria 2450
440 Ga0453683_0432789 3300044673 Bacteria 850
441 Ga0453684_0001369 3300044712 Bacteria 70779
442 Ga0453684_0005810 3300044712 Bacteria 24042
443 Ga0453684_0006387 3300044712 Bacteria 22454
444 Ga0453684_0045157 3300044712 Bacteria 5881
445 Ga0453684_0045549 3300044712 Bacteria 5849
446 Ga0453684_0254845 3300044712 Bacteria 2013
447 Ga0453684_0345690 3300044712 Unclassified 1678
448 Ga0453684_0429645 3300044712 Bacteria 1474
449 Ga0453684_0496760 3300044712 Bacteria 1351
450 Ga0453684_0566474 3300044712 Bacteria 1249
451 Ga0453684_1025709 3300044712 Bacteria 876
452 Ga0451576_1034323 3300045051 Unclassified 860
453 Ga0466967_0817043 3300045976 Bacteria 926
454 Ga0495603_0092679 3300046455 Bacteria 1766
455 Ga0495644_0203528 3300046523 Bacteria 763
456 Ga0495667_0660580 3300046559 Unclassified 649
457 Ga0495613_0230207 3300046689 Bacteria 1299
458 Ga0495600_0454383 3300046809 Bacteria 792
459 Ga0495636_0189165 3300047318 Bacteria 937
460 Ga0495679_168828 3300047446 Unclassified 582
461 Ga0496104_1267033 3300048907 Unclassified 640
462 Ga0496105_0792892 3300048908 Bacteria 721
463 Ga0501309_015053 3300049129 Unclassified 1043
464 Ga0501292_046297 3300049515 Unclassified 762
465 Ga0501031_0384874 3300049568 Unclassified 907
466 Ga0501033_0622276 3300049570 Unclassified 739
467 Ga0501033_0694970 3300049570 Unclassified 692
468 Ga0501033_1075162 3300049570 Bacteria 536
469 Ga0501034_0637116 3300049571 Bacteria 969
470 Ga0501036_0008199 3300049572 Bacteria 8564
471 Ga0501036_0018184 3300049572 Bacteria 5886
472 Ga0501036_0084372 3300049572 Bacteria 2685
473 Ga0501036_0169349 3300049572 Bacteria 1840
474 Ga0501036_0633819 3300049572 Unclassified 885
475 Ga0501036_1165633 3300049572 Unclassified 628
476 Ga0501037_0000466 3300049573 Bacteria 32979
477 Ga0501037_0052676 3300049573 Bacteria 2976
478 Ga0501037_0242398 3300049573 Bacteria 1263
479 Ga0501037_0504402 3300049573 Unclassified 820
480 Ga0501038_0009683 3300049574 Bacteria 8838
481 Ga0501038_0012925 3300049574 Bacteria 7615
482 Ga0501038_0326646 3300049574 Bacteria 1199
483 Ga0501039_0021625 3300049575 Bacteria 4935
484 Ga0501039_0041162 3300049575 Bacteria 3568
485 Ga0501039_0066404 3300049575 Bacteria 2800
486 Ga0501039_0098294 3300049575 Bacteria 2283
487 Ga0501039_0140500 3300049575 Unclassified 1897
488 Ga0501039_0397145 3300049575 Unclassified 1083
489 Ga0501039_0521899 3300049575 Unclassified 932
490 Ga0501039_0590985 3300049575 Bacteria 870
491 Ga0501039_0901790 3300049575 Unclassified 688
492 Ga0501040_0004372 3300049576 Bacteria 9184
493 Ga0501040_0072672 3300049576 Bacteria 2376
494 Ga0501040_0695052 3300049576 Unclassified 735
495 Ga0501040_0818733 3300049576 Bacteria 674
496 Ga0501040_1079441 3300049576 Bacteria 582
497 Ga0501041_0003857 3300049577 Bacteria 8623
498 Ga0501041_0023943 3300049577 Bacteria 3663
499 Ga0501041_0317616 3300049577 Unclassified 982
500 Ga0501042_0018208 3300049578 Bacteria 4860
501 Ga0501042_0341651 3300049578 Unclassified 1082
502 Ga0501043_0056112 3300049579 Bacteria 3094
503 Ga0501043_0056837 3300049579 Bacteria 3073
504 Ga0501043_0061435 3300049579 Bacteria 2951
505 Ga0501043_0716773 3300049579 Unclassified 729
506 Ga0501046_0007391 3300049580 Bacteria 9657
507 Ga0501046_0026673 3300049580 Bacteria 4719
508 Ga0501046_0262925 3300049580 Bacteria 1267
509 Ga0501046_0503205 3300049580 Unclassified 867
510 Ga0501046_0633651 3300049580 Unclassified 757
511 Ga0501046_1052271 3300049580 Unclassified 563
512 Ga0501047_0008876 3300049581 Bacteria 9483
513 Ga0501047_0546742 3300049581 Unclassified 983
514 Ga0501047_0787937 3300049581 Unclassified 766
515 Ga0501048_0266875 3300049582 Unclassified 1216
516 Ga0501048_0272717 3300049582 Unclassified 1202
517 Ga0501048_1238035 3300049582 Unclassified 537
518 Ga0501068_0008785 3300049584 Bacteria 5636
519 Ga0501068_0052062 3300049584 Bacteria 2478
520 Ga0501068_0378453 3300049584 Unclassified 911
521 Ga0501068_0550409 3300049584 Unclassified 750
522 Ga0501068_0743886 3300049584 Unclassified 642
523 Ga0501068_0783868 3300049584 Unclassified 625
524 Ga0501070_0013809 3300049586 Bacteria 6804
525 Ga0501070_0827308 3300049586 Unclassified 726
526 Ga0501071_0097010 3300049587 Unclassified 2170
527 Ga0501071_0523234 3300049587 Bacteria 910
528 Ga0501071_0683299 3300049587 Bacteria 790
529 Ga0501072_0010648 3300049588 Bacteria 7005
530 Ga0501072_0064948 3300049588 Unclassified 2878
531 Ga0501072_0453166 3300049588 Bacteria 1016
532 Ga0501072_0579141 3300049588 Unclassified 885
533 Ga0501072_0841615 3300049588 Unclassified 717
534 Ga0501072_1145905 3300049588 Bacteria 605
535 Ga0501074_0323796 3300049590 Unclassified 1094
536 Ga0501074_0459326 3300049590 Unclassified 903
537 Ga0501074_0847817 3300049590 Unclassified 644
538 Ga0501075_0003541 3300049591 Bacteria 10449
539 Ga0501075_0184216 3300049591 Bacteria 1593
540 Ga0501075_0208040 3300049591 Bacteria 1492
541 Ga0501075_0279367 3300049591 Bacteria 1272
542 Ga0501075_0344564 3300049591 Bacteria 1135
543 Ga0501075_0616570 3300049591 Unclassified 827
544 Ga0501076_0000714 3300049592 Bacteria 21429
545 Ga0501076_0138327 3300049592 Bacteria 1978
546 Ga0501076_0207600 3300049592 Unclassified 1600
547 Ga0501076_0402925 3300049592 Bacteria 1125
548 Ga0501076_1251389 3300049592 Unclassified 611
549 Ga0501076_1294235 3300049592 Unclassified 599
550 Ga0501076_1370295 3300049592 Unclassified 581
551 Ga0501077_0073791 3300049593 Bacteria 2161
552 Ga0501077_0083206 3300049593 Bacteria 2028
553 Ga0501077_0157328 3300049593 Bacteria 1442
554 Ga0501079_0053420 3300049741 Unclassified 3117
555 Ga0501079_0269192 3300049741 Bacteria 1332
556 Ga0501079_0319575 3300049741 Unclassified 1215
557 Ga0501079_1077723 3300049741 Unclassified 633
558 Ga0501080_0039225 3300049742 Bacteria 4420
559 Ga0501080_0063949 3300049742 Bacteria 3424
560 Ga0501081_0000733 3300049743 Bacteria 19116
561 Ga0501081_0194748 3300049743 Bacteria 1468
562 Ga0501081_0542400 3300049743 Unclassified 868
563 Ga0501081_0751967 3300049743 Unclassified 733
564 Ga0501081_0972087 3300049743 Unclassified 641
565 Ga0501083_0236159 3300049744 Bacteria 1190
566 Ga0501035_0046876 3300049822 Bacteria 3885
567 Ga0501035_0049378 3300049822 Bacteria 3771
568 Ga0501035_0061095 3300049822 Bacteria 3354
569 Ga0501044_0000786 3300049823 Bacteria 38328
570 Ga0501044_0096870 3300049823 Bacteria 2971
571 Ga0501044_0682182 3300049823 Bacteria 914
572 Ga0501044_0923300 3300049823 Bacteria 747
573 Ga0501044_1266735 3300049823 Bacteria 604
574 Ga0501045_0005082 3300049824 Bacteria 9105
575 Ga0501045_0037078 3300049824 Unclassified 3543
576 Ga0501045_0633042 3300049824 Unclassified 791
577 Ga0501045_0992226 3300049824 Bacteria 616
578 Ga0501045_1068240 3300049824 Bacteria 591
579 Ga0501045_1142989 3300049824 Bacteria 569
580 nmdc:mga07m45_715852_c1 3300050496 Unclassified 575
581 nmdc:mga05p37_11027_c1 3300050507 Bacteria 10736
582 nmdc:mga05p37_182740_c1 3300050507 Unclassified 2551
583 nmdc:mga05p37_1830_c1 3300050507 Bacteria 24802
584 nmdc:mga05p37_444413_c1 3300050507 Bacteria 1503
585 nmdc:mga05p37_44918_c1 3300050507 Bacteria 5435
586 nmdc:mga05p37_560974_c1 3300050507 Unclassified 1298
587 nmdc:mga05p37_632365_c1 3300050507 Unclassified 1202
588 nmdc:mga05p37_85206_c1 3300050507 Bacteria 3894
589 nmdc:mga09592_46322_c1 3300050508 Unclassified 3664
590 nmdc:mga09592_480242_c1 3300050508 Unclassified 1071
591 nmdc:mga09592_886975_c1 3300050508 Bacteria 750
592 nmdc:mga0qj67_131378_c1 3300050509 Bacteria 2028
593 nmdc:mga0qj67_193363_c1 3300050509 Bacteria 1653
594 nmdc:mga0qj67_84326_c1 3300050509 Unclassified 2548
595 nmdc:mga0qj67_973528_c1 3300050509 Bacteria 666
596 nmdc:mga06r32_1660114_c1 3300050510 Viruses 577
597 nmdc:mga06r32_212721_c1 3300050510 Bacteria 1921
598 nmdc:mga06r32_253940_c1 3300050510 Bacteria 1746
599 nmdc:mga06r32_43279_c1 3300050510 Bacteria 4285
600 nmdc:mga06r32_950706_c1 3300050510 Bacteria 814
601 nmdc:mga08y16_1074897_c1 3300050511 Unclassified 781
602 nmdc:mga08y16_2023849_c1 3300050511 Bacteria 525
603 nmdc:mga08y16_98616_c1 3300050511 Bacteria 3043
604 nmdc:mga0n895_169003_c1 3300050512 Bacteria 2219
605 nmdc:mga0n895_286807_c1 3300050512 Unclassified 1669
606 nmdc:mga0n895_520212_c1 3300050512 Bacteria 1197
607 nmdc:mga0n895_601562_c1 3300050512 Bacteria 1102
608 nmdc:mga0n895_895802_c1 3300050512 Bacteria 873
609 nmdc:mga0n895_995062_c1 3300050512 Unclassified 820
610 nmdc:mga0rr50_18109_c1 3300050513 Bacteria 4724
611 nmdc:mga0rr50_235385_c1 3300050513 Bacteria 1516
612 nmdc:mga0rr50_38438_c1 3300050513 Bacteria 3463
613 nmdc:mga0rr50_84_c1 3300050513 Bacteria 52823
614 nmdc:mga08x19_11_c1 3300050514 Bacteria 403007
615 nmdc:mga08x19_137540_c1 3300050514 Bacteria 1648
616 nmdc:mga08x19_173952_c1 3300050514 Bacteria 1467
617 nmdc:mga08x19_2411_c1 3300050514 Bacteria 11341
618 nmdc:mga08x19_290746_c1 3300050514 Bacteria 1133
619 nmdc:mga08x19_309370_c1 3300050514 Bacteria 1098
620 nmdc:mga0a205_158146_c1 3300050515 Unclassified 2164
621 nmdc:mga0a205_205273_c1 3300050515 Bacteria 1860
622 nmdc:mga0a205_267941_c1 3300050515 Bacteria 1585
623 nmdc:mga0a205_3245_c2 3300050515 Bacteria 12133
624 nmdc:mga0a205_6784_c1 3300050515 Bacteria 10355
625 Ga0495619_0742941 3300053085 Bacteria 666
626 Ga0500555_023563 3300053103 Bacteria 1765
627 Ga0500577_0000806 3300053142 Bacteria 8075
628 Ga0501084_0001969 3300054114 Bacteria 16397
629 Ga0501084_0049260 3300054114 Unclassified 3527
630 Ga0501084_0231946 3300054114 Unclassified 1558
631 Ga0501084_0414450 3300054114 Bacteria 1139
632 Ga0501084_0463266 3300054114 Bacteria 1072
633 Ga0501084_0998042 3300054114 Unclassified 703
634 Ga0501084_1449332 3300054114 Bacteria 575
635 Ga0501084_1504948 3300054114 Unclassified 563
636 Ga0587070_211620 3300059491 Bacteria 521
637 Ga0501082_0004700 3300060353 Bacteria 11907
638 Ga0501082_0216450 3300060353 Bacteria 1666
639 Ga0501082_0443163 3300060353 Bacteria 1134
640 Ga0501082_1217821 3300060353 Bacteria 658
641 Ga0501082_1695145 3300060353 Unclassified 551
642 Ga0530510_0001111 3300061734 Bacteria 17863
643 Ga0530510_0006654 3300061734 Bacteria 8061
644 Ga0530510_0053809 3300061734 Bacteria 2908
645 Ga0530510_0085438 3300061734 Bacteria 2299
646 Ga0530510_0103764 3300061734 Bacteria 2079
647 Ga0530510_0154966 3300061734 Unclassified 1693
648 Ga0530510_0268512 3300061734 Bacteria 1273
649 Ga0530510_1236907 3300061734 Unclassified 572
650 Ga0163162_10911917
651 MRS1b_contig_5170368
652 MBSR1b_contig_13570300
653 MBSR1b_contig_6330342
654 Ga0058862_11096336
655 Ga0065714_10064422
656 Ga0065712_10067728
657 Ga0065715_10327425
658 Ga0065707_10128050
659 Ga0070658_10266236
660 Ga0070690_100020180
661 Ga0070670_100375613
662 Ga0070677_10011843
663 Ga0070682_101340836
664 Ga0070689_100002792
665 Ga0070689_100255388
666 Ga0070689_101567391
667 Ga0070661_100489151
668 Ga0070661_101817158
669 Ga0070692_10750846
670 Ga0070668_100806044
671 Ga0070668_101072735
672 Ga0070669_100030553
673 Ga0070669_100900906
674 Ga0070675_100000115
675 Ga0070671_100000047
676 Ga0070674_100027215
677 Ga0070674_100586189
678 Ga0070673_100011261
679 Ga0070673_100296337
680 Ga0070688_100293595
681 Ga0070688_101322000
682 Ga0070667_100225333
683 Ga0070709_10290905
684 Ga0070713_100043854
685 Ga0070713_100109680
686 Ga0070701_11018244
687 Ga0070700_100339851
688 Ga0070700_100376788
689 Ga0070700_100732409
690 Ga0070694_100795809
691 Ga0070708_100106008
692 Ga0070708_100214996
693 Ga0070708_100366590
694 Ga0070708_100529416
695 Ga0070708_100654729
696 Ga0070708_101370927
697 Ga0070678_101388801
698 Ga0070662_101219942
699 Ga0070681_11130899
700 Ga0068867_100173799
701 Ga0068867_100314034
702 Ga0068867_101023531
703 Ga0068867_101913824
704 Ga0068867_102043232
705 Ga0068867_102050679
706 Ga0070706_100077359
707 Ga0070706_100235524
708 Ga0070706_100277672
709 Ga0070706_100551961
710 Ga0070706_100846291
711 Ga0070706_100901305
712 Ga0070706_101079647
713 Ga0070706_101180940
714 Ga0070706_101325494
715 Ga0070706_101708982
716 Ga0070707_100216412
717 Ga0070707_100384368
718 Ga0070707_100464489
719 Ga0070707_100476477
720 Ga0070707_101061530
721 Ga0070707_102004236
722 Ga0070698_100064014
723 Ga0070698_100066654
724 Ga0070698_100493006
725 Ga0070698_100514386
726 Ga0070698_100705952
727 Ga0070698_100783455
728 Ga0070698_100952792
729 Ga0070699_100037696
730 Ga0070699_100068699
731 Ga0070699_100205295
732 Ga0070699_100213840
733 Ga0070699_100479443
734 Ga0070699_100491408
735 Ga0070699_100777346
736 Ga0070699_100990918
737 Ga0070699_101259934
738 Ga0070699_101674002
739 Ga0070697_100068790
740 Ga0070697_100084144
741 Ga0070697_100192983
742 Ga0070697_100275947
743 Ga0070697_100496285
744 Ga0070697_100507034
745 Ga0070697_100817884
746 Ga0070697_101005993
747 Ga0070697_101285256
748 Ga0068853_100144685
749 Ga0070672_101974112
750 Ga0070686_100108758
751 Ga0070686_100265732
752 Ga0070686_100338955
753 Ga0070686_100859134
754 Ga0070695_100759528
755 Ga0070695_100900571
756 Ga0070696_100942700
757 Ga0070693_100243247
758 Ga0070665_100118721
759 Ga0070704_100123971
760 Ga0070704_102027909
761 Ga0068857_100027715
762 Ga0068857_100139295
763 Ga0068854_100012885
764 Ga0068854_100392239
765 Ga0068852_101038331
766 Ga0068859_100189555
767 Ga0068859_100722094
768 Ga0068859_101023142
769 Ga0068859_101162720
770 Ga0068859_101822691
771 Ga0068864_100718903
772 Ga0068864_101182898
773 Ga0068864_101340484
774 Ga0068866_10059414
775 Ga0068870_10093243
776 Ga0068863_100941873
777 Ga0068863_101438255
778 Ga0068858_100002107
779 Ga0068858_100259810
780 Ga0068858_100297991
781 Ga0068860_100087154
782 Ga0068860_102263441
783 Ga0068862_100003981
784 Ga0068862_100342251
785 Ga0081455_10030093
786 Ga0081455_10050571
787 Ga0081539_10111211
788 Ga0081539_10158795
789 Ga0070717_10000300
790 Ga0070717_10270251
791 Ga0070717_11759718
792 Ga0070712_100079059
793 Ga0097621_102155995
794 Ga0075370_10798784
795 Ga0068871_100106829
796 Ga0075428_100027169
797 Ga0075428_100057608
798 Ga0075428_100393499
799 Ga0075428_100946251
800 Ga0075430_100103171
801 Ga0075430_100129236
802 Ga0075430_100173206
803 Ga0075430_100178598
804 Ga0075431_100053505
805 Ga0075431_100054322
806 Ga0075431_100106924
807 Ga0075431_100232081
808 Ga0075431_100875305
809 Ga0075431_101112614
810 Ga0075433_10126631
811 Ga0075433_10144037
812 Ga0075434_100019694
813 Ga0075434_100044299
814 Ga0075434_100370438
815 Ga0075434_100439895
816 Ga0075434_100729086
817 Ga0075429_100063731
818 Ga0075429_100408776
819 Ga0068865_101344297
820 Ga0075436_100000288
821 Ga0075436_100020167
822 Ga0075436_100083901
823 Ga0075436_100102830
824 Ga0075436_100426479
825 Ga0075436_100474808
826 Ga0097620_100189554
827 Ga0097620_100722176
828 Ga0097620_101023154
829 Ga0097620_101163042
830 Ga0097620_101822984
831 Ga0075435_100000070
832 Ga0075435_100085912
833 Ga0075435_100134799
834 Ga0099794_10157550
835 Ga0099794_10268707
836 Ga0111539_10737059
837 Ga0105245_10000010
838 Ga0105245_10054587
839 Ga0105247_10015418
840 Ga0114129_10010995
841 Ga0114129_10039691
842 Ga0114129_10076641
843 Ga0114129_10089720
844 Ga0114129_10237139
845 Ga0114129_10259933
846 Ga0114129_10343121
847 Ga0114129_10658732
848 Ga0114129_11103249
849 Ga0114129_11930863
850 Ga0105241_10449179
851 Ga0105248_10073923
852 Ga0105248_11547801
853 Ga0105248_11712900
854 Ga0105237_11130304
855 Ga0105249_10039226
856 Ga0105249_10751585
857 Ga0105249_10852271
858 Ga0105239_11910956
859 Ga0105246_10553213
860 Ga0157371_11250151
861 Ga0157374_10000012
862 Ga0157374_10380826
863 Ga0157378_10069189
864 Ga0157378_10428642
865 Ga0157378_12836667
866 Ga0163162_10239323
867 Ga0157372_10630557
868 Ga0157375_10001182
869 Ga0157375_11834713
870 Ga0163163_12813735
871 Ga0157380_10026352
872 Ga0157380_10249607
873 Ga0157380_10396234
874 Ga0157380_11150482
875 Ga0157380_12114758
876 Ga0157377_10000002
877 Ga0157377_10005848
878 Ga0157379_10093850
879 Ga0157379_10176224
880 Ga0157379_10416768
881 Ga0157379_12450428
882 Ga0157376_10233988
883 Ga0213873_10146223
884 Ga0213876_10320411
885 Ga0207682_10032960
886 Ga0207688_10090384
887 Ga0207699_10762544
888 Ga0207643_10250322
889 Ga0207705_10047163
890 Ga0207705_10113590
891 Ga0207705_11066123
892 Ga0207684_10066662
893 Ga0207684_10242774
894 Ga0207684_10423364
895 Ga0207684_10598181
896 Ga0207684_10620730
897 Ga0207684_10674898
898 Ga0207684_10858707
899 Ga0207684_10995409
900 Ga0207684_11118088
901 Ga0207684_11359985
902 Ga0207654_10357827
903 Ga0207649_11302621
904 Ga0207652_10524339
905 Ga0207646_10187096
906 Ga0207646_10211008
907 Ga0207646_10964881
908 Ga0207681_10120216
909 Ga0207650_10000173
910 Ga0207650_10241352
911 Ga0207659_10001456
912 Ga0207659_10038184
913 Ga0207687_10000005
914 Ga0207687_10017869
915 Ga0207700_10012181
916 Ga0207700_10131064
917 Ga0207644_10000055
918 Ga0207670_10000940
919 Ga0207670_10204242
920 Ga0207670_11164163
921 Ga0207669_10608583
922 Ga0207665_10067933
923 Ga0207691_10037984
924 Ga0207691_10102015
925 Ga0207711_10284581
926 Ga0207689_10063420
927 Ga0207661_11285935
928 Ga0207679_11700133
929 Ga0207651_10342570
930 Ga0207651_10812491
931 Ga0207712_10307758
932 Ga0207712_10418346
933 Ga0207712_10501578
934 Ga0207712_10570232
935 Ga0207712_11342408
936 Ga0207668_10167975
937 Ga0207668_10724043
938 Ga0207668_11053193
939 Ga0207640_10114854
940 Ga0207658_10424562
941 Ga0207658_10496305
942 Ga0207677_11354611
943 Ga0207703_10001621
944 Ga0207703_10366129
945 Ga0207708_10563735
946 Ga0207708_10577595
947 Ga0207641_10196383
948 Ga0207641_11580424
949 Ga0207648_10175231
950 Ga0207648_10498318
951 Ga0207648_11100827
952 Ga0207676_11707549
953 Ga0207676_12452833
954 Ga0207674_10061476
955 Ga0207674_10153494
956 Ga0207675_101511349
957 Ga0207683_12154137
958 Ga0209966_1032141
959 Ga0207428_10276336
960 Ga0207428_10378387
961 Ga0268265_10007416
962 Ga0268265_11061775
963 Ga0268264_10066081
964 Ga0268264_10354319
965 Ga0265337_1006131
966 Ga0265326_10006056
967 Ga0265334_10016762
968 Ga0265334_10088683
969 Ga0265318_10023317
970 Ga0265318_10124220
971 Ga0265323_10004342
972 Ga0265323_10016893
973 Ga0265323_10167981
974 Ga0265322_10010107
975 Ga0265322_10028218
976 Ga0265338_10011501
977 Ga0265338_10047033
978 Ga0265338_10052234
979 Ga0265338_10091681
980 Ga0265338_10540037
981 Ga0307511_10061266
982 Ga0265330_10002756
983 Ga0265330_10053443
984 Ga0265320_10020489
985 Ga0265320_10027507
986 Ga0265320_10467772
987 Ga0265329_10001041
988 Ga0265340_10082757
989 Ga0265316_10000080
990 Ga0265316_10000331
991 Ga0265316_10005706
992 Ga0265316_10023689
993 Ga0265316_10031838
994 Ga0265316_10063134
995 Ga0265316_10079552
996 Ga0265316_10174890
997 Ga0265316_10277005
998 Ga0307408_101607377
999 Ga0265313_10106640
1000 Ga0265313_10183080
1001 Ga0316575_10083681
1002 Ga0316579_10236580
1003 Ga0265314_10158442
1004 Ga0265314_10248480
1005 Ga0265314_10454010
1006 Ga0265314_10461798
1007 Ga0265342_10001972
1008 Ga0265342_10006620
1009 Ga0265342_10404083
1010 Ga0265342_10578369
1011 Ga0316576_10000867
1012 Ga0316576_10011972
1013 Ga0316576_10064829
1014 Ga0316576_10084637
1015 Ga0316576_10126300
1016 Ga0316578_10001095
1017 Ga0316578_10094777
1018 Ga0316578_10225431
1019 Ga0316578_10291881
1020 Ga0316578_10912248
1021 Ga0316577_10010207
1022 Ga0316577_10015563
1023 Ga0316577_10018956
1024 Ga0316577_10048518
1025 Ga0316577_10103423
1026 Ga0316577_10562668
1027 Ga0316577_10798053
1028 Ga0316577_10805213
1029 Ga0307416_100439104
1030 Ga0307411_10235814
1031 Ga0316583_10060759
1032 Ga0316583_10063067
1033 Ga0316583_10121205
1034 Ga0316585_10034113
1035 Ga0316585_10061865
1036 Ga0316580_10015466
1037 Ga0316592_1099540
1038 Ga0316588_1097030
1039 Ga0316587_1042176
1040 Ga0373941_0009362
1041 Ga0373953_0336098
1042 Ga0373955_0368586
1043 Ga0316574_0017761
1044 Ga0316574_0063504
1045 Ga0316574_0108659
1046 Ga0316574_0687503
1047 Ga0373933_0142690
1048 Ga0373937_0306821
1049 Ga0265778_046555
1050 Ga0316582_0055036
1051 Ga0316582_0062437
1052 Ga0316582_0227440
1053 Ga0316582_0412161
1054 Ga0316582_0492694
1055 Ga0316582_0496626
1056 Ga0316584_0000084
1057 Ga0316584_0013613
1058 Ga0316584_0137302
1059 Ga0316584_0155344
1060 Ga0316584_0376890
1061 Ga0316584_0626660
1062 Ga0395899_0200587
1063 Ga0395900_0108842
1064 Ga0395898_0790563
1065 Ga0395905_0206609
1066 Ga0436364_0333747
1067 Ga0395901_0086040
1068 Ga0395901_1534913
1069 Ga0400489_95740
1070 Ga0400487_36034
1071 Ga0436365_1846846
1072 Ga0436363_0320031
1073 Ga0436362_0155917
1074 Ga0436362_0206005
1075 Ga0436362_0280990
1076 Ga0439439_0039200
1077 Ga0451839_0352286
1078 Ga0439450_045003
1079 Ga0439462_0041043
1080 Ga0450922_016057
1081 Ga0451577_0000016
1082 Ga0451577_0024815
1083 Ga0451577_0051017
1084 Ga0451577_0291688
1085 Ga0451577_0589719
1086 Ga0451577_0713191
1087 Ga0453683_0025324
1088 Ga0453683_0056775
1089 Ga0453683_0432789
1090 Ga0453684_0001369
1091 Ga0453684_0005810
1092 Ga0453684_0006387
1093 Ga0453684_0045157
1094 Ga0453684_0045549
1095 Ga0453684_0254845
1096 Ga0453684_0345690
1097 Ga0453684_0429645
1098 Ga0453684_0496760
1099 Ga0453684_0566474
1100 Ga0453684_1025709
1101 Ga0451576_1034323
1102 Ga0466967_0817043
1103 Ga0495603_0092679
1104 Ga0495644_0203528
1105 Ga0495667_0660580
1106 Ga0495613_0230207
1107 Ga0495600_0454383
1108 Ga0495636_0189165
1109 Ga0495679_168828
1110 Ga0496104_1267033
1111 Ga0496105_0792892
1112 Ga0501309_015053
1113 Ga0501292_046297
1114 Ga0501031_0384874
1115 Ga0501033_0622276
1116 Ga0501033_0694970
1117 Ga0501033_1075162
1118 Ga0501034_0637116
1119 Ga0501036_0008199
1120 Ga0501036_0018184
1121 Ga0501036_0084372
1122 Ga0501036_0169349
1123 Ga0501036_0633819
1124 Ga0501036_1165633
1125 Ga0501037_0000466
1126 Ga0501037_0052676
1127 Ga0501037_0242398
1128 Ga0501037_0504402
1129 Ga0501038_0009683
1130 Ga0501038_0012925
1131 Ga0501038_0326646
1132 Ga0501039_0021625
1133 Ga0501039_0041162
1134 Ga0501039_0066404
1135 Ga0501039_0098294
1136 Ga0501039_0140500
1137 Ga0501039_0397145
1138 Ga0501039_0521899
1139 Ga0501039_0590985
1140 Ga0501039_0901790
1141 Ga0501040_0004372
1142 Ga0501040_0072672
1143 Ga0501040_0695052
1144 Ga0501040_0818733
1145 Ga0501040_1079441
1146 Ga0501041_0003857
1147 Ga0501041_0023943
1148 Ga0501041_0317616
1149 Ga0501042_0018208
1150 Ga0501042_0341651
1151 Ga0501043_0056112
1152 Ga0501043_0056837
1153 Ga0501043_0061435
1154 Ga0501043_0716773
1155 Ga0501046_0007391
1156 Ga0501046_0026673
1157 Ga0501046_0262925
1158 Ga0501046_0503205
1159 Ga0501046_0633651
1160 Ga0501046_1052271
1161 Ga0501047_0008876
1162 Ga0501047_0546742
1163 Ga0501047_0787937
1164 Ga0501048_0266875
1165 Ga0501048_0272717
1166 Ga0501048_1238035
1167 Ga0501068_0008785
1168 Ga0501068_0052062
1169 Ga0501068_0378453
1170 Ga0501068_0550409
1171 Ga0501068_0743886
1172 Ga0501068_0783868
1173 Ga0501070_0013809
1174 Ga0501070_0827308
1175 Ga0501071_0097010
1176 Ga0501071_0523234
1177 Ga0501071_0683299
1178 Ga0501072_0010648
1179 Ga0501072_0064948
1180 Ga0501072_0453166
1181 Ga0501072_0579141
1182 Ga0501072_0841615
1183 Ga0501072_1145905
1184 Ga0501074_0323796
1185 Ga0501074_0459326
1186 Ga0501074_0847817
1187 Ga0501075_0003541
1188 Ga0501075_0184216
1189 Ga0501075_0208040
1190 Ga0501075_0279367
1191 Ga0501075_0344564
1192 Ga0501075_0616570
1193 Ga0501076_0000714
1194 Ga0501076_0138327
1195 Ga0501076_0207600
1196 Ga0501076_0402925
1197 Ga0501076_1251389
1198 Ga0501076_1294235
1199 Ga0501076_1370295
1200 Ga0501077_0073791
1201 Ga0501077_0083206
1202 Ga0501077_0157328
1203 Ga0501079_0053420
1204 Ga0501079_0269192
1205 Ga0501079_0319575
1206 Ga0501079_1077723
1207 Ga0501080_0039225
1208 Ga0501080_0063949
1209 Ga0501081_0000733
1210 Ga0501081_0194748
1211 Ga0501081_0542400
1212 Ga0501081_0751967
1213 Ga0501081_0972087
1214 Ga0501083_0236159
1215 Ga0501035_0046876
1216 Ga0501035_0049378
1217 Ga0501035_0061095
1218 Ga0501044_0000786
1219 Ga0501044_0096870
1220 Ga0501044_0682182
1221 Ga0501044_0923300
1222 Ga0501044_1266735
1223 Ga0501045_0005082
1224 Ga0501045_0037078
1225 Ga0501045_0633042
1226 Ga0501045_0992226
1227 Ga0501045_1068240
1228 Ga0501045_1142989
1229 nmdc:mga07m45_715852_c1
1230 nmdc:mga05p37_11027_c1
1231 nmdc:mga05p37_182740_c1
1232 nmdc:mga05p37_1830_c1
1233 nmdc:mga05p37_444413_c1
1234 nmdc:mga05p37_44918_c1
1235 nmdc:mga05p37_560974_c1
1236 nmdc:mga05p37_632365_c1
1237 nmdc:mga05p37_85206_c1
1238 nmdc:mga09592_46322_c1
1239 nmdc:mga09592_480242_c1
1240 nmdc:mga09592_886975_c1
1241 nmdc:mga0qj67_131378_c1
1242 nmdc:mga0qj67_193363_c1
1243 nmdc:mga0qj67_84326_c1
1244 nmdc:mga0qj67_973528_c1
1245 nmdc:mga06r32_1660114_c1
1246 nmdc:mga06r32_212721_c1
1247 nmdc:mga06r32_253940_c1
1248 nmdc:mga06r32_43279_c1
1249 nmdc:mga06r32_950706_c1
1250 nmdc:mga08y16_1074897_c1
1251 nmdc:mga08y16_2023849_c1
1252 nmdc:mga08y16_98616_c1
1253 nmdc:mga0n895_169003_c1
1254 nmdc:mga0n895_286807_c1
1255 nmdc:mga0n895_520212_c1
1256 nmdc:mga0n895_601562_c1
1257 nmdc:mga0n895_895802_c1
1258 nmdc:mga0n895_995062_c1
1259 nmdc:mga0rr50_18109_c1
1260 nmdc:mga0rr50_235385_c1
1261 nmdc:mga0rr50_38438_c1
1262 nmdc:mga0rr50_84_c1
1263 nmdc:mga08x19_11_c1
1264 nmdc:mga08x19_137540_c1
1265 nmdc:mga08x19_173952_c1
1266 nmdc:mga08x19_2411_c1
1267 nmdc:mga08x19_290746_c1
1268 nmdc:mga08x19_309370_c1
1269 nmdc:mga0a205_158146_c1
1270 nmdc:mga0a205_205273_c1
1271 nmdc:mga0a205_267941_c1
1272 nmdc:mga0a205_3245_c2
1273 nmdc:mga0a205_6784_c1
1274 Ga0495619_0742941
1275 Ga0500555_023563
1276 Ga0500577_0000806
1277 Ga0501084_0001969
1278 Ga0501084_0049260
1279 Ga0501084_0231946
1280 Ga0501084_0414450
1281 Ga0501084_0463266
1282 Ga0501084_0998042
1283 Ga0501084_1449332
1284 Ga0501084_1504948
1285 Ga0587070_211620
1286 Ga0501082_0004700
1287 Ga0501082_0216450
1288 Ga0501082_0443163
1289 Ga0501082_1217821
1290 Ga0501082_1695145
1291 Ga0530510_0001111
1292 Ga0530510_0006654
1293 Ga0530510_0053809
1294 Ga0530510_0085438
1295 Ga0530510_0103764
1296 Ga0530510_0154966
1297 Ga0530510_0268512
1298 Ga0530510_1236907

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

5

111

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mzm-assembly1.cif.gz_B mazf from s. aureus crystal form i, p212121, 2.1 a 0.9316 4 111
4mzm-assembly2.cif.gz_C mazf from s. aureus crystal form i, p212121, 2.1 a 0.9189 3 111
1ne8-assembly1.cif.gz_A-2 ydce protein from bacillus subtilis 0.9165 4 108
4mdx-assembly1.cif.gz_B crystal structure of bacillus subtilis mazf in complex with rna 0.9155 1 108
7du5-assembly1.cif.gz_A the structure of the m.tb mazf-mt1 toxin in complex with a fragment of cognate antitoxin 0.9145 4 110
ID Description Score Start End Superfamily
af_P71650_1_116_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9189 4 108 2.30.30.110
4hkeA00 Mainly Beta;Roll;SH3 type barrels.; 0.9143 3 111 2.30.30.110
2mf2B00 Mainly Beta;Roll;SH3 type barrels.; 0.9142 4 111 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9012 1 111 2.30.30.110
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.8926 1 112 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A2P9GZZ8-F1-model_v4 mRNA interferase (Modular protein) (EC 3.1.-.-) 0.9883 3 112 GO:0003677
GO:0004521
GO:0006355
GO:0006402
GO:0016075
AF-A0A660RP31-F1-model_v4 mRNA interferase (EC 3.1.-.-) 0.985 1 110 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A4V0XS12-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.982 30 110 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A140K3E8-F1-model_v4 mRNA interferase (EC 3.1.-.-) 0.9805 2 111 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A2G6Q3U1-F1-model_v4 MazF family transcriptional regulator 0.9792 39 112 GO:0003677

Map