F472447
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 649 | 257 | 1298 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10911917|Ga0163162_109119171 |
| Length | 113 |
| Sequence | VAGILRGEIRWADLNPIRGNEQAGLRPVLILSHDVFNERSGTVIAVALTSQPQRAGFPLTLEITAARLPKSRSWVKISQIRTLAIERIGKRLGRASPEEMGQVIEGLNEILGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 145 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 146 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 149 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 157 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 158 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 161 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 162 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 166 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 167 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 168 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 179 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 187 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 192 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 193 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 194 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 195 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 212 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 253 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 254 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 1.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.62 |
| Nodule | 0 |
| Rhizoplane | 0.31 |
| Rhizosphere | 97.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_10911917 | 3300013306 | Bacteria | 991 |
| 2 | MRS1b_contig_5170368 | 2162886011 | Unclassified | 837 |
| 3 | MBSR1b_contig_13570300 | 2162886012 | Bacteria | 912 |
| 4 | MBSR1b_contig_6330342 | 2162886012 | Unclassified | 837 |
| 5 | Ga0058862_11096336 | 3300004803 | Unclassified | 707 |
| 6 | Ga0065714_10064422 | 3300005288 | Bacteria | 270668 |
| 7 | Ga0065712_10067728 | 3300005290 | Bacteria | 178215 |
| 8 | Ga0065715_10327425 | 3300005293 | Unclassified | 990 |
| 9 | Ga0065707_10128050 | 3300005295 | Bacteria | 1972 |
| 10 | Ga0070658_10266236 | 3300005327 | Bacteria | 1456 |
| 11 | Ga0070690_100020180 | 3300005330 | Bacteria | 4057 |
| 12 | Ga0070670_100375613 | 3300005331 | Bacteria | 1252 |
| 13 | Ga0070677_10011843 | 3300005333 | Bacteria | 3018 |
| 14 | Ga0070682_101340836 | 3300005337 | Unclassified | 609 |
| 15 | Ga0070689_100002792 | 3300005340 | Bacteria | 11468 |
| 16 | Ga0070689_100255388 | 3300005340 | Bacteria | 1447 |
| 17 | Ga0070689_101567391 | 3300005340 | Unclassified | 598 |
| 18 | Ga0070661_100489151 | 3300005344 | Bacteria | 983 |
| 19 | Ga0070661_101817158 | 3300005344 | Bacteria | 517 |
| 20 | Ga0070692_10750846 | 3300005345 | Bacteria | 661 |
| 21 | Ga0070668_100806044 | 3300005347 | Unclassified | 834 |
| 22 | Ga0070668_101072735 | 3300005347 | Unclassified | 726 |
| 23 | Ga0070669_100030553 | 3300005353 | Bacteria | 3888 |
| 24 | Ga0070669_100900906 | 3300005353 | Unclassified | 755 |
| 25 | Ga0070675_100000115 | 3300005354 | Bacteria | 46929 |
| 26 | Ga0070671_100000047 | 3300005355 | Bacteria | 84234 |
| 27 | Ga0070674_100027215 | 3300005356 | Bacteria | 3745 |
| 28 | Ga0070674_100586189 | 3300005356 | Unclassified | 940 |
| 29 | Ga0070673_100011261 | 3300005364 | Bacteria | 6099 |
| 30 | Ga0070673_100296337 | 3300005364 | Unclassified | 1423 |
| 31 | Ga0070688_100293595 | 3300005365 | Bacteria | 1172 |
| 32 | Ga0070688_101322000 | 3300005365 | Unclassified | 582 |
| 33 | Ga0070667_100225333 | 3300005367 | Unclassified | 1670 |
| 34 | Ga0070709_10290905 | 3300005434 | Bacteria | 1190 |
| 35 | Ga0070713_100043854 | 3300005436 | Unclassified | 3659 |
| 36 | Ga0070713_100109680 | 3300005436 | Bacteria | 2405 |
| 37 | Ga0070701_11018244 | 3300005438 | Unclassified | 579 |
| 38 | Ga0070700_100339851 | 3300005441 | Bacteria | 1109 |
| 39 | Ga0070700_100376788 | 3300005441 | Unclassified | 1060 |
| 40 | Ga0070700_100732409 | 3300005441 | Unclassified | 789 |
| 41 | Ga0070694_100795809 | 3300005444 | Unclassified | 775 |
| 42 | Ga0070708_100106008 | 3300005445 | Bacteria | 2580 |
| 43 | Ga0070708_100214996 | 3300005445 | Bacteria | 1802 |
| 44 | Ga0070708_100366590 | 3300005445 | Bacteria | 1358 |
| 45 | Ga0070708_100529416 | 3300005445 | Unclassified | 1112 |
| 46 | Ga0070708_100654729 | 3300005445 | Bacteria | 990 |
| 47 | Ga0070708_101370927 | 3300005445 | Unclassified | 660 |
| 48 | Ga0070678_101388801 | 3300005456 | Bacteria | 655 |
| 49 | Ga0070662_101219942 | 3300005457 | Unclassified | 647 |
| 50 | Ga0070681_11130899 | 3300005458 | Unclassified | 704 |
| 51 | Ga0068867_100173799 | 3300005459 | Bacteria | 1708 |
| 52 | Ga0068867_100314034 | 3300005459 | Bacteria | 1296 |
| 53 | Ga0068867_101023531 | 3300005459 | Bacteria | 750 |
| 54 | Ga0068867_101913824 | 3300005459 | Unclassified | 559 |
| 55 | Ga0068867_102043232 | 3300005459 | Unclassified | 542 |
| 56 | Ga0068867_102050679 | 3300005459 | Unclassified | 541 |
| 57 | Ga0070706_100077359 | 3300005467 | Bacteria | 3079 |
| 58 | Ga0070706_100235524 | 3300005467 | Bacteria | 1709 |
| 59 | Ga0070706_100277672 | 3300005467 | Bacteria | 1563 |
| 60 | Ga0070706_100551961 | 3300005467 | Bacteria | 1072 |
| 61 | Ga0070706_100846291 | 3300005467 | Bacteria | 846 |
| 62 | Ga0070706_100901305 | 3300005467 | Bacteria | 817 |
| 63 | Ga0070706_101079647 | 3300005467 | Unclassified | 739 |
| 64 | Ga0070706_101180940 | 3300005467 | Unclassified | 703 |
| 65 | Ga0070706_101325494 | 3300005467 | Unclassified | 660 |
| 66 | Ga0070706_101708982 | 3300005467 | Unclassified | 573 |
| 67 | Ga0070707_100216412 | 3300005468 | Bacteria | 1867 |
| 68 | Ga0070707_100384368 | 3300005468 | Bacteria | 1363 |
| 69 | Ga0070707_100464489 | 3300005468 | Bacteria | 1227 |
| 70 | Ga0070707_100476477 | 3300005468 | Bacteria | 1209 |
| 71 | Ga0070707_101061530 | 3300005468 | Unclassified | 776 |
| 72 | Ga0070707_102004236 | 3300005468 | Unclassified | 546 |
| 73 | Ga0070698_100064014 | 3300005471 | Bacteria | 3706 |
| 74 | Ga0070698_100066654 | 3300005471 | Bacteria | 3623 |
| 75 | Ga0070698_100493006 | 3300005471 | Bacteria | 1163 |
| 76 | Ga0070698_100514386 | 3300005471 | Bacteria | 1135 |
| 77 | Ga0070698_100705952 | 3300005471 | Bacteria | 951 |
| 78 | Ga0070698_100783455 | 3300005471 | Bacteria | 897 |
| 79 | Ga0070698_100952792 | 3300005471 | Unclassified | 805 |
| 80 | Ga0070699_100037696 | 3300005518 | Bacteria | 4185 |
| 81 | Ga0070699_100068699 | 3300005518 | Bacteria | 3078 |
| 82 | Ga0070699_100205295 | 3300005518 | Unclassified | 1753 |
| 83 | Ga0070699_100213840 | 3300005518 | Bacteria | 1717 |
| 84 | Ga0070699_100479443 | 3300005518 | Unclassified | 1129 |
| 85 | Ga0070699_100491408 | 3300005518 | Bacteria | 1114 |
| 86 | Ga0070699_100777346 | 3300005518 | Bacteria | 876 |
| 87 | Ga0070699_100990918 | 3300005518 | Unclassified | 770 |
| 88 | Ga0070699_101259934 | 3300005518 | Unclassified | 678 |
| 89 | Ga0070699_101674002 | 3300005518 | Bacteria | 583 |
| 90 | Ga0070697_100068790 | 3300005536 | Bacteria | 2899 |
| 91 | Ga0070697_100084144 | 3300005536 | Unclassified | 2623 |
| 92 | Ga0070697_100192983 | 3300005536 | Bacteria | 1729 |
| 93 | Ga0070697_100275947 | 3300005536 | Unclassified | 1441 |
| 94 | Ga0070697_100496285 | 3300005536 | Unclassified | 1067 |
| 95 | Ga0070697_100507034 | 3300005536 | Unclassified | 1055 |
| 96 | Ga0070697_100817884 | 3300005536 | Unclassified | 825 |
| 97 | Ga0070697_101005993 | 3300005536 | Bacteria | 741 |
| 98 | Ga0070697_101285256 | 3300005536 | Bacteria | 653 |
| 99 | Ga0068853_100144685 | 3300005539 | Bacteria | 2136 |
| 100 | Ga0070672_101974112 | 3300005543 | Unclassified | 525 |
| 101 | Ga0070686_100108758 | 3300005544 | Bacteria | 1885 |
| 102 | Ga0070686_100265732 | 3300005544 | Bacteria | 1259 |
| 103 | Ga0070686_100338955 | 3300005544 | Bacteria | 1126 |
| 104 | Ga0070686_100859134 | 3300005544 | Bacteria | 735 |
| 105 | Ga0070695_100759528 | 3300005545 | Bacteria | 774 |
| 106 | Ga0070695_100900571 | 3300005545 | Unclassified | 714 |
| 107 | Ga0070696_100942700 | 3300005546 | Bacteria | 718 |
| 108 | Ga0070693_100243247 | 3300005547 | Bacteria | 1189 |
| 109 | Ga0070665_100118721 | 3300005548 | Unclassified | 2647 |
| 110 | Ga0070704_100123971 | 3300005549 | Bacteria | 1990 |
| 111 | Ga0070704_102027909 | 3300005549 | Bacteria | 534 |
| 112 | Ga0068857_100027715 | 3300005577 | Bacteria | 4997 |
| 113 | Ga0068857_100139295 | 3300005577 | Bacteria | 2192 |
| 114 | Ga0068854_100012885 | 3300005578 | Bacteria | 5477 |
| 115 | Ga0068854_100392239 | 3300005578 | Unclassified | 1147 |
| 116 | Ga0068852_101038331 | 3300005616 | Unclassified | 839 |
| 117 | Ga0068859_100189555 | 3300005617 | Bacteria | 2140 |
| 118 | Ga0068859_100722094 | 3300005617 | Unclassified | 1086 |
| 119 | Ga0068859_101023142 | 3300005617 | Bacteria | 907 |
| 120 | Ga0068859_101162720 | 3300005617 | Unclassified | 849 |
| 121 | Ga0068859_101822691 | 3300005617 | Unclassified | 672 |
| 122 | Ga0068864_100718903 | 3300005618 | Bacteria | 977 |
| 123 | Ga0068864_101182898 | 3300005618 | Unclassified | 763 |
| 124 | Ga0068864_101340484 | 3300005618 | Unclassified | 716 |
| 125 | Ga0068866_10059414 | 3300005718 | Bacteria | 1978 |
| 126 | Ga0068870_10093243 | 3300005840 | Bacteria | 1688 |
| 127 | Ga0068863_100941873 | 3300005841 | Bacteria | 865 |
| 128 | Ga0068863_101438255 | 3300005841 | Bacteria | 697 |
| 129 | Ga0068858_100002107 | 3300005842 | Bacteria | 20202 |
| 130 | Ga0068858_100259810 | 3300005842 | Bacteria | 1650 |
| 131 | Ga0068858_100297991 | 3300005842 | Unclassified | 1538 |
| 132 | Ga0068860_100087154 | 3300005843 | Bacteria | 2972 |
| 133 | Ga0068860_102263441 | 3300005843 | Unclassified | 564 |
| 134 | Ga0068862_100003981 | 3300005844 | Bacteria | 12539 |
| 135 | Ga0068862_100342251 | 3300005844 | Bacteria | 1385 |
| 136 | Ga0081455_10030093 | 3300005937 | Bacteria | 4939 |
| 137 | Ga0081455_10050571 | 3300005937 | Unclassified | 3573 |
| 138 | Ga0081539_10111211 | 3300005985 | Unclassified | 1378 |
| 139 | Ga0081539_10158795 | 3300005985 | Unclassified | 1080 |
| 140 | Ga0070717_10000300 | 3300006028 | Bacteria | 32563 |
| 141 | Ga0070717_10270251 | 3300006028 | Bacteria | 1506 |
| 142 | Ga0070717_11759718 | 3300006028 | Unclassified | 560 |
| 143 | Ga0070712_100079059 | 3300006175 | Bacteria | 2376 |
| 144 | Ga0097621_102155995 | 3300006237 | Bacteria | 533 |
| 145 | Ga0075370_10798784 | 3300006353 | Unclassified | 575 |
| 146 | Ga0068871_100106829 | 3300006358 | Bacteria | 2350 |
| 147 | Ga0075428_100027169 | 3300006844 | Bacteria | 6336 |
| 148 | Ga0075428_100057608 | 3300006844 | Unclassified | 4253 |
| 149 | Ga0075428_100393499 | 3300006844 | Bacteria | 1485 |
| 150 | Ga0075428_100946251 | 3300006844 | Unclassified | 913 |
| 151 | Ga0075430_100103171 | 3300006846 | Bacteria | 2381 |
| 152 | Ga0075430_100129236 | 3300006846 | Bacteria | 2105 |
| 153 | Ga0075430_100173206 | 3300006846 | Viruses | 1795 |
| 154 | Ga0075430_100178598 | 3300006846 | Bacteria | 1766 |
| 155 | Ga0075431_100053505 | 3300006847 | Bacteria | 4162 |
| 156 | Ga0075431_100054322 | 3300006847 | Unclassified | 4130 |
| 157 | Ga0075431_100106924 | 3300006847 | Unclassified | 2886 |
| 158 | Ga0075431_100232081 | 3300006847 | Bacteria | 1880 |
| 159 | Ga0075431_100875305 | 3300006847 | Unclassified | 869 |
| 160 | Ga0075431_101112614 | 3300006847 | Bacteria | 754 |
| 161 | Ga0075433_10126631 | 3300006852 | Bacteria | 2268 |
| 162 | Ga0075433_10144037 | 3300006852 | Bacteria | 2118 |
| 163 | Ga0075434_100019694 | 3300006871 | Bacteria | 6531 |
| 164 | Ga0075434_100044299 | 3300006871 | Bacteria | 4414 |
| 165 | Ga0075434_100370438 | 3300006871 | Unclassified | 1453 |
| 166 | Ga0075434_100439895 | 3300006871 | Bacteria | 1325 |
| 167 | Ga0075434_100729086 | 3300006871 | Bacteria | 1008 |
| 168 | Ga0075429_100063731 | 3300006880 | Bacteria | 3211 |
| 169 | Ga0075429_100408776 | 3300006880 | Unclassified | 1189 |
| 170 | Ga0068865_101344297 | 3300006881 | Unclassified | 636 |
| 171 | Ga0075436_100000288 | 3300006914 | Bacteria | 31977 |
| 172 | Ga0075436_100020167 | 3300006914 | Bacteria | 4575 |
| 173 | Ga0075436_100083901 | 3300006914 | Bacteria | 2211 |
| 174 | Ga0075436_100102830 | 3300006914 | Bacteria | 1990 |
| 175 | Ga0075436_100426479 | 3300006914 | Bacteria | 963 |
| 176 | Ga0075436_100474808 | 3300006914 | Bacteria | 913 |
| 177 | Ga0097620_100189554 | 3300006931 | Bacteria | 2140 |
| 178 | Ga0097620_100722176 | 3300006931 | Unclassified | 1086 |
| 179 | Ga0097620_101023154 | 3300006931 | Bacteria | 907 |
| 180 | Ga0097620_101163042 | 3300006931 | Unclassified | 849 |
| 181 | Ga0097620_101822984 | 3300006931 | Unclassified | 672 |
| 182 | Ga0075435_100000070 | 3300007076 | Bacteria | 52706 |
| 183 | Ga0075435_100085912 | 3300007076 | Bacteria | 2590 |
| 184 | Ga0075435_100134799 | 3300007076 | Bacteria | 2068 |
| 185 | Ga0099794_10157550 | 3300007265 | Bacteria | 1154 |
| 186 | Ga0099794_10268707 | 3300007265 | Unclassified | 881 |
| 187 | Ga0111539_10737059 | 3300009094 | Unclassified | 1147 |
| 188 | Ga0105245_10000010 | 3300009098 | Bacteria | 278233 |
| 189 | Ga0105245_10054587 | 3300009098 | Bacteria | 3588 |
| 190 | Ga0105247_10015418 | 3300009101 | Bacteria | 4578 |
| 191 | Ga0114129_10010995 | 3300009147 | Bacteria | 12896 |
| 192 | Ga0114129_10039691 | 3300009147 | Bacteria | 6638 |
| 193 | Ga0114129_10076641 | 3300009147 | Bacteria | 4654 |
| 194 | Ga0114129_10089720 | 3300009147 | Unclassified | 4261 |
| 195 | Ga0114129_10237139 | 3300009147 | Bacteria | 2454 |
| 196 | Ga0114129_10259933 | 3300009147 | Bacteria | 2327 |
| 197 | Ga0114129_10343121 | 3300009147 | Bacteria | 1980 |
| 198 | Ga0114129_10658732 | 3300009147 | Bacteria | 1350 |
| 199 | Ga0114129_11103249 | 3300009147 | Unclassified | 993 |
| 200 | Ga0114129_11930863 | 3300009147 | Unclassified | 715 |
| 201 | Ga0105241_10449179 | 3300009174 | Bacteria | 1140 |
| 202 | Ga0105248_10073923 | 3300009177 | Bacteria | 3831 |
| 203 | Ga0105248_11547801 | 3300009177 | Unclassified | 751 |
| 204 | Ga0105248_11712900 | 3300009177 | Bacteria | 713 |
| 205 | Ga0105237_11130304 | 3300009545 | Bacteria | 790 |
| 206 | Ga0105249_10039226 | 3300009553 | Unclassified | 4300 |
| 207 | Ga0105249_10751585 | 3300009553 | Bacteria | 1037 |
| 208 | Ga0105249_10852271 | 3300009553 | Unclassified | 977 |
| 209 | Ga0105239_11910956 | 3300010375 | Unclassified | 688 |
| 210 | Ga0105246_10553213 | 3300011119 | Bacteria | 986 |
| 211 | Ga0157371_11250151 | 3300013102 | Bacteria | 573 |
| 212 | Ga0157374_10000012 | 3300013296 | Bacteria | 462353 |
| 213 | Ga0157374_10380826 | 3300013296 | Bacteria | 1405 |
| 214 | Ga0157378_10069189 | 3300013297 | Bacteria | 3166 |
| 215 | Ga0157378_10428642 | 3300013297 | Bacteria | 1308 |
| 216 | Ga0157378_12836667 | 3300013297 | Unclassified | 537 |
| 217 | Ga0163162_10239323 | 3300013306 | Bacteria | 1946 |
| 218 | Ga0157372_10630557 | 3300013307 | Bacteria | 1249 |
| 219 | Ga0157375_10001182 | 3300013308 | Bacteria | 22544 |
| 220 | Ga0157375_11834713 | 3300013308 | Bacteria | 719 |
| 221 | Ga0163163_12813735 | 3300014325 | Bacteria | 543 |
| 222 | Ga0157380_10026352 | 3300014326 | Unclassified | 4414 |
| 223 | Ga0157380_10249607 | 3300014326 | Bacteria | 1605 |
| 224 | Ga0157380_10396234 | 3300014326 | Bacteria | 1308 |
| 225 | Ga0157380_11150482 | 3300014326 | Unclassified | 817 |
| 226 | Ga0157380_12114758 | 3300014326 | Unclassified | 626 |
| 227 | Ga0157377_10000002 | 3300014745 | Bacteria | 473827 |
| 228 | Ga0157377_10005848 | 3300014745 | Bacteria | 5817 |
| 229 | Ga0157379_10093850 | 3300014968 | Bacteria | 2692 |
| 230 | Ga0157379_10176224 | 3300014968 | Bacteria | 1931 |
| 231 | Ga0157379_10416768 | 3300014968 | Bacteria | 1236 |
| 232 | Ga0157379_12450428 | 3300014968 | Unclassified | 521 |
| 233 | Ga0157376_10233988 | 3300014969 | Bacteria | 1708 |
| 234 | Ga0213873_10146223 | 3300021358 | Bacteria | 709 |
| 235 | Ga0213876_10320411 | 3300021384 | Unclassified | 824 |
| 236 | Ga0207682_10032960 | 3300025893 | Unclassified | 2083 |
| 237 | Ga0207688_10090384 | 3300025901 | Bacteria | 1757 |
| 238 | Ga0207699_10762544 | 3300025906 | Unclassified | 710 |
| 239 | Ga0207643_10250322 | 3300025908 | Bacteria | 1091 |
| 240 | Ga0207705_10047163 | 3300025909 | Bacteria | 3098 |
| 241 | Ga0207705_10113590 | 3300025909 | Bacteria | 2003 |
| 242 | Ga0207705_11066123 | 3300025909 | Bacteria | 623 |
| 243 | Ga0207684_10066662 | 3300025910 | Unclassified | 3058 |
| 244 | Ga0207684_10242774 | 3300025910 | Bacteria | 1554 |
| 245 | Ga0207684_10423364 | 3300025910 | Bacteria | 1144 |
| 246 | Ga0207684_10598181 | 3300025910 | Unclassified | 942 |
| 247 | Ga0207684_10620730 | 3300025910 | Bacteria | 922 |
| 248 | Ga0207684_10674898 | 3300025910 | Bacteria | 879 |
| 249 | Ga0207684_10858707 | 3300025910 | Unclassified | 765 |
| 250 | Ga0207684_10995409 | 3300025910 | Unclassified | 702 |
| 251 | Ga0207684_11118088 | 3300025910 | Bacteria | 655 |
| 252 | Ga0207684_11359985 | 3300025910 | Unclassified | 583 |
| 253 | Ga0207654_10357827 | 3300025911 | Bacteria | 1006 |
| 254 | Ga0207649_11302621 | 3300025920 | Bacteria | 575 |
| 255 | Ga0207652_10524339 | 3300025921 | Bacteria | 1066 |
| 256 | Ga0207646_10187096 | 3300025922 | Unclassified | 1870 |
| 257 | Ga0207646_10211008 | 3300025922 | Bacteria | 1754 |
| 258 | Ga0207646_10964881 | 3300025922 | Unclassified | 754 |
| 259 | Ga0207681_10120216 | 3300025923 | Bacteria | 1925 |
| 260 | Ga0207650_10000173 | 3300025925 | Bacteria | 76023 |
| 261 | Ga0207650_10241352 | 3300025925 | Bacteria | 1460 |
| 262 | Ga0207659_10001456 | 3300025926 | Bacteria | 14141 |
| 263 | Ga0207659_10038184 | 3300025926 | Unclassified | 3338 |
| 264 | Ga0207687_10000005 | 3300025927 | Bacteria | 770649 |
| 265 | Ga0207687_10017869 | 3300025927 | Bacteria | 4679 |
| 266 | Ga0207700_10012181 | 3300025928 | Bacteria | 5532 |
| 267 | Ga0207700_10131064 | 3300025928 | Bacteria | 2047 |
| 268 | Ga0207644_10000055 | 3300025931 | Bacteria | 84281 |
| 269 | Ga0207670_10000940 | 3300025936 | Bacteria | 15346 |
| 270 | Ga0207670_10204242 | 3300025936 | Bacteria | 1503 |
| 271 | Ga0207670_11164163 | 3300025936 | Unclassified | 652 |
| 272 | Ga0207669_10608583 | 3300025937 | Unclassified | 889 |
| 273 | Ga0207665_10067933 | 3300025939 | Unclassified | 2428 |
| 274 | Ga0207691_10037984 | 3300025940 | Unclassified | 4457 |
| 275 | Ga0207691_10102015 | 3300025940 | Bacteria | 2560 |
| 276 | Ga0207711_10284581 | 3300025941 | Bacteria | 1523 |
| 277 | Ga0207689_10063420 | 3300025942 | Bacteria | 3040 |
| 278 | Ga0207661_11285935 | 3300025944 | Unclassified | 672 |
| 279 | Ga0207679_11700133 | 3300025945 | Unclassified | 577 |
| 280 | Ga0207651_10342570 | 3300025960 | Unclassified | 1256 |
| 281 | Ga0207651_10812491 | 3300025960 | Unclassified | 829 |
| 282 | Ga0207712_10307758 | 3300025961 | Bacteria | 1303 |
| 283 | Ga0207712_10418346 | 3300025961 | Bacteria | 1130 |
| 284 | Ga0207712_10501578 | 3300025961 | Bacteria | 1038 |
| 285 | Ga0207712_10570232 | 3300025961 | Unclassified | 976 |
| 286 | Ga0207712_11342408 | 3300025961 | Unclassified | 639 |
| 287 | Ga0207668_10167975 | 3300025972 | Bacteria | 1718 |
| 288 | Ga0207668_10724043 | 3300025972 | Unclassified | 876 |
| 289 | Ga0207668_11053193 | 3300025972 | Unclassified | 728 |
| 290 | Ga0207640_10114854 | 3300025981 | Bacteria | 1916 |
| 291 | Ga0207658_10424562 | 3300025986 | Bacteria | 1173 |
| 292 | Ga0207658_10496305 | 3300025986 | Unclassified | 1087 |
| 293 | Ga0207677_11354611 | 3300026023 | Bacteria | 655 |
| 294 | Ga0207703_10001621 | 3300026035 | Bacteria | 20273 |
| 295 | Ga0207703_10366129 | 3300026035 | Bacteria | 1330 |
| 296 | Ga0207708_10563735 | 3300026075 | Unclassified | 962 |
| 297 | Ga0207708_10577595 | 3300026075 | Unclassified | 950 |
| 298 | Ga0207641_10196383 | 3300026088 | Unclassified | 1858 |
| 299 | Ga0207641_11580424 | 3300026088 | Bacteria | 658 |
| 300 | Ga0207648_10175231 | 3300026089 | Bacteria | 1896 |
| 301 | Ga0207648_10498318 | 3300026089 | Bacteria | 1114 |
| 302 | Ga0207648_11100827 | 3300026089 | Unclassified | 745 |
| 303 | Ga0207676_11707549 | 3300026095 | Unclassified | 628 |
| 304 | Ga0207676_12452833 | 3300026095 | Unclassified | 518 |
| 305 | Ga0207674_10061476 | 3300026116 | Bacteria | 3795 |
| 306 | Ga0207674_10153494 | 3300026116 | Bacteria | 2259 |
| 307 | Ga0207675_101511349 | 3300026118 | Unclassified | 692 |
| 308 | Ga0207683_12154137 | 3300026121 | Bacteria | 506 |
| 309 | Ga0209966_1032141 | 3300027695 | Unclassified | 1067 |
| 310 | Ga0207428_10276336 | 3300027907 | Bacteria | 1248 |
| 311 | Ga0207428_10378387 | 3300027907 | Bacteria | 1039 |
| 312 | Ga0268265_10007416 | 3300028380 | Bacteria | 7410 |
| 313 | Ga0268265_11061775 | 3300028380 | Unclassified | 802 |
| 314 | Ga0268264_10066081 | 3300028381 | Bacteria | 3049 |
| 315 | Ga0268264_10354319 | 3300028381 | Bacteria | 1398 |
| 316 | Ga0265337_1006131 | 3300028556 | Bacteria | 4680 |
| 317 | Ga0265326_10006056 | 3300028558 | Bacteria | 3782 |
| 318 | Ga0265334_10016762 | 3300028573 | Bacteria | 3030 |
| 319 | Ga0265334_10088683 | 3300028573 | Unclassified | 1131 |
| 320 | Ga0265318_10023317 | 3300028577 | Bacteria | 2467 |
| 321 | Ga0265318_10124220 | 3300028577 | Bacteria | 949 |
| 322 | Ga0265323_10004342 | 3300028653 | Bacteria | 6114 |
| 323 | Ga0265323_10016893 | 3300028653 | Bacteria | 2842 |
| 324 | Ga0265323_10167981 | 3300028653 | Unclassified | 698 |
| 325 | Ga0265322_10010107 | 3300028654 | Bacteria | 2737 |
| 326 | Ga0265322_10028218 | 3300028654 | Unclassified | 1604 |
| 327 | Ga0265338_10011501 | 3300028800 | Bacteria | 10215 |
| 328 | Ga0265338_10047033 | 3300028800 | Bacteria | 3945 |
| 329 | Ga0265338_10052234 | 3300028800 | Bacteria | 3670 |
| 330 | Ga0265338_10091681 | 3300028800 | Bacteria | 2509 |
| 331 | Ga0265338_10540037 | 3300028800 | Bacteria | 817 |
| 332 | Ga0307511_10061266 | 3300030521 | Unclassified | 2869 |
| 333 | Ga0265330_10002756 | 3300031235 | Bacteria | 9443 |
| 334 | Ga0265330_10053443 | 3300031235 | Bacteria | 1767 |
| 335 | Ga0265320_10020489 | 3300031240 | Bacteria | 3584 |
| 336 | Ga0265320_10027507 | 3300031240 | Bacteria | 2963 |
| 337 | Ga0265320_10467772 | 3300031240 | Unclassified | 557 |
| 338 | Ga0265329_10001041 | 3300031242 | Bacteria | 13751 |
| 339 | Ga0265340_10082757 | 3300031247 | Bacteria | 1509 |
| 340 | Ga0265316_10000080 | 3300031344 | Bacteria | 100625 |
| 341 | Ga0265316_10000331 | 3300031344 | Bacteria | 52879 |
| 342 | Ga0265316_10005706 | 3300031344 | Bacteria | 12029 |
| 343 | Ga0265316_10023689 | 3300031344 | Bacteria | 5154 |
| 344 | Ga0265316_10031838 | 3300031344 | Bacteria | 4309 |
| 345 | Ga0265316_10063134 | 3300031344 | Bacteria | 2873 |
| 346 | Ga0265316_10079552 | 3300031344 | Bacteria | 2515 |
| 347 | Ga0265316_10174890 | 3300031344 | Unclassified | 1600 |
| 348 | Ga0265316_10277005 | 3300031344 | Bacteria | 1226 |
| 349 | Ga0307408_101607377 | 3300031548 | Bacteria | 617 |
| 350 | Ga0265313_10106640 | 3300031595 | Unclassified | 1237 |
| 351 | Ga0265313_10183080 | 3300031595 | Bacteria | 879 |
| 352 | Ga0316575_10083681 | 3300031665 | Unclassified | 1288 |
| 353 | Ga0316579_10236580 | 3300031691 | Unclassified | 883 |
| 354 | Ga0265314_10158442 | 3300031711 | Bacteria | 1380 |
| 355 | Ga0265314_10248480 | 3300031711 | Unclassified | 1022 |
| 356 | Ga0265314_10454010 | 3300031711 | Unclassified | 682 |
| 357 | Ga0265314_10461798 | 3300031711 | Bacteria | 675 |
| 358 | Ga0265342_10001972 | 3300031712 | Bacteria | 18333 |
| 359 | Ga0265342_10006620 | 3300031712 | Bacteria | 8601 |
| 360 | Ga0265342_10404083 | 3300031712 | Unclassified | 705 |
| 361 | Ga0265342_10578369 | 3300031712 | Unclassified | 568 |
| 362 | Ga0316576_10000867 | 3300031727 | Bacteria | 15338 |
| 363 | Ga0316576_10011972 | 3300031727 | Bacteria | 5709 |
| 364 | Ga0316576_10064829 | 3300031727 | Bacteria | 2683 |
| 365 | Ga0316576_10084637 | 3300031727 | Unclassified | 2357 |
| 366 | Ga0316576_10126300 | 3300031727 | Bacteria | 1922 |
| 367 | Ga0316578_10001095 | 3300031728 | Bacteria | 10529 |
| 368 | Ga0316578_10094777 | 3300031728 | Bacteria | 1785 |
| 369 | Ga0316578_10225431 | 3300031728 | Unclassified | 1126 |
| 370 | Ga0316578_10291881 | 3300031728 | Unclassified | 976 |
| 371 | Ga0316578_10912248 | 3300031728 | Bacteria | 507 |
| 372 | Ga0316577_10010207 | 3300031733 | Bacteria | 5064 |
| 373 | Ga0316577_10015563 | 3300031733 | Bacteria | 4185 |
| 374 | Ga0316577_10018956 | 3300031733 | Unclassified | 3807 |
| 375 | Ga0316577_10048518 | 3300031733 | Bacteria | 2371 |
| 376 | Ga0316577_10103423 | 3300031733 | Bacteria | 1597 |
| 377 | Ga0316577_10562668 | 3300031733 | Unclassified | 648 |
| 378 | Ga0316577_10798053 | 3300031733 | Bacteria | 536 |
| 379 | Ga0316577_10805213 | 3300031733 | Unclassified | 533 |
| 380 | Ga0307416_100439104 | 3300032002 | Unclassified | 1355 |
| 381 | Ga0307411_10235814 | 3300032005 | Unclassified | 1429 |
| 382 | Ga0316583_10060759 | 3300032133 | Unclassified | 1324 |
| 383 | Ga0316583_10063067 | 3300032133 | Bacteria | 1298 |
| 384 | Ga0316583_10121205 | 3300032133 | Unclassified | 911 |
| 385 | Ga0316585_10034113 | 3300032137 | Unclassified | 1607 |
| 386 | Ga0316585_10061865 | 3300032137 | Unclassified | 1210 |
| 387 | Ga0316580_10015466 | 3300032139 | Unclassified | 2334 |
| 388 | Ga0316592_1099540 | 3300033524 | Unclassified | 668 |
| 389 | Ga0316588_1097030 | 3300033528 | Unclassified | 737 |
| 390 | Ga0316587_1042176 | 3300033529 | Bacteria | 826 |
| 391 | Ga0373941_0009362 | 3300035115 | Bacteria | 2465 |
| 392 | Ga0373953_0336098 | 3300035117 | Bacteria | 661 |
| 393 | Ga0373955_0368586 | 3300035172 | Unclassified | 871 |
| 394 | Ga0316574_0017761 | 3300035398 | Bacteria | 4170 |
| 395 | Ga0316574_0063504 | 3300035398 | Unclassified | 2322 |
| 396 | Ga0316574_0108659 | 3300035398 | Bacteria | 1777 |
| 397 | Ga0316574_0687503 | 3300035398 | Unclassified | 628 |
| 398 | Ga0373933_0142690 | 3300035724 | Bacteria | 1513 |
| 399 | Ga0373937_0306821 | 3300036401 | Bacteria | 1501 |
| 400 | Ga0265778_046555 | 3300036457 | Unclassified | 587 |
| 401 | Ga0316582_0055036 | 3300036647 | Bacteria | 2535 |
| 402 | Ga0316582_0062437 | 3300036647 | Unclassified | 2392 |
| 403 | Ga0316582_0227440 | 3300036647 | Unclassified | 1276 |
| 404 | Ga0316582_0412161 | 3300036647 | Unclassified | 931 |
| 405 | Ga0316582_0492694 | 3300036647 | Unclassified | 845 |
| 406 | Ga0316582_0496626 | 3300036647 | Bacteria | 841 |
| 407 | Ga0316584_0000084 | 3300036712 | Bacteria | 37166 |
| 408 | Ga0316584_0013613 | 3300036712 | Bacteria | 5764 |
| 409 | Ga0316584_0137302 | 3300036712 | Unclassified | 1824 |
| 410 | Ga0316584_0155344 | 3300036712 | Bacteria | 1701 |
| 411 | Ga0316584_0376890 | 3300036712 | Bacteria | 1015 |
| 412 | Ga0316584_0626660 | 3300036712 | Unclassified | 743 |
| 413 | Ga0395899_0200587 | 3300037312 | Bacteria | 1391 |
| 414 | Ga0395900_0108842 | 3300037418 | Bacteria | 2847 |
| 415 | Ga0395898_0790563 | 3300037466 | Bacteria | 889 |
| 416 | Ga0395905_0206609 | 3300037471 | Bacteria | 1840 |
| 417 | Ga0436364_0333747 | 3300037853 | Unclassified | 995 |
| 418 | Ga0395901_0086040 | 3300038443 | Bacteria | 3287 |
| 419 | Ga0395901_1534913 | 3300038443 | Bacteria | 621 |
| 420 | Ga0400489_95740 | 3300039093 | Bacteria | 2277 |
| 421 | Ga0400487_36034 | 3300039110 | Bacteria | 1071 |
| 422 | Ga0436365_1846846 | 3300039437 | Unclassified | 824 |
| 423 | Ga0436363_0320031 | 3300039450 | Bacteria | 953 |
| 424 | Ga0436362_0155917 | 3300039453 | Bacteria | 2820 |
| 425 | Ga0436362_0206005 | 3300039453 | Unclassified | 636 |
| 426 | Ga0436362_0280990 | 3300039453 | Bacteria | 597 |
| 427 | Ga0439439_0039200 | 3300041406 | Bacteria | 1224 |
| 428 | Ga0451839_0352286 | 3300041496 | Bacteria | 3424 |
| 429 | Ga0439450_045003 | 3300042008 | Bacteria | 1035 |
| 430 | Ga0439462_0041043 | 3300042015 | Bacteria | 1235 |
| 431 | Ga0450922_016057 | 3300042124 | Bacteria | 748 |
| 432 | Ga0451577_0000016 | 3300042876 | Bacteria | 531002 |
| 433 | Ga0451577_0024815 | 3300042876 | Bacteria | 5448 |
| 434 | Ga0451577_0051017 | 3300042876 | Bacteria | 3693 |
| 435 | Ga0451577_0291688 | 3300042876 | Bacteria | 1478 |
| 436 | Ga0451577_0589719 | 3300042876 | Bacteria | 1009 |
| 437 | Ga0451577_0713191 | 3300042876 | Unclassified | 908 |
| 438 | Ga0453683_0025324 | 3300044673 | Bacteria | 3771 |
| 439 | Ga0453683_0056775 | 3300044673 | Bacteria | 2450 |
| 440 | Ga0453683_0432789 | 3300044673 | Bacteria | 850 |
| 441 | Ga0453684_0001369 | 3300044712 | Bacteria | 70779 |
| 442 | Ga0453684_0005810 | 3300044712 | Bacteria | 24042 |
| 443 | Ga0453684_0006387 | 3300044712 | Bacteria | 22454 |
| 444 | Ga0453684_0045157 | 3300044712 | Bacteria | 5881 |
| 445 | Ga0453684_0045549 | 3300044712 | Bacteria | 5849 |
| 446 | Ga0453684_0254845 | 3300044712 | Bacteria | 2013 |
| 447 | Ga0453684_0345690 | 3300044712 | Unclassified | 1678 |
| 448 | Ga0453684_0429645 | 3300044712 | Bacteria | 1474 |
| 449 | Ga0453684_0496760 | 3300044712 | Bacteria | 1351 |
| 450 | Ga0453684_0566474 | 3300044712 | Bacteria | 1249 |
| 451 | Ga0453684_1025709 | 3300044712 | Bacteria | 876 |
| 452 | Ga0451576_1034323 | 3300045051 | Unclassified | 860 |
| 453 | Ga0466967_0817043 | 3300045976 | Bacteria | 926 |
| 454 | Ga0495603_0092679 | 3300046455 | Bacteria | 1766 |
| 455 | Ga0495644_0203528 | 3300046523 | Bacteria | 763 |
| 456 | Ga0495667_0660580 | 3300046559 | Unclassified | 649 |
| 457 | Ga0495613_0230207 | 3300046689 | Bacteria | 1299 |
| 458 | Ga0495600_0454383 | 3300046809 | Bacteria | 792 |
| 459 | Ga0495636_0189165 | 3300047318 | Bacteria | 937 |
| 460 | Ga0495679_168828 | 3300047446 | Unclassified | 582 |
| 461 | Ga0496104_1267033 | 3300048907 | Unclassified | 640 |
| 462 | Ga0496105_0792892 | 3300048908 | Bacteria | 721 |
| 463 | Ga0501309_015053 | 3300049129 | Unclassified | 1043 |
| 464 | Ga0501292_046297 | 3300049515 | Unclassified | 762 |
| 465 | Ga0501031_0384874 | 3300049568 | Unclassified | 907 |
| 466 | Ga0501033_0622276 | 3300049570 | Unclassified | 739 |
| 467 | Ga0501033_0694970 | 3300049570 | Unclassified | 692 |
| 468 | Ga0501033_1075162 | 3300049570 | Bacteria | 536 |
| 469 | Ga0501034_0637116 | 3300049571 | Bacteria | 969 |
| 470 | Ga0501036_0008199 | 3300049572 | Bacteria | 8564 |
| 471 | Ga0501036_0018184 | 3300049572 | Bacteria | 5886 |
| 472 | Ga0501036_0084372 | 3300049572 | Bacteria | 2685 |
| 473 | Ga0501036_0169349 | 3300049572 | Bacteria | 1840 |
| 474 | Ga0501036_0633819 | 3300049572 | Unclassified | 885 |
| 475 | Ga0501036_1165633 | 3300049572 | Unclassified | 628 |
| 476 | Ga0501037_0000466 | 3300049573 | Bacteria | 32979 |
| 477 | Ga0501037_0052676 | 3300049573 | Bacteria | 2976 |
| 478 | Ga0501037_0242398 | 3300049573 | Bacteria | 1263 |
| 479 | Ga0501037_0504402 | 3300049573 | Unclassified | 820 |
| 480 | Ga0501038_0009683 | 3300049574 | Bacteria | 8838 |
| 481 | Ga0501038_0012925 | 3300049574 | Bacteria | 7615 |
| 482 | Ga0501038_0326646 | 3300049574 | Bacteria | 1199 |
| 483 | Ga0501039_0021625 | 3300049575 | Bacteria | 4935 |
| 484 | Ga0501039_0041162 | 3300049575 | Bacteria | 3568 |
| 485 | Ga0501039_0066404 | 3300049575 | Bacteria | 2800 |
| 486 | Ga0501039_0098294 | 3300049575 | Bacteria | 2283 |
| 487 | Ga0501039_0140500 | 3300049575 | Unclassified | 1897 |
| 488 | Ga0501039_0397145 | 3300049575 | Unclassified | 1083 |
| 489 | Ga0501039_0521899 | 3300049575 | Unclassified | 932 |
| 490 | Ga0501039_0590985 | 3300049575 | Bacteria | 870 |
| 491 | Ga0501039_0901790 | 3300049575 | Unclassified | 688 |
| 492 | Ga0501040_0004372 | 3300049576 | Bacteria | 9184 |
| 493 | Ga0501040_0072672 | 3300049576 | Bacteria | 2376 |
| 494 | Ga0501040_0695052 | 3300049576 | Unclassified | 735 |
| 495 | Ga0501040_0818733 | 3300049576 | Bacteria | 674 |
| 496 | Ga0501040_1079441 | 3300049576 | Bacteria | 582 |
| 497 | Ga0501041_0003857 | 3300049577 | Bacteria | 8623 |
| 498 | Ga0501041_0023943 | 3300049577 | Bacteria | 3663 |
| 499 | Ga0501041_0317616 | 3300049577 | Unclassified | 982 |
| 500 | Ga0501042_0018208 | 3300049578 | Bacteria | 4860 |
| 501 | Ga0501042_0341651 | 3300049578 | Unclassified | 1082 |
| 502 | Ga0501043_0056112 | 3300049579 | Bacteria | 3094 |
| 503 | Ga0501043_0056837 | 3300049579 | Bacteria | 3073 |
| 504 | Ga0501043_0061435 | 3300049579 | Bacteria | 2951 |
| 505 | Ga0501043_0716773 | 3300049579 | Unclassified | 729 |
| 506 | Ga0501046_0007391 | 3300049580 | Bacteria | 9657 |
| 507 | Ga0501046_0026673 | 3300049580 | Bacteria | 4719 |
| 508 | Ga0501046_0262925 | 3300049580 | Bacteria | 1267 |
| 509 | Ga0501046_0503205 | 3300049580 | Unclassified | 867 |
| 510 | Ga0501046_0633651 | 3300049580 | Unclassified | 757 |
| 511 | Ga0501046_1052271 | 3300049580 | Unclassified | 563 |
| 512 | Ga0501047_0008876 | 3300049581 | Bacteria | 9483 |
| 513 | Ga0501047_0546742 | 3300049581 | Unclassified | 983 |
| 514 | Ga0501047_0787937 | 3300049581 | Unclassified | 766 |
| 515 | Ga0501048_0266875 | 3300049582 | Unclassified | 1216 |
| 516 | Ga0501048_0272717 | 3300049582 | Unclassified | 1202 |
| 517 | Ga0501048_1238035 | 3300049582 | Unclassified | 537 |
| 518 | Ga0501068_0008785 | 3300049584 | Bacteria | 5636 |
| 519 | Ga0501068_0052062 | 3300049584 | Bacteria | 2478 |
| 520 | Ga0501068_0378453 | 3300049584 | Unclassified | 911 |
| 521 | Ga0501068_0550409 | 3300049584 | Unclassified | 750 |
| 522 | Ga0501068_0743886 | 3300049584 | Unclassified | 642 |
| 523 | Ga0501068_0783868 | 3300049584 | Unclassified | 625 |
| 524 | Ga0501070_0013809 | 3300049586 | Bacteria | 6804 |
| 525 | Ga0501070_0827308 | 3300049586 | Unclassified | 726 |
| 526 | Ga0501071_0097010 | 3300049587 | Unclassified | 2170 |
| 527 | Ga0501071_0523234 | 3300049587 | Bacteria | 910 |
| 528 | Ga0501071_0683299 | 3300049587 | Bacteria | 790 |
| 529 | Ga0501072_0010648 | 3300049588 | Bacteria | 7005 |
| 530 | Ga0501072_0064948 | 3300049588 | Unclassified | 2878 |
| 531 | Ga0501072_0453166 | 3300049588 | Bacteria | 1016 |
| 532 | Ga0501072_0579141 | 3300049588 | Unclassified | 885 |
| 533 | Ga0501072_0841615 | 3300049588 | Unclassified | 717 |
| 534 | Ga0501072_1145905 | 3300049588 | Bacteria | 605 |
| 535 | Ga0501074_0323796 | 3300049590 | Unclassified | 1094 |
| 536 | Ga0501074_0459326 | 3300049590 | Unclassified | 903 |
| 537 | Ga0501074_0847817 | 3300049590 | Unclassified | 644 |
| 538 | Ga0501075_0003541 | 3300049591 | Bacteria | 10449 |
| 539 | Ga0501075_0184216 | 3300049591 | Bacteria | 1593 |
| 540 | Ga0501075_0208040 | 3300049591 | Bacteria | 1492 |
| 541 | Ga0501075_0279367 | 3300049591 | Bacteria | 1272 |
| 542 | Ga0501075_0344564 | 3300049591 | Bacteria | 1135 |
| 543 | Ga0501075_0616570 | 3300049591 | Unclassified | 827 |
| 544 | Ga0501076_0000714 | 3300049592 | Bacteria | 21429 |
| 545 | Ga0501076_0138327 | 3300049592 | Bacteria | 1978 |
| 546 | Ga0501076_0207600 | 3300049592 | Unclassified | 1600 |
| 547 | Ga0501076_0402925 | 3300049592 | Bacteria | 1125 |
| 548 | Ga0501076_1251389 | 3300049592 | Unclassified | 611 |
| 549 | Ga0501076_1294235 | 3300049592 | Unclassified | 599 |
| 550 | Ga0501076_1370295 | 3300049592 | Unclassified | 581 |
| 551 | Ga0501077_0073791 | 3300049593 | Bacteria | 2161 |
| 552 | Ga0501077_0083206 | 3300049593 | Bacteria | 2028 |
| 553 | Ga0501077_0157328 | 3300049593 | Bacteria | 1442 |
| 554 | Ga0501079_0053420 | 3300049741 | Unclassified | 3117 |
| 555 | Ga0501079_0269192 | 3300049741 | Bacteria | 1332 |
| 556 | Ga0501079_0319575 | 3300049741 | Unclassified | 1215 |
| 557 | Ga0501079_1077723 | 3300049741 | Unclassified | 633 |
| 558 | Ga0501080_0039225 | 3300049742 | Bacteria | 4420 |
| 559 | Ga0501080_0063949 | 3300049742 | Bacteria | 3424 |
| 560 | Ga0501081_0000733 | 3300049743 | Bacteria | 19116 |
| 561 | Ga0501081_0194748 | 3300049743 | Bacteria | 1468 |
| 562 | Ga0501081_0542400 | 3300049743 | Unclassified | 868 |
| 563 | Ga0501081_0751967 | 3300049743 | Unclassified | 733 |
| 564 | Ga0501081_0972087 | 3300049743 | Unclassified | 641 |
| 565 | Ga0501083_0236159 | 3300049744 | Bacteria | 1190 |
| 566 | Ga0501035_0046876 | 3300049822 | Bacteria | 3885 |
| 567 | Ga0501035_0049378 | 3300049822 | Bacteria | 3771 |
| 568 | Ga0501035_0061095 | 3300049822 | Bacteria | 3354 |
| 569 | Ga0501044_0000786 | 3300049823 | Bacteria | 38328 |
| 570 | Ga0501044_0096870 | 3300049823 | Bacteria | 2971 |
| 571 | Ga0501044_0682182 | 3300049823 | Bacteria | 914 |
| 572 | Ga0501044_0923300 | 3300049823 | Bacteria | 747 |
| 573 | Ga0501044_1266735 | 3300049823 | Bacteria | 604 |
| 574 | Ga0501045_0005082 | 3300049824 | Bacteria | 9105 |
| 575 | Ga0501045_0037078 | 3300049824 | Unclassified | 3543 |
| 576 | Ga0501045_0633042 | 3300049824 | Unclassified | 791 |
| 577 | Ga0501045_0992226 | 3300049824 | Bacteria | 616 |
| 578 | Ga0501045_1068240 | 3300049824 | Bacteria | 591 |
| 579 | Ga0501045_1142989 | 3300049824 | Bacteria | 569 |
| 580 | nmdc:mga07m45_715852_c1 | 3300050496 | Unclassified | 575 |
| 581 | nmdc:mga05p37_11027_c1 | 3300050507 | Bacteria | 10736 |
| 582 | nmdc:mga05p37_182740_c1 | 3300050507 | Unclassified | 2551 |
| 583 | nmdc:mga05p37_1830_c1 | 3300050507 | Bacteria | 24802 |
| 584 | nmdc:mga05p37_444413_c1 | 3300050507 | Bacteria | 1503 |
| 585 | nmdc:mga05p37_44918_c1 | 3300050507 | Bacteria | 5435 |
| 586 | nmdc:mga05p37_560974_c1 | 3300050507 | Unclassified | 1298 |
| 587 | nmdc:mga05p37_632365_c1 | 3300050507 | Unclassified | 1202 |
| 588 | nmdc:mga05p37_85206_c1 | 3300050507 | Bacteria | 3894 |
| 589 | nmdc:mga09592_46322_c1 | 3300050508 | Unclassified | 3664 |
| 590 | nmdc:mga09592_480242_c1 | 3300050508 | Unclassified | 1071 |
| 591 | nmdc:mga09592_886975_c1 | 3300050508 | Bacteria | 750 |
| 592 | nmdc:mga0qj67_131378_c1 | 3300050509 | Bacteria | 2028 |
| 593 | nmdc:mga0qj67_193363_c1 | 3300050509 | Bacteria | 1653 |
| 594 | nmdc:mga0qj67_84326_c1 | 3300050509 | Unclassified | 2548 |
| 595 | nmdc:mga0qj67_973528_c1 | 3300050509 | Bacteria | 666 |
| 596 | nmdc:mga06r32_1660114_c1 | 3300050510 | Viruses | 577 |
| 597 | nmdc:mga06r32_212721_c1 | 3300050510 | Bacteria | 1921 |
| 598 | nmdc:mga06r32_253940_c1 | 3300050510 | Bacteria | 1746 |
| 599 | nmdc:mga06r32_43279_c1 | 3300050510 | Bacteria | 4285 |
| 600 | nmdc:mga06r32_950706_c1 | 3300050510 | Bacteria | 814 |
| 601 | nmdc:mga08y16_1074897_c1 | 3300050511 | Unclassified | 781 |
| 602 | nmdc:mga08y16_2023849_c1 | 3300050511 | Bacteria | 525 |
| 603 | nmdc:mga08y16_98616_c1 | 3300050511 | Bacteria | 3043 |
| 604 | nmdc:mga0n895_169003_c1 | 3300050512 | Bacteria | 2219 |
| 605 | nmdc:mga0n895_286807_c1 | 3300050512 | Unclassified | 1669 |
| 606 | nmdc:mga0n895_520212_c1 | 3300050512 | Bacteria | 1197 |
| 607 | nmdc:mga0n895_601562_c1 | 3300050512 | Bacteria | 1102 |
| 608 | nmdc:mga0n895_895802_c1 | 3300050512 | Bacteria | 873 |
| 609 | nmdc:mga0n895_995062_c1 | 3300050512 | Unclassified | 820 |
| 610 | nmdc:mga0rr50_18109_c1 | 3300050513 | Bacteria | 4724 |
| 611 | nmdc:mga0rr50_235385_c1 | 3300050513 | Bacteria | 1516 |
| 612 | nmdc:mga0rr50_38438_c1 | 3300050513 | Bacteria | 3463 |
| 613 | nmdc:mga0rr50_84_c1 | 3300050513 | Bacteria | 52823 |
| 614 | nmdc:mga08x19_11_c1 | 3300050514 | Bacteria | 403007 |
| 615 | nmdc:mga08x19_137540_c1 | 3300050514 | Bacteria | 1648 |
| 616 | nmdc:mga08x19_173952_c1 | 3300050514 | Bacteria | 1467 |
| 617 | nmdc:mga08x19_2411_c1 | 3300050514 | Bacteria | 11341 |
| 618 | nmdc:mga08x19_290746_c1 | 3300050514 | Bacteria | 1133 |
| 619 | nmdc:mga08x19_309370_c1 | 3300050514 | Bacteria | 1098 |
| 620 | nmdc:mga0a205_158146_c1 | 3300050515 | Unclassified | 2164 |
| 621 | nmdc:mga0a205_205273_c1 | 3300050515 | Bacteria | 1860 |
| 622 | nmdc:mga0a205_267941_c1 | 3300050515 | Bacteria | 1585 |
| 623 | nmdc:mga0a205_3245_c2 | 3300050515 | Bacteria | 12133 |
| 624 | nmdc:mga0a205_6784_c1 | 3300050515 | Bacteria | 10355 |
| 625 | Ga0495619_0742941 | 3300053085 | Bacteria | 666 |
| 626 | Ga0500555_023563 | 3300053103 | Bacteria | 1765 |
| 627 | Ga0500577_0000806 | 3300053142 | Bacteria | 8075 |
| 628 | Ga0501084_0001969 | 3300054114 | Bacteria | 16397 |
| 629 | Ga0501084_0049260 | 3300054114 | Unclassified | 3527 |
| 630 | Ga0501084_0231946 | 3300054114 | Unclassified | 1558 |
| 631 | Ga0501084_0414450 | 3300054114 | Bacteria | 1139 |
| 632 | Ga0501084_0463266 | 3300054114 | Bacteria | 1072 |
| 633 | Ga0501084_0998042 | 3300054114 | Unclassified | 703 |
| 634 | Ga0501084_1449332 | 3300054114 | Bacteria | 575 |
| 635 | Ga0501084_1504948 | 3300054114 | Unclassified | 563 |
| 636 | Ga0587070_211620 | 3300059491 | Bacteria | 521 |
| 637 | Ga0501082_0004700 | 3300060353 | Bacteria | 11907 |
| 638 | Ga0501082_0216450 | 3300060353 | Bacteria | 1666 |
| 639 | Ga0501082_0443163 | 3300060353 | Bacteria | 1134 |
| 640 | Ga0501082_1217821 | 3300060353 | Bacteria | 658 |
| 641 | Ga0501082_1695145 | 3300060353 | Unclassified | 551 |
| 642 | Ga0530510_0001111 | 3300061734 | Bacteria | 17863 |
| 643 | Ga0530510_0006654 | 3300061734 | Bacteria | 8061 |
| 644 | Ga0530510_0053809 | 3300061734 | Bacteria | 2908 |
| 645 | Ga0530510_0085438 | 3300061734 | Bacteria | 2299 |
| 646 | Ga0530510_0103764 | 3300061734 | Bacteria | 2079 |
| 647 | Ga0530510_0154966 | 3300061734 | Unclassified | 1693 |
| 648 | Ga0530510_0268512 | 3300061734 | Bacteria | 1273 |
| 649 | Ga0530510_1236907 | 3300061734 | Unclassified | 572 |
| 650 | Ga0163162_10911917 | |||
| 651 | MRS1b_contig_5170368 | |||
| 652 | MBSR1b_contig_13570300 | |||
| 653 | MBSR1b_contig_6330342 | |||
| 654 | Ga0058862_11096336 | |||
| 655 | Ga0065714_10064422 | |||
| 656 | Ga0065712_10067728 | |||
| 657 | Ga0065715_10327425 | |||
| 658 | Ga0065707_10128050 | |||
| 659 | Ga0070658_10266236 | |||
| 660 | Ga0070690_100020180 | |||
| 661 | Ga0070670_100375613 | |||
| 662 | Ga0070677_10011843 | |||
| 663 | Ga0070682_101340836 | |||
| 664 | Ga0070689_100002792 | |||
| 665 | Ga0070689_100255388 | |||
| 666 | Ga0070689_101567391 | |||
| 667 | Ga0070661_100489151 | |||
| 668 | Ga0070661_101817158 | |||
| 669 | Ga0070692_10750846 | |||
| 670 | Ga0070668_100806044 | |||
| 671 | Ga0070668_101072735 | |||
| 672 | Ga0070669_100030553 | |||
| 673 | Ga0070669_100900906 | |||
| 674 | Ga0070675_100000115 | |||
| 675 | Ga0070671_100000047 | |||
| 676 | Ga0070674_100027215 | |||
| 677 | Ga0070674_100586189 | |||
| 678 | Ga0070673_100011261 | |||
| 679 | Ga0070673_100296337 | |||
| 680 | Ga0070688_100293595 | |||
| 681 | Ga0070688_101322000 | |||
| 682 | Ga0070667_100225333 | |||
| 683 | Ga0070709_10290905 | |||
| 684 | Ga0070713_100043854 | |||
| 685 | Ga0070713_100109680 | |||
| 686 | Ga0070701_11018244 | |||
| 687 | Ga0070700_100339851 | |||
| 688 | Ga0070700_100376788 | |||
| 689 | Ga0070700_100732409 | |||
| 690 | Ga0070694_100795809 | |||
| 691 | Ga0070708_100106008 | |||
| 692 | Ga0070708_100214996 | |||
| 693 | Ga0070708_100366590 | |||
| 694 | Ga0070708_100529416 | |||
| 695 | Ga0070708_100654729 | |||
| 696 | Ga0070708_101370927 | |||
| 697 | Ga0070678_101388801 | |||
| 698 | Ga0070662_101219942 | |||
| 699 | Ga0070681_11130899 | |||
| 700 | Ga0068867_100173799 | |||
| 701 | Ga0068867_100314034 | |||
| 702 | Ga0068867_101023531 | |||
| 703 | Ga0068867_101913824 | |||
| 704 | Ga0068867_102043232 | |||
| 705 | Ga0068867_102050679 | |||
| 706 | Ga0070706_100077359 | |||
| 707 | Ga0070706_100235524 | |||
| 708 | Ga0070706_100277672 | |||
| 709 | Ga0070706_100551961 | |||
| 710 | Ga0070706_100846291 | |||
| 711 | Ga0070706_100901305 | |||
| 712 | Ga0070706_101079647 | |||
| 713 | Ga0070706_101180940 | |||
| 714 | Ga0070706_101325494 | |||
| 715 | Ga0070706_101708982 | |||
| 716 | Ga0070707_100216412 | |||
| 717 | Ga0070707_100384368 | |||
| 718 | Ga0070707_100464489 | |||
| 719 | Ga0070707_100476477 | |||
| 720 | Ga0070707_101061530 | |||
| 721 | Ga0070707_102004236 | |||
| 722 | Ga0070698_100064014 | |||
| 723 | Ga0070698_100066654 | |||
| 724 | Ga0070698_100493006 | |||
| 725 | Ga0070698_100514386 | |||
| 726 | Ga0070698_100705952 | |||
| 727 | Ga0070698_100783455 | |||
| 728 | Ga0070698_100952792 | |||
| 729 | Ga0070699_100037696 | |||
| 730 | Ga0070699_100068699 | |||
| 731 | Ga0070699_100205295 | |||
| 732 | Ga0070699_100213840 | |||
| 733 | Ga0070699_100479443 | |||
| 734 | Ga0070699_100491408 | |||
| 735 | Ga0070699_100777346 | |||
| 736 | Ga0070699_100990918 | |||
| 737 | Ga0070699_101259934 | |||
| 738 | Ga0070699_101674002 | |||
| 739 | Ga0070697_100068790 | |||
| 740 | Ga0070697_100084144 | |||
| 741 | Ga0070697_100192983 | |||
| 742 | Ga0070697_100275947 | |||
| 743 | Ga0070697_100496285 | |||
| 744 | Ga0070697_100507034 | |||
| 745 | Ga0070697_100817884 | |||
| 746 | Ga0070697_101005993 | |||
| 747 | Ga0070697_101285256 | |||
| 748 | Ga0068853_100144685 | |||
| 749 | Ga0070672_101974112 | |||
| 750 | Ga0070686_100108758 | |||
| 751 | Ga0070686_100265732 | |||
| 752 | Ga0070686_100338955 | |||
| 753 | Ga0070686_100859134 | |||
| 754 | Ga0070695_100759528 | |||
| 755 | Ga0070695_100900571 | |||
| 756 | Ga0070696_100942700 | |||
| 757 | Ga0070693_100243247 | |||
| 758 | Ga0070665_100118721 | |||
| 759 | Ga0070704_100123971 | |||
| 760 | Ga0070704_102027909 | |||
| 761 | Ga0068857_100027715 | |||
| 762 | Ga0068857_100139295 | |||
| 763 | Ga0068854_100012885 | |||
| 764 | Ga0068854_100392239 | |||
| 765 | Ga0068852_101038331 | |||
| 766 | Ga0068859_100189555 | |||
| 767 | Ga0068859_100722094 | |||
| 768 | Ga0068859_101023142 | |||
| 769 | Ga0068859_101162720 | |||
| 770 | Ga0068859_101822691 | |||
| 771 | Ga0068864_100718903 | |||
| 772 | Ga0068864_101182898 | |||
| 773 | Ga0068864_101340484 | |||
| 774 | Ga0068866_10059414 | |||
| 775 | Ga0068870_10093243 | |||
| 776 | Ga0068863_100941873 | |||
| 777 | Ga0068863_101438255 | |||
| 778 | Ga0068858_100002107 | |||
| 779 | Ga0068858_100259810 | |||
| 780 | Ga0068858_100297991 | |||
| 781 | Ga0068860_100087154 | |||
| 782 | Ga0068860_102263441 | |||
| 783 | Ga0068862_100003981 | |||
| 784 | Ga0068862_100342251 | |||
| 785 | Ga0081455_10030093 | |||
| 786 | Ga0081455_10050571 | |||
| 787 | Ga0081539_10111211 | |||
| 788 | Ga0081539_10158795 | |||
| 789 | Ga0070717_10000300 | |||
| 790 | Ga0070717_10270251 | |||
| 791 | Ga0070717_11759718 | |||
| 792 | Ga0070712_100079059 | |||
| 793 | Ga0097621_102155995 | |||
| 794 | Ga0075370_10798784 | |||
| 795 | Ga0068871_100106829 | |||
| 796 | Ga0075428_100027169 | |||
| 797 | Ga0075428_100057608 | |||
| 798 | Ga0075428_100393499 | |||
| 799 | Ga0075428_100946251 | |||
| 800 | Ga0075430_100103171 | |||
| 801 | Ga0075430_100129236 | |||
| 802 | Ga0075430_100173206 | |||
| 803 | Ga0075430_100178598 | |||
| 804 | Ga0075431_100053505 | |||
| 805 | Ga0075431_100054322 | |||
| 806 | Ga0075431_100106924 | |||
| 807 | Ga0075431_100232081 | |||
| 808 | Ga0075431_100875305 | |||
| 809 | Ga0075431_101112614 | |||
| 810 | Ga0075433_10126631 | |||
| 811 | Ga0075433_10144037 | |||
| 812 | Ga0075434_100019694 | |||
| 813 | Ga0075434_100044299 | |||
| 814 | Ga0075434_100370438 | |||
| 815 | Ga0075434_100439895 | |||
| 816 | Ga0075434_100729086 | |||
| 817 | Ga0075429_100063731 | |||
| 818 | Ga0075429_100408776 | |||
| 819 | Ga0068865_101344297 | |||
| 820 | Ga0075436_100000288 | |||
| 821 | Ga0075436_100020167 | |||
| 822 | Ga0075436_100083901 | |||
| 823 | Ga0075436_100102830 | |||
| 824 | Ga0075436_100426479 | |||
| 825 | Ga0075436_100474808 | |||
| 826 | Ga0097620_100189554 | |||
| 827 | Ga0097620_100722176 | |||
| 828 | Ga0097620_101023154 | |||
| 829 | Ga0097620_101163042 | |||
| 830 | Ga0097620_101822984 | |||
| 831 | Ga0075435_100000070 | |||
| 832 | Ga0075435_100085912 | |||
| 833 | Ga0075435_100134799 | |||
| 834 | Ga0099794_10157550 | |||
| 835 | Ga0099794_10268707 | |||
| 836 | Ga0111539_10737059 | |||
| 837 | Ga0105245_10000010 | |||
| 838 | Ga0105245_10054587 | |||
| 839 | Ga0105247_10015418 | |||
| 840 | Ga0114129_10010995 | |||
| 841 | Ga0114129_10039691 | |||
| 842 | Ga0114129_10076641 | |||
| 843 | Ga0114129_10089720 | |||
| 844 | Ga0114129_10237139 | |||
| 845 | Ga0114129_10259933 | |||
| 846 | Ga0114129_10343121 | |||
| 847 | Ga0114129_10658732 | |||
| 848 | Ga0114129_11103249 | |||
| 849 | Ga0114129_11930863 | |||
| 850 | Ga0105241_10449179 | |||
| 851 | Ga0105248_10073923 | |||
| 852 | Ga0105248_11547801 | |||
| 853 | Ga0105248_11712900 | |||
| 854 | Ga0105237_11130304 | |||
| 855 | Ga0105249_10039226 | |||
| 856 | Ga0105249_10751585 | |||
| 857 | Ga0105249_10852271 | |||
| 858 | Ga0105239_11910956 | |||
| 859 | Ga0105246_10553213 | |||
| 860 | Ga0157371_11250151 | |||
| 861 | Ga0157374_10000012 | |||
| 862 | Ga0157374_10380826 | |||
| 863 | Ga0157378_10069189 | |||
| 864 | Ga0157378_10428642 | |||
| 865 | Ga0157378_12836667 | |||
| 866 | Ga0163162_10239323 | |||
| 867 | Ga0157372_10630557 | |||
| 868 | Ga0157375_10001182 | |||
| 869 | Ga0157375_11834713 | |||
| 870 | Ga0163163_12813735 | |||
| 871 | Ga0157380_10026352 | |||
| 872 | Ga0157380_10249607 | |||
| 873 | Ga0157380_10396234 | |||
| 874 | Ga0157380_11150482 | |||
| 875 | Ga0157380_12114758 | |||
| 876 | Ga0157377_10000002 | |||
| 877 | Ga0157377_10005848 | |||
| 878 | Ga0157379_10093850 | |||
| 879 | Ga0157379_10176224 | |||
| 880 | Ga0157379_10416768 | |||
| 881 | Ga0157379_12450428 | |||
| 882 | Ga0157376_10233988 | |||
| 883 | Ga0213873_10146223 | |||
| 884 | Ga0213876_10320411 | |||
| 885 | Ga0207682_10032960 | |||
| 886 | Ga0207688_10090384 | |||
| 887 | Ga0207699_10762544 | |||
| 888 | Ga0207643_10250322 | |||
| 889 | Ga0207705_10047163 | |||
| 890 | Ga0207705_10113590 | |||
| 891 | Ga0207705_11066123 | |||
| 892 | Ga0207684_10066662 | |||
| 893 | Ga0207684_10242774 | |||
| 894 | Ga0207684_10423364 | |||
| 895 | Ga0207684_10598181 | |||
| 896 | Ga0207684_10620730 | |||
| 897 | Ga0207684_10674898 | |||
| 898 | Ga0207684_10858707 | |||
| 899 | Ga0207684_10995409 | |||
| 900 | Ga0207684_11118088 | |||
| 901 | Ga0207684_11359985 | |||
| 902 | Ga0207654_10357827 | |||
| 903 | Ga0207649_11302621 | |||
| 904 | Ga0207652_10524339 | |||
| 905 | Ga0207646_10187096 | |||
| 906 | Ga0207646_10211008 | |||
| 907 | Ga0207646_10964881 | |||
| 908 | Ga0207681_10120216 | |||
| 909 | Ga0207650_10000173 | |||
| 910 | Ga0207650_10241352 | |||
| 911 | Ga0207659_10001456 | |||
| 912 | Ga0207659_10038184 | |||
| 913 | Ga0207687_10000005 | |||
| 914 | Ga0207687_10017869 | |||
| 915 | Ga0207700_10012181 | |||
| 916 | Ga0207700_10131064 | |||
| 917 | Ga0207644_10000055 | |||
| 918 | Ga0207670_10000940 | |||
| 919 | Ga0207670_10204242 | |||
| 920 | Ga0207670_11164163 | |||
| 921 | Ga0207669_10608583 | |||
| 922 | Ga0207665_10067933 | |||
| 923 | Ga0207691_10037984 | |||
| 924 | Ga0207691_10102015 | |||
| 925 | Ga0207711_10284581 | |||
| 926 | Ga0207689_10063420 | |||
| 927 | Ga0207661_11285935 | |||
| 928 | Ga0207679_11700133 | |||
| 929 | Ga0207651_10342570 | |||
| 930 | Ga0207651_10812491 | |||
| 931 | Ga0207712_10307758 | |||
| 932 | Ga0207712_10418346 | |||
| 933 | Ga0207712_10501578 | |||
| 934 | Ga0207712_10570232 | |||
| 935 | Ga0207712_11342408 | |||
| 936 | Ga0207668_10167975 | |||
| 937 | Ga0207668_10724043 | |||
| 938 | Ga0207668_11053193 | |||
| 939 | Ga0207640_10114854 | |||
| 940 | Ga0207658_10424562 | |||
| 941 | Ga0207658_10496305 | |||
| 942 | Ga0207677_11354611 | |||
| 943 | Ga0207703_10001621 | |||
| 944 | Ga0207703_10366129 | |||
| 945 | Ga0207708_10563735 | |||
| 946 | Ga0207708_10577595 | |||
| 947 | Ga0207641_10196383 | |||
| 948 | Ga0207641_11580424 | |||
| 949 | Ga0207648_10175231 | |||
| 950 | Ga0207648_10498318 | |||
| 951 | Ga0207648_11100827 | |||
| 952 | Ga0207676_11707549 | |||
| 953 | Ga0207676_12452833 | |||
| 954 | Ga0207674_10061476 | |||
| 955 | Ga0207674_10153494 | |||
| 956 | Ga0207675_101511349 | |||
| 957 | Ga0207683_12154137 | |||
| 958 | Ga0209966_1032141 | |||
| 959 | Ga0207428_10276336 | |||
| 960 | Ga0207428_10378387 | |||
| 961 | Ga0268265_10007416 | |||
| 962 | Ga0268265_11061775 | |||
| 963 | Ga0268264_10066081 | |||
| 964 | Ga0268264_10354319 | |||
| 965 | Ga0265337_1006131 | |||
| 966 | Ga0265326_10006056 | |||
| 967 | Ga0265334_10016762 | |||
| 968 | Ga0265334_10088683 | |||
| 969 | Ga0265318_10023317 | |||
| 970 | Ga0265318_10124220 | |||
| 971 | Ga0265323_10004342 | |||
| 972 | Ga0265323_10016893 | |||
| 973 | Ga0265323_10167981 | |||
| 974 | Ga0265322_10010107 | |||
| 975 | Ga0265322_10028218 | |||
| 976 | Ga0265338_10011501 | |||
| 977 | Ga0265338_10047033 | |||
| 978 | Ga0265338_10052234 | |||
| 979 | Ga0265338_10091681 | |||
| 980 | Ga0265338_10540037 | |||
| 981 | Ga0307511_10061266 | |||
| 982 | Ga0265330_10002756 | |||
| 983 | Ga0265330_10053443 | |||
| 984 | Ga0265320_10020489 | |||
| 985 | Ga0265320_10027507 | |||
| 986 | Ga0265320_10467772 | |||
| 987 | Ga0265329_10001041 | |||
| 988 | Ga0265340_10082757 | |||
| 989 | Ga0265316_10000080 | |||
| 990 | Ga0265316_10000331 | |||
| 991 | Ga0265316_10005706 | |||
| 992 | Ga0265316_10023689 | |||
| 993 | Ga0265316_10031838 | |||
| 994 | Ga0265316_10063134 | |||
| 995 | Ga0265316_10079552 | |||
| 996 | Ga0265316_10174890 | |||
| 997 | Ga0265316_10277005 | |||
| 998 | Ga0307408_101607377 | |||
| 999 | Ga0265313_10106640 | |||
| 1000 | Ga0265313_10183080 | |||
| 1001 | Ga0316575_10083681 | |||
| 1002 | Ga0316579_10236580 | |||
| 1003 | Ga0265314_10158442 | |||
| 1004 | Ga0265314_10248480 | |||
| 1005 | Ga0265314_10454010 | |||
| 1006 | Ga0265314_10461798 | |||
| 1007 | Ga0265342_10001972 | |||
| 1008 | Ga0265342_10006620 | |||
| 1009 | Ga0265342_10404083 | |||
| 1010 | Ga0265342_10578369 | |||
| 1011 | Ga0316576_10000867 | |||
| 1012 | Ga0316576_10011972 | |||
| 1013 | Ga0316576_10064829 | |||
| 1014 | Ga0316576_10084637 | |||
| 1015 | Ga0316576_10126300 | |||
| 1016 | Ga0316578_10001095 | |||
| 1017 | Ga0316578_10094777 | |||
| 1018 | Ga0316578_10225431 | |||
| 1019 | Ga0316578_10291881 | |||
| 1020 | Ga0316578_10912248 | |||
| 1021 | Ga0316577_10010207 | |||
| 1022 | Ga0316577_10015563 | |||
| 1023 | Ga0316577_10018956 | |||
| 1024 | Ga0316577_10048518 | |||
| 1025 | Ga0316577_10103423 | |||
| 1026 | Ga0316577_10562668 | |||
| 1027 | Ga0316577_10798053 | |||
| 1028 | Ga0316577_10805213 | |||
| 1029 | Ga0307416_100439104 | |||
| 1030 | Ga0307411_10235814 | |||
| 1031 | Ga0316583_10060759 | |||
| 1032 | Ga0316583_10063067 | |||
| 1033 | Ga0316583_10121205 | |||
| 1034 | Ga0316585_10034113 | |||
| 1035 | Ga0316585_10061865 | |||
| 1036 | Ga0316580_10015466 | |||
| 1037 | Ga0316592_1099540 | |||
| 1038 | Ga0316588_1097030 | |||
| 1039 | Ga0316587_1042176 | |||
| 1040 | Ga0373941_0009362 | |||
| 1041 | Ga0373953_0336098 | |||
| 1042 | Ga0373955_0368586 | |||
| 1043 | Ga0316574_0017761 | |||
| 1044 | Ga0316574_0063504 | |||
| 1045 | Ga0316574_0108659 | |||
| 1046 | Ga0316574_0687503 | |||
| 1047 | Ga0373933_0142690 | |||
| 1048 | Ga0373937_0306821 | |||
| 1049 | Ga0265778_046555 | |||
| 1050 | Ga0316582_0055036 | |||
| 1051 | Ga0316582_0062437 | |||
| 1052 | Ga0316582_0227440 | |||
| 1053 | Ga0316582_0412161 | |||
| 1054 | Ga0316582_0492694 | |||
| 1055 | Ga0316582_0496626 | |||
| 1056 | Ga0316584_0000084 | |||
| 1057 | Ga0316584_0013613 | |||
| 1058 | Ga0316584_0137302 | |||
| 1059 | Ga0316584_0155344 | |||
| 1060 | Ga0316584_0376890 | |||
| 1061 | Ga0316584_0626660 | |||
| 1062 | Ga0395899_0200587 | |||
| 1063 | Ga0395900_0108842 | |||
| 1064 | Ga0395898_0790563 | |||
| 1065 | Ga0395905_0206609 | |||
| 1066 | Ga0436364_0333747 | |||
| 1067 | Ga0395901_0086040 | |||
| 1068 | Ga0395901_1534913 | |||
| 1069 | Ga0400489_95740 | |||
| 1070 | Ga0400487_36034 | |||
| 1071 | Ga0436365_1846846 | |||
| 1072 | Ga0436363_0320031 | |||
| 1073 | Ga0436362_0155917 | |||
| 1074 | Ga0436362_0206005 | |||
| 1075 | Ga0436362_0280990 | |||
| 1076 | Ga0439439_0039200 | |||
| 1077 | Ga0451839_0352286 | |||
| 1078 | Ga0439450_045003 | |||
| 1079 | Ga0439462_0041043 | |||
| 1080 | Ga0450922_016057 | |||
| 1081 | Ga0451577_0000016 | |||
| 1082 | Ga0451577_0024815 | |||
| 1083 | Ga0451577_0051017 | |||
| 1084 | Ga0451577_0291688 | |||
| 1085 | Ga0451577_0589719 | |||
| 1086 | Ga0451577_0713191 | |||
| 1087 | Ga0453683_0025324 | |||
| 1088 | Ga0453683_0056775 | |||
| 1089 | Ga0453683_0432789 | |||
| 1090 | Ga0453684_0001369 | |||
| 1091 | Ga0453684_0005810 | |||
| 1092 | Ga0453684_0006387 | |||
| 1093 | Ga0453684_0045157 | |||
| 1094 | Ga0453684_0045549 | |||
| 1095 | Ga0453684_0254845 | |||
| 1096 | Ga0453684_0345690 | |||
| 1097 | Ga0453684_0429645 | |||
| 1098 | Ga0453684_0496760 | |||
| 1099 | Ga0453684_0566474 | |||
| 1100 | Ga0453684_1025709 | |||
| 1101 | Ga0451576_1034323 | |||
| 1102 | Ga0466967_0817043 | |||
| 1103 | Ga0495603_0092679 | |||
| 1104 | Ga0495644_0203528 | |||
| 1105 | Ga0495667_0660580 | |||
| 1106 | Ga0495613_0230207 | |||
| 1107 | Ga0495600_0454383 | |||
| 1108 | Ga0495636_0189165 | |||
| 1109 | Ga0495679_168828 | |||
| 1110 | Ga0496104_1267033 | |||
| 1111 | Ga0496105_0792892 | |||
| 1112 | Ga0501309_015053 | |||
| 1113 | Ga0501292_046297 | |||
| 1114 | Ga0501031_0384874 | |||
| 1115 | Ga0501033_0622276 | |||
| 1116 | Ga0501033_0694970 | |||
| 1117 | Ga0501033_1075162 | |||
| 1118 | Ga0501034_0637116 | |||
| 1119 | Ga0501036_0008199 | |||
| 1120 | Ga0501036_0018184 | |||
| 1121 | Ga0501036_0084372 | |||
| 1122 | Ga0501036_0169349 | |||
| 1123 | Ga0501036_0633819 | |||
| 1124 | Ga0501036_1165633 | |||
| 1125 | Ga0501037_0000466 | |||
| 1126 | Ga0501037_0052676 | |||
| 1127 | Ga0501037_0242398 | |||
| 1128 | Ga0501037_0504402 | |||
| 1129 | Ga0501038_0009683 | |||
| 1130 | Ga0501038_0012925 | |||
| 1131 | Ga0501038_0326646 | |||
| 1132 | Ga0501039_0021625 | |||
| 1133 | Ga0501039_0041162 | |||
| 1134 | Ga0501039_0066404 | |||
| 1135 | Ga0501039_0098294 | |||
| 1136 | Ga0501039_0140500 | |||
| 1137 | Ga0501039_0397145 | |||
| 1138 | Ga0501039_0521899 | |||
| 1139 | Ga0501039_0590985 | |||
| 1140 | Ga0501039_0901790 | |||
| 1141 | Ga0501040_0004372 | |||
| 1142 | Ga0501040_0072672 | |||
| 1143 | Ga0501040_0695052 | |||
| 1144 | Ga0501040_0818733 | |||
| 1145 | Ga0501040_1079441 | |||
| 1146 | Ga0501041_0003857 | |||
| 1147 | Ga0501041_0023943 | |||
| 1148 | Ga0501041_0317616 | |||
| 1149 | Ga0501042_0018208 | |||
| 1150 | Ga0501042_0341651 | |||
| 1151 | Ga0501043_0056112 | |||
| 1152 | Ga0501043_0056837 | |||
| 1153 | Ga0501043_0061435 | |||
| 1154 | Ga0501043_0716773 | |||
| 1155 | Ga0501046_0007391 | |||
| 1156 | Ga0501046_0026673 | |||
| 1157 | Ga0501046_0262925 | |||
| 1158 | Ga0501046_0503205 | |||
| 1159 | Ga0501046_0633651 | |||
| 1160 | Ga0501046_1052271 | |||
| 1161 | Ga0501047_0008876 | |||
| 1162 | Ga0501047_0546742 | |||
| 1163 | Ga0501047_0787937 | |||
| 1164 | Ga0501048_0266875 | |||
| 1165 | Ga0501048_0272717 | |||
| 1166 | Ga0501048_1238035 | |||
| 1167 | Ga0501068_0008785 | |||
| 1168 | Ga0501068_0052062 | |||
| 1169 | Ga0501068_0378453 | |||
| 1170 | Ga0501068_0550409 | |||
| 1171 | Ga0501068_0743886 | |||
| 1172 | Ga0501068_0783868 | |||
| 1173 | Ga0501070_0013809 | |||
| 1174 | Ga0501070_0827308 | |||
| 1175 | Ga0501071_0097010 | |||
| 1176 | Ga0501071_0523234 | |||
| 1177 | Ga0501071_0683299 | |||
| 1178 | Ga0501072_0010648 | |||
| 1179 | Ga0501072_0064948 | |||
| 1180 | Ga0501072_0453166 | |||
| 1181 | Ga0501072_0579141 | |||
| 1182 | Ga0501072_0841615 | |||
| 1183 | Ga0501072_1145905 | |||
| 1184 | Ga0501074_0323796 | |||
| 1185 | Ga0501074_0459326 | |||
| 1186 | Ga0501074_0847817 | |||
| 1187 | Ga0501075_0003541 | |||
| 1188 | Ga0501075_0184216 | |||
| 1189 | Ga0501075_0208040 | |||
| 1190 | Ga0501075_0279367 | |||
| 1191 | Ga0501075_0344564 | |||
| 1192 | Ga0501075_0616570 | |||
| 1193 | Ga0501076_0000714 | |||
| 1194 | Ga0501076_0138327 | |||
| 1195 | Ga0501076_0207600 | |||
| 1196 | Ga0501076_0402925 | |||
| 1197 | Ga0501076_1251389 | |||
| 1198 | Ga0501076_1294235 | |||
| 1199 | Ga0501076_1370295 | |||
| 1200 | Ga0501077_0073791 | |||
| 1201 | Ga0501077_0083206 | |||
| 1202 | Ga0501077_0157328 | |||
| 1203 | Ga0501079_0053420 | |||
| 1204 | Ga0501079_0269192 | |||
| 1205 | Ga0501079_0319575 | |||
| 1206 | Ga0501079_1077723 | |||
| 1207 | Ga0501080_0039225 | |||
| 1208 | Ga0501080_0063949 | |||
| 1209 | Ga0501081_0000733 | |||
| 1210 | Ga0501081_0194748 | |||
| 1211 | Ga0501081_0542400 | |||
| 1212 | Ga0501081_0751967 | |||
| 1213 | Ga0501081_0972087 | |||
| 1214 | Ga0501083_0236159 | |||
| 1215 | Ga0501035_0046876 | |||
| 1216 | Ga0501035_0049378 | |||
| 1217 | Ga0501035_0061095 | |||
| 1218 | Ga0501044_0000786 | |||
| 1219 | Ga0501044_0096870 | |||
| 1220 | Ga0501044_0682182 | |||
| 1221 | Ga0501044_0923300 | |||
| 1222 | Ga0501044_1266735 | |||
| 1223 | Ga0501045_0005082 | |||
| 1224 | Ga0501045_0037078 | |||
| 1225 | Ga0501045_0633042 | |||
| 1226 | Ga0501045_0992226 | |||
| 1227 | Ga0501045_1068240 | |||
| 1228 | Ga0501045_1142989 | |||
| 1229 | nmdc:mga07m45_715852_c1 | |||
| 1230 | nmdc:mga05p37_11027_c1 | |||
| 1231 | nmdc:mga05p37_182740_c1 | |||
| 1232 | nmdc:mga05p37_1830_c1 | |||
| 1233 | nmdc:mga05p37_444413_c1 | |||
| 1234 | nmdc:mga05p37_44918_c1 | |||
| 1235 | nmdc:mga05p37_560974_c1 | |||
| 1236 | nmdc:mga05p37_632365_c1 | |||
| 1237 | nmdc:mga05p37_85206_c1 | |||
| 1238 | nmdc:mga09592_46322_c1 | |||
| 1239 | nmdc:mga09592_480242_c1 | |||
| 1240 | nmdc:mga09592_886975_c1 | |||
| 1241 | nmdc:mga0qj67_131378_c1 | |||
| 1242 | nmdc:mga0qj67_193363_c1 | |||
| 1243 | nmdc:mga0qj67_84326_c1 | |||
| 1244 | nmdc:mga0qj67_973528_c1 | |||
| 1245 | nmdc:mga06r32_1660114_c1 | |||
| 1246 | nmdc:mga06r32_212721_c1 | |||
| 1247 | nmdc:mga06r32_253940_c1 | |||
| 1248 | nmdc:mga06r32_43279_c1 | |||
| 1249 | nmdc:mga06r32_950706_c1 | |||
| 1250 | nmdc:mga08y16_1074897_c1 | |||
| 1251 | nmdc:mga08y16_2023849_c1 | |||
| 1252 | nmdc:mga08y16_98616_c1 | |||
| 1253 | nmdc:mga0n895_169003_c1 | |||
| 1254 | nmdc:mga0n895_286807_c1 | |||
| 1255 | nmdc:mga0n895_520212_c1 | |||
| 1256 | nmdc:mga0n895_601562_c1 | |||
| 1257 | nmdc:mga0n895_895802_c1 | |||
| 1258 | nmdc:mga0n895_995062_c1 | |||
| 1259 | nmdc:mga0rr50_18109_c1 | |||
| 1260 | nmdc:mga0rr50_235385_c1 | |||
| 1261 | nmdc:mga0rr50_38438_c1 | |||
| 1262 | nmdc:mga0rr50_84_c1 | |||
| 1263 | nmdc:mga08x19_11_c1 | |||
| 1264 | nmdc:mga08x19_137540_c1 | |||
| 1265 | nmdc:mga08x19_173952_c1 | |||
| 1266 | nmdc:mga08x19_2411_c1 | |||
| 1267 | nmdc:mga08x19_290746_c1 | |||
| 1268 | nmdc:mga08x19_309370_c1 | |||
| 1269 | nmdc:mga0a205_158146_c1 | |||
| 1270 | nmdc:mga0a205_205273_c1 | |||
| 1271 | nmdc:mga0a205_267941_c1 | |||
| 1272 | nmdc:mga0a205_3245_c2 | |||
| 1273 | nmdc:mga0a205_6784_c1 | |||
| 1274 | Ga0495619_0742941 | |||
| 1275 | Ga0500555_023563 | |||
| 1276 | Ga0500577_0000806 | |||
| 1277 | Ga0501084_0001969 | |||
| 1278 | Ga0501084_0049260 | |||
| 1279 | Ga0501084_0231946 | |||
| 1280 | Ga0501084_0414450 | |||
| 1281 | Ga0501084_0463266 | |||
| 1282 | Ga0501084_0998042 | |||
| 1283 | Ga0501084_1449332 | |||
| 1284 | Ga0501084_1504948 | |||
| 1285 | Ga0587070_211620 | |||
| 1286 | Ga0501082_0004700 | |||
| 1287 | Ga0501082_0216450 | |||
| 1288 | Ga0501082_0443163 | |||
| 1289 | Ga0501082_1217821 | |||
| 1290 | Ga0501082_1695145 | |||
| 1291 | Ga0530510_0001111 | |||
| 1292 | Ga0530510_0006654 | |||
| 1293 | Ga0530510_0053809 | |||
| 1294 | Ga0530510_0085438 | |||
| 1295 | Ga0530510_0103764 | |||
| 1296 | Ga0530510_0154966 | |||
| 1297 | Ga0530510_0268512 | |||
| 1298 | Ga0530510_1236907 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mzm-assembly1.cif.gz_B | mazf from s. aureus crystal form i, p212121, 2.1 a | 0.9316 | 4 | 111 |
| 4mzm-assembly2.cif.gz_C | mazf from s. aureus crystal form i, p212121, 2.1 a | 0.9189 | 3 | 111 |
| 1ne8-assembly1.cif.gz_A-2 | ydce protein from bacillus subtilis | 0.9165 | 4 | 108 |
| 4mdx-assembly1.cif.gz_B | crystal structure of bacillus subtilis mazf in complex with rna | 0.9155 | 1 | 108 |
| 7du5-assembly1.cif.gz_A | the structure of the m.tb mazf-mt1 toxin in complex with a fragment of cognate antitoxin | 0.9145 | 4 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71650_1_116_2.30.30.110 | Mainly Beta;Roll;SH3 type barrels.; | 0.9189 | 4 | 108 | 2.30.30.110 |
| 4hkeA00 | Mainly Beta;Roll;SH3 type barrels.; | 0.9143 | 3 | 111 | 2.30.30.110 |
| 2mf2B00 | Mainly Beta;Roll;SH3 type barrels.; | 0.9142 | 4 | 111 | 2.30.30.110 |
| af_P9WII5_1_103_2.30.30.110 | Mainly Beta;Roll;SH3 type barrels.; | 0.9012 | 1 | 111 | 2.30.30.110 |
| 5cqyB00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8926 | 1 | 112 | 2.30.30.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P9GZZ8-F1-model_v4 | mRNA interferase (Modular protein) (EC 3.1.-.-) | 0.9883 | 3 | 112 |
GO:0003677
GO:0004521 GO:0006355 GO:0006402 GO:0016075 |
| AF-A0A660RP31-F1-model_v4 | mRNA interferase (EC 3.1.-.-) | 0.985 | 1 | 110 |
GO:0003677
GO:0004521 GO:0006402 GO:0016075 |
| AF-A0A4V0XS12-F1-model_v4 | Type II toxin-antitoxin system PemK/MazF family toxin | 0.982 | 30 | 110 |
GO:0003677
GO:0004521 GO:0006402 GO:0016075 |
| AF-A0A140K3E8-F1-model_v4 | mRNA interferase (EC 3.1.-.-) | 0.9805 | 2 | 111 |
GO:0003677
GO:0004521 GO:0006402 GO:0016075 |
| AF-A0A2G6Q3U1-F1-model_v4 | MazF family transcriptional regulator | 0.9792 | 39 | 112 |
GO:0003677
|