F472415

General Info

Members Datasets Scaffolds Average Seq Length
648 289 1296 303

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0004686|Ga0500622_0004686_3585_5435
Length 369
Sequence VADSQNAHNPDKTQPLDAMPAAPKPPPAQMDMLKPATSALSSSHSLPDIEQLRIPTPTSPVSDRFRWLGHKIATTAFVTEILPGAAAKLNAYAALTRLNKPIGIWLLLWPVLWALWLSSGGKPDPHVFIVFVLGTILTRSAGCAINDYADRNFDGHVKRTKNRPLVTGAVDPIEALALCAGLGLIALGLTLTLNQLAQKLTLVGGVLVVTYPFFKRFFPLPQAYLGIAFTWSVPMAYAAQTGDVPRAAIVMFLAGLAWTVAYDTMYAMVDREDDKKLGIRSSAILFGDADRFIIGIMQLMTLLGLWLIGHEMELGLWYGLGLAFAATFALYQQLLIRKRKPEDCFKAFLNNNYFGMSVFIGIFLEYTFR

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
128 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
138 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
139 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
140 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
141 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
142 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
216 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
217 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
218 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
240 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
241 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
279 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
280 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
286 2643221556 Massilia sp. Root1485 Isolate Unclassified
287 2643221684 Massilia sp. Root133 Isolate Unclassified
288 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
289 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.31
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 3.4
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0004686 3300053156 Bacteria 8461
2 SwRhRL2b_contig_1927969 2162886007 Bacteria 2814
3 SwRhRL2b_contig_38418 2162886007 Bacteria 2814
4 Ga0065165_1001411 3300005262 Bacteria 26128
5 Ga0065704_10073332 3300005289 Bacteria 7281
6 Ga0065712_10075276 3300005290 Bacteria 3895
7 Ga0065715_10212272 3300005293 Bacteria 1309
8 Ga0065715_10224058 3300005293 Bacteria 1260
9 Ga0070690_100003324 3300005330 Bacteria 8763
10 Ga0070670_100005970 3300005331 Bacteria 10302
11 Ga0070670_100170949 3300005331 Bacteria 1885
12 Ga0070670_100284241 3300005331 Bacteria 1445
13 Ga0070677_10005189 3300005333 Bacteria 4283
14 Ga0068869_100079676 3300005334 Bacteria 2441
15 Ga0068869_100251148 3300005334 Bacteria 1412
16 Ga0068869_100312570 3300005334 Bacteria 1272
17 Ga0070689_100000518 3300005340 Bacteria 22782
18 Ga0070689_100142597 3300005340 Bacteria 1927
19 Ga0070687_100045706 3300005343 Bacteria 2238
20 Ga0070661_100004943 3300005344 Bacteria 9177
21 Ga0070668_100002230 3300005347 Bacteria 14244
22 Ga0070669_100090500 3300005353 Bacteria 2293
23 Ga0070669_100201868 3300005353 Bacteria 1565
24 Ga0070675_100106635 3300005354 Bacteria 2365
25 Ga0070675_100154374 3300005354 Bacteria 1970
26 Ga0070671_100037309 3300005355 Bacteria 4030
27 Ga0070674_100050435 3300005356 Bacteria 2865
28 Ga0070673_100052696 3300005364 Bacteria 3193
29 Ga0070673_100137870 3300005364 Bacteria 2055
30 Ga0070659_100359226 3300005366 Bacteria 1223
31 Ga0070667_100052602 3300005367 Bacteria 3437
32 Ga0070705_100002762 3300005440 Bacteria 8759
33 Ga0070678_100037982 3300005456 Bacteria 3387
34 Ga0070662_100002859 3300005457 Bacteria 10702
35 Ga0070662_100313558 3300005457 Bacteria 1277
36 Ga0068867_100006399 3300005459 Bacteria 8323
37 Ga0068867_100151374 3300005459 Bacteria 1822
38 Ga0070685_10016714 3300005466 Bacteria 3914
39 Ga0070679_100056795 3300005530 Bacteria 3901
40 Ga0070684_100000535 3300005535 Bacteria 26071
41 Ga0070672_100046176 3300005543 Bacteria 3374
42 Ga0070672_100150723 3300005543 Bacteria 1923
43 Ga0070686_100460882 3300005544 Bacteria 979
44 Ga0070695_100097401 3300005545 Bacteria 1975
45 Ga0070665_100008198 3300005548 Bacteria 10578
46 Ga0070704_100334504 3300005549 Bacteria 1273
47 Ga0070664_100006562 3300005564 Bacteria 9385
48 Ga0068857_100073574 3300005577 Bacteria 3045
49 Ga0068857_100451728 3300005577 Bacteria 1201
50 Ga0070702_100011993 3300005615 Bacteria 4327
51 Ga0068859_100000800 3300005617 Bacteria 31891
52 Ga0068859_100191177 3300005617 Bacteria 2131
53 Ga0068864_100003622 3300005618 Bacteria 12771
54 Ga0068861_100003141 3300005719 Bacteria 10915
55 Ga0068861_100069973 3300005719 Bacteria 2716
56 Ga0068861_100176819 3300005719 Bacteria 1773
57 Ga0068861_100182096 3300005719 Bacteria 1750
58 Ga0068863_100000641 3300005841 Bacteria 35462
59 Ga0068858_100016716 3300005842 Bacteria 6890
60 Ga0068860_100008543 3300005843 Bacteria 10204
61 Ga0068862_100006284 3300005844 Bacteria 9886
62 Ga0068862_100009495 3300005844 Bacteria 8050
63 Ga0068862_100057279 3300005844 Bacteria 3342
64 Ga0070716_100079196 3300006173 Bacteria 1956
65 Ga0068871_100503914 3300006358 Bacteria 1091
66 Ga0075428_100011470 3300006844 Bacteria 9859
67 Ga0075428_100027952 3300006844 Bacteria 6241
68 Ga0075428_100082925 3300006844 Bacteria 3498
69 Ga0075430_100017829 3300006846 Bacteria 6043
70 Ga0075430_100301414 3300006846 Bacteria 1325
71 Ga0075431_100010551 3300006847 Bacteria 9287
72 Ga0075431_100026041 3300006847 Bacteria 5997
73 Ga0075431_100174283 3300006847 Bacteria 2210
74 Ga0075431_100240387 3300006847 Bacteria 1842
75 Ga0075433_10002252 3300006852 Bacteria 14650
76 Ga0075434_100000822 3300006871 Bacteria 24682
77 Ga0075434_100324572 3300006871 Bacteria 1560
78 Ga0075429_100002254 3300006880 Bacteria 16146
79 Ga0075429_100074277 3300006880 Bacteria 2962
80 Ga0068865_100049949 3300006881 Bacteria 2887
81 Ga0097620_100000800 3300006931 Bacteria 31891
82 Ga0097620_100191170 3300006931 Bacteria 2131
83 Ga0075435_100029490 3300007076 Bacteria 4306
84 Ga0111539_10014678 3300009094 Bacteria 9774
85 Ga0111539_10040565 3300009094 Bacteria 5603
86 Ga0111539_10058623 3300009094 Bacteria 4567
87 Ga0111539_10073831 3300009094 Bacteria 4020
88 Ga0111539_10308552 3300009094 Bacteria 1841
89 Ga0105247_10084290 3300009101 Bacteria 2008
90 Ga0114129_10002637 3300009147 Bacteria 24969
91 Ga0114129_10012563 3300009147 Bacteria 12058
92 Ga0114129_10052221 3300009147 Bacteria 5737
93 Ga0105243_10023263 3300009148 Bacteria 4716
94 Ga0105243_10050933 3300009148 Bacteria 3273
95 Ga0105242_10381456 3300009176 Bacteria 1310
96 Ga0105248_10000895 3300009177 Bacteria 33359
97 Ga0105249_10020639 3300009553 Bacteria 5890
98 Ga0105249_10022662 3300009553 Bacteria 5628
99 Ga0157378_10288501 3300013297 Bacteria 1584
100 Ga0157372_10319779 3300013307 Bacteria 1807
101 Ga0157375_10027071 3300013308 Bacteria 5355
102 Ga0157375_10512477 3300013308 Bacteria 1363
103 Ga0157514_132735 3300013874 Bacteria 1074
104 Ga0163163_10003361 3300014325 Bacteria 13580
105 Ga0163163_10063722 3300014325 Bacteria 3656
106 Ga0163163_10197026 3300014325 Bacteria 2062
107 Ga0163163_10564295 3300014325 Bacteria 1201
108 Ga0157380_10140281 3300014326 Bacteria 2076
109 Ga0157380_10304133 3300014326 Bacteria 1471
110 Ga0157377_10001449 3300014745 Bacteria 10252
111 Ga0157379_10070040 3300014968 Bacteria 3137
112 Ga0209563_100022 3300025230 Bacteria 643318
113 Ga0209677_110628 3300025253 Bacteria 1511
114 Ga0207697_10038466 3300025315 Bacteria 1962
115 Ga0207682_10018244 3300025893 Bacteria 2744
116 Ga0207682_10045950 3300025893 Bacteria 1793
117 Ga0207642_10045384 3300025899 Bacteria 1951
118 Ga0207688_10080977 3300025901 Bacteria 1854
119 Ga0207645_10058030 3300025907 Bacteria 2471
120 Ga0207643_10017292 3300025908 Bacteria 3942
121 Ga0207660_10195433 3300025917 Bacteria 1578
122 Ga0207662_10002920 3300025918 Bacteria 8668
123 Ga0207657_10015055 3300025919 Bacteria 7511
124 Ga0207649_10050897 3300025920 Bacteria 2564
125 Ga0207650_10019103 3300025925 Bacteria 4816
126 Ga0207659_10004777 3300025926 Bacteria 8216
127 Ga0207659_10030982 3300025926 Bacteria 3658
128 Ga0207659_10447045 3300025926 Bacteria 1088
129 Ga0207644_10103904 3300025931 Bacteria 2138
130 Ga0207706_10005686 3300025933 Bacteria 11611
131 Ga0207686_10219726 3300025934 Bacteria 1371
132 Ga0207709_10045067 3300025935 Bacteria 2669
133 Ga0207670_10011922 3300025936 Bacteria 5062
134 Ga0207670_10266156 3300025936 Bacteria 1331
135 Ga0207669_10031133 3300025937 Bacteria 2976
136 Ga0207704_10017981 3300025938 Bacteria 3679
137 Ga0207665_10091048 3300025939 Bacteria 2114
138 Ga0207691_10009188 3300025940 Bacteria 9488
139 Ga0207691_10014816 3300025940 Bacteria 7429
140 Ga0207691_10054902 3300025940 Bacteria 3633
141 Ga0207711_10090776 3300025941 Bacteria 2686
142 Ga0207689_10016166 3300025942 Bacteria 6320
143 Ga0207689_10018683 3300025942 Bacteria 5848
144 Ga0207689_10020364 3300025942 Bacteria 5584
145 Ga0207679_10003697 3300025945 Bacteria 9481
146 Ga0207679_10183586 3300025945 Bacteria 1733
147 Ga0207651_10012849 3300025960 Bacteria 4760
148 Ga0207651_10136885 3300025960 Bacteria 1885
149 Ga0207712_10009525 3300025961 Bacteria 6146
150 Ga0207712_10037028 3300025961 Bacteria 3326
151 Ga0207668_10002493 3300025972 Bacteria 10747
152 Ga0207668_10178882 3300025972 Bacteria 1671
153 Ga0207658_10046714 3300025986 Bacteria 3164
154 Ga0207703_10049246 3300026035 Bacteria 3405
155 Ga0207641_10006163 3300026088 Bacteria 10147
156 Ga0207641_10357170 3300026088 Bacteria 1394
157 Ga0207641_10593663 3300026088 Bacteria 1083
158 Ga0207648_10004869 3300026089 Bacteria 13690
159 Ga0207676_10003107 3300026095 Bacteria 11849
160 Ga0207674_10105386 3300026116 Bacteria 2798
161 Ga0207674_10306261 3300026116 Bacteria 1538
162 Ga0207675_100002949 3300026118 Bacteria 16729
163 Ga0207675_100011263 3300026118 Bacteria 8375
164 Ga0207675_100044693 3300026118 Bacteria 4140
165 Ga0207683_10014654 3300026121 Bacteria 6678
166 Ga0207683_10056349 3300026121 Bacteria 3447
167 Ga0207683_10081214 3300026121 Bacteria 2877
168 Ga0209971_1025878 3300027682 Bacteria 1402
169 Ga0207428_10008110 3300027907 Bacteria 9519
170 Ga0207428_10041811 3300027907 Bacteria 3709
171 Ga0207428_10072783 3300027907 Bacteria 2697
172 Ga0207428_10092787 3300027907 Bacteria 2343
173 Ga0207428_10123457 3300027907 Bacteria 1984
174 Ga0268266_10066423 3300028379 Bacteria 3119
175 Ga0268266_10120731 3300028379 Bacteria 2332
176 Ga0268265_10002021 3300028380 Bacteria 15917
177 Ga0268265_10114121 3300028380 Bacteria 2212
178 Ga0268264_10044676 3300028381 Bacteria 3675
179 Ga0265338_10238581 3300028800 Bacteria 1348
180 Ga0265770_1000304 3300030878 Bacteria 6669
181 Ga0265760_10001385 3300031090 Bacteria 7113
182 Ga0307408_100019871 3300031548 Bacteria 4525
183 Ga0307408_100280192 3300031548 Bacteria 1388
184 Ga0316575_10001493 3300031665 Bacteria 7552
185 Ga0316575_10025914 3300031665 Bacteria 2277
186 Ga0316578_10026778 3300031728 Bacteria 3253
187 Ga0307413_10040649 3300031824 Bacteria 2715
188 Ga0307410_10057114 3300031852 Bacteria 2656
189 Ga0307406_10085626 3300031901 Bacteria 2108
190 Ga0307407_10026773 3300031903 Bacteria 3059
191 Ga0307412_10011602 3300031911 Bacteria 5110
192 Ga0307412_10074927 3300031911 Bacteria 2320
193 Ga0307409_100019806 3300031995 Bacteria 4568
194 Ga0307409_100151799 3300031995 Bacteria 2012
195 Ga0307416_100006976 3300032002 Bacteria 7123
196 Ga0307416_100037042 3300032002 Bacteria 3749
197 Ga0307416_100596844 3300032002 Bacteria 1183
198 Ga0307411_10017072 3300032005 Bacteria 4124
199 Ga0307411_10070186 3300032005 Bacteria 2370
200 Ga0307411_10204188 3300032005 Bacteria 1520
201 Ga0307415_100076242 3300032126 Bacteria 2376
202 Ga0307415_100391619 3300032126 Bacteria 1183
203 Ga0316580_10009313 3300032139 Bacteria 2950
204 Ga0373930_0005720 3300034816 Bacteria 2076
205 Ga0316574_0032274 3300035398 Bacteria 3182
206 Ga0316574_0239445 3300035398 Bacteria 1160
207 Ga0316582_0025599 3300036647 Bacteria 3545
208 Ga0316584_0027053 3300036712 Bacteria 4219
209 Ga0395899_0006928 3300037312 Bacteria 8778
210 Ga0395899_0093337 3300037312 Bacteria 2178
211 Ga0395900_0000992 3300037418 Bacteria 36889
212 Ga0395900_0036534 3300037418 Bacteria 5064
213 Ga0395900_0059863 3300037418 Bacteria 3920
214 Ga0395900_0420405 3300037418 Bacteria 1297
215 Ga0395898_0327665 3300037466 Bacteria 1460
216 Ga0395905_0027921 3300037471 Bacteria 5321
217 Ga0395905_0074984 3300037471 Bacteria 3170
218 Ga0395905_0244196 3300037471 Bacteria 1677
219 Ga0439453_0021112 3300041408 Bacteria 1172
220 Ga0450919_009018 3300042121 Bacteria 1150
221 Ga0450920_000423 3300042122 Bacteria 6609
222 Ga0450923_000265 3300042125 Bacteria 5201
223 Ga0450894_002255 3300042131 Bacteria 2614
224 Ga0450896_000010 3300042133 Bacteria 10059
225 Ga0450896_011154 3300042133 Bacteria 1264
226 Ga0450907_002324 3300042146 Bacteria 3677
227 Ga0439446_0004492 3300042156 Bacteria 3538
228 Ga0450908_000545 3300042184 Bacteria 7229
229 Ga0450908_003723 3300042184 Bacteria 2954
230 Ga0451577_0058939 3300042876 Bacteria 3423
231 Ga0451577_0124546 3300042876 Bacteria 2309
232 Ga0466969_0075168 3300044656 Bacteria 1620
233 Ga0466972_0004758 3300044658 Bacteria 6797
234 Ga0466972_0064867 3300044658 Bacteria 1747
235 Ga0466965_0044311 3300044683 Bacteria 2198
236 Ga0466966_0033025 3300044684 Bacteria 3350
237 Ga0466964_0002589 3300044706 Bacteria 6462
238 Ga0453684_0081953 3300044712 Bacteria 4021
239 Ga0453684_0317192 3300044712 Bacteria 1766
240 Ga0466968_0003632 3300044735 Bacteria 5715
241 Ga0466970_0172693 3300044765 Bacteria 1198
242 Ga0466957_0012682 3300044842 Bacteria 4883
243 Ga0466957_0208127 3300044842 Bacteria 1287
244 Ga0466957_0314903 3300044842 Bacteria 1054
245 Ga0466959_0012399 3300045049 Bacteria 6158
246 Ga0451576_0006856 3300045051 Bacteria 13809
247 Ga0451576_0113928 3300045051 Bacteria 2814
248 Ga0451576_0363178 3300045051 Bacteria 1516
249 Ga0466967_0041804 3300045976 Bacteria 3956
250 Ga0495617_000104 3300046452 Bacteria 61298
251 Ga0495617_049847 3300046452 Bacteria 1393
252 Ga0495627_001021 3300046453 Bacteria 18746
253 Ga0495603_0003286 3300046455 Bacteria 9630
254 Ga0495590_0000179 3300046457 Bacteria 37217
255 Ga0495590_0001207 3300046457 Bacteria 11301
256 Ga0495590_0002723 3300046457 Bacteria 7299
257 Ga0495591_000127 3300046458 Bacteria 83271
258 Ga0495591_008318 3300046458 Bacteria 4269
259 Ga0495653_0024831 3300046463 Bacteria 4823
260 Ga0495653_0052113 3300046463 Bacteria 3137
261 Ga0495650_0000458 3300046471 Bacteria 63663
262 Ga0495650_0021617 3300046471 Bacteria 3103
263 Ga0495650_0046597 3300046471 Bacteria 1818
264 Ga0495582_0002269 3300046473 Bacteria 10757
265 Ga0495605_0000039 3300046474 Bacteria 196802
266 Ga0495605_0000445 3300046474 Bacteria 37241
267 Ga0495605_0006494 3300046474 Bacteria 6717
268 Ga0495605_0020041 3300046474 Bacteria 3558
269 Ga0495605_0022905 3300046474 Bacteria 3291
270 Ga0495605_0029613 3300046474 Bacteria 2814
271 Ga0495584_0000611 3300046491 Bacteria 23905
272 Ga0495584_0000923 3300046491 Bacteria 18628
273 Ga0495584_0001206 3300046491 Bacteria 15841
274 Ga0495584_0001621 3300046491 Bacteria 13232
275 Ga0495584_0002947 3300046491 Bacteria 9473
276 Ga0495584_0007947 3300046491 Bacteria 5514
277 Ga0495584_0035086 3300046491 Bacteria 2535
278 Ga0495584_0057806 3300046491 Bacteria 1951
279 Ga0495585_0002267 3300046492 Bacteria 13909
280 Ga0495585_0003173 3300046492 Bacteria 11254
281 Ga0495585_0004115 3300046492 Bacteria 9531
282 Ga0495585_0009756 3300046492 Bacteria 5746
283 Ga0495585_0010382 3300046492 Bacteria 5545
284 Ga0495585_0014103 3300046492 Bacteria 4666
285 Ga0495585_0015922 3300046492 Bacteria 4362
286 Ga0495585_0016058 3300046492 Bacteria 4341
287 Ga0495585_0030995 3300046492 Bacteria 3039
288 Ga0495585_0031225 3300046492 Bacteria 3024
289 Ga0495585_0051771 3300046492 Bacteria 2274
290 Ga0495585_0195208 3300046492 Bacteria 1033
291 Ga0495594_0023427 3300046499 Bacteria 3308
292 Ga0495594_0039972 3300046499 Bacteria 2565
293 Ga0495596_0000693 3300046500 Bacteria 20891
294 Ga0495596_0006700 3300046500 Bacteria 5271
295 Ga0495596_0018120 3300046500 Bacteria 2905
296 Ga0495596_0020594 3300046500 Bacteria 2698
297 Ga0495596_0037631 3300046500 Bacteria 1912
298 Ga0495596_0038440 3300046500 Bacteria 1891
299 Ga0495607_0001269 3300046501 Bacteria 22570
300 Ga0495607_0002439 3300046501 Bacteria 15146
301 Ga0495607_0006218 3300046501 Bacteria 8422
302 Ga0495607_0017431 3300046501 Bacteria 4609
303 Ga0495607_0018737 3300046501 Bacteria 4403
304 Ga0495607_0033717 3300046501 Bacteria 3113
305 Ga0495583_0000116 3300046506 Bacteria 135355
306 Ga0495583_0000881 3300046506 Bacteria 36218
307 Ga0495583_0004966 3300046506 Bacteria 9230
308 Ga0495583_0014374 3300046506 Bacteria 4371
309 Ga0495583_0024832 3300046506 Bacteria 3004
310 Ga0495583_0033790 3300046506 Bacteria 2456
311 Ga0495583_0041449 3300046506 Bacteria 2156
312 Ga0495606_0010194 3300046507 Bacteria 7834
313 Ga0495606_0010670 3300046507 Bacteria 7595
314 Ga0495606_0012517 3300046507 Bacteria 6795
315 Ga0495606_0089164 3300046507 Bacteria 1900
316 Ga0495610_0000452 3300046512 Bacteria 42500
317 Ga0495616_0001143 3300046513 Bacteria 18750
318 Ga0495616_0002215 3300046513 Bacteria 12998
319 Ga0495616_0004692 3300046513 Bacteria 8572
320 Ga0495616_0020722 3300046513 Bacteria 3571
321 Ga0495616_0027545 3300046513 Bacteria 3014
322 Ga0495616_0062458 3300046513 Bacteria 1824
323 Ga0495620_0004231 3300046515 Bacteria 8116
324 Ga0495631_0000480 3300046518 Bacteria 26693
325 Ga0495631_0002440 3300046518 Bacteria 10485
326 Ga0495631_0004833 3300046518 Bacteria 7102
327 Ga0495631_0012560 3300046518 Bacteria 4133
328 Ga0495631_0020346 3300046518 Bacteria 3101
329 Ga0495631_0034589 3300046518 Bacteria 2264
330 Ga0495631_0044541 3300046518 Bacteria 1954
331 Ga0495632_0000103 3300046519 Bacteria 86898
332 Ga0495632_0000430 3300046519 Bacteria 39988
333 Ga0495632_0001860 3300046519 Bacteria 16956
334 Ga0495632_0009344 3300046519 Bacteria 5919
335 Ga0495632_0011598 3300046519 Bacteria 5133
336 Ga0495632_0012757 3300046519 Bacteria 4826
337 Ga0495632_0024594 3300046519 Bacteria 3196
338 Ga0495637_0000029 3300046520 Bacteria 143929
339 Ga0495637_0005839 3300046520 Bacteria 6228
340 Ga0495637_0006019 3300046520 Bacteria 6128
341 Ga0495643_0002233 3300046522 Bacteria 15734
342 Ga0495643_0003666 3300046522 Bacteria 11145
343 Ga0495643_0007173 3300046522 Bacteria 7230
344 Ga0495643_0047184 3300046522 Bacteria 2333
345 Ga0495644_0032399 3300046523 Bacteria 1974
346 Ga0495648_0000795 3300046524 Bacteria 33423
347 Ga0495648_0009583 3300046524 Bacteria 7476
348 Ga0495648_0013788 3300046524 Bacteria 5955
349 Ga0495648_0020208 3300046524 Bacteria 4655
350 Ga0495648_0031075 3300046524 Bacteria 3522
351 Ga0495648_0088102 3300046524 Bacteria 1745
352 Ga0495648_0150122 3300046524 Bacteria 1216
353 Ga0495663_0001068 3300046525 Bacteria 8944
354 Ga0495663_0061055 3300046525 Bacteria 1185
355 Ga0495666_0000504 3300046526 Bacteria 17330
356 Ga0495642_0000469 3300046528 Bacteria 20946
357 Ga0495642_0002531 3300046528 Bacteria 7394
358 Ga0495642_0003257 3300046528 Bacteria 6428
359 Ga0495642_0008030 3300046528 Bacteria 4037
360 Ga0495642_0021116 3300046528 Bacteria 2559
361 Ga0495642_0122650 3300046528 Bacteria 1115
362 Ga0495652_0030667 3300046529 Bacteria 4713
363 Ga0495654_0033497 3300046530 Bacteria 2599
364 Ga0495654_0058421 3300046530 Bacteria 1861
365 Ga0495654_0058749 3300046530 Bacteria 1854
366 Ga0495654_0072991 3300046530 Bacteria 1623
367 Ga0495654_0073682 3300046530 Bacteria 1614
368 Ga0495665_0009102 3300046531 Bacteria 5382
369 Ga0495665_0009467 3300046531 Bacteria 5273
370 Ga0495665_0082504 3300046531 Bacteria 1690
371 Ga0495586_0028584 3300046535 Bacteria 2983
372 Ga0495586_0054079 3300046535 Bacteria 2175
373 Ga0495609_0008158 3300046538 Bacteria 5146
374 Ga0495609_0010397 3300046538 Bacteria 4464
375 Ga0495609_0014122 3300046538 Bacteria 3759
376 Ga0495609_0014754 3300046538 Bacteria 3668
377 Ga0495609_0137183 3300046538 Bacteria 1045
378 Ga0495597_0000975 3300046542 Bacteria 22068
379 Ga0495597_0001582 3300046542 Bacteria 16002
380 Ga0495597_0003431 3300046542 Bacteria 9258
381 Ga0495597_0003997 3300046542 Bacteria 8284
382 Ga0495597_0005815 3300046542 Bacteria 6461
383 Ga0495633_0006535 3300046558 Bacteria 6889
384 Ga0495633_0117069 3300046558 Bacteria 1235
385 Ga0495668_0002707 3300046616 Bacteria 14215
386 Ga0495668_0003785 3300046616 Bacteria 11086
387 Ga0495668_0003845 3300046616 Bacteria 10990
388 Ga0495668_0018825 3300046616 Bacteria 3989
389 Ga0495668_0021434 3300046616 Bacteria 3705
390 Ga0495611_0000701 3300046648 Bacteria 18999
391 Ga0495611_0011941 3300046648 Bacteria 3688
392 Ga0495611_0015461 3300046648 Bacteria 3263
393 Ga0495611_0020830 3300046648 Bacteria 2826
394 Ga0495611_0051398 3300046648 Bacteria 1857
395 Ga0495635_0012232 3300046663 Bacteria 6014
396 Ga0495661_0001196 3300046665 Bacteria 22530
397 Ga0495661_0001409 3300046665 Bacteria 20155
398 Ga0495661_0001667 3300046665 Bacteria 18095
399 Ga0495661_0001962 3300046665 Bacteria 16328
400 Ga0495661_0019662 3300046665 Bacteria 4421
401 Ga0495661_0020800 3300046665 Bacteria 4278
402 Ga0495661_0026283 3300046665 Bacteria 3750
403 Ga0495661_0027605 3300046665 Bacteria 3641
404 Ga0495661_0028911 3300046665 Bacteria 3542
405 Ga0495661_0049860 3300046665 Bacteria 2536
406 Ga0495661_0061333 3300046665 Bacteria 2232
407 Ga0495588_0000059 3300046674 Bacteria 263358
408 Ga0495588_0001562 3300046674 Bacteria 9808
409 Ga0495588_0004011 3300046674 Bacteria 6475
410 Ga0495588_0127656 3300046674 Bacteria 1341
411 Ga0495623_0002959 3300046679 Bacteria 11176
412 Ga0495669_0000781 3300046684 Bacteria 13593
413 Ga0495669_0003090 3300046684 Bacteria 6846
414 Ga0495669_0077351 3300046684 Bacteria 1523
415 Ga0495613_0287028 3300046689 Bacteria 1141
416 Ga0495670_0001638 3300046691 Bacteria 10957
417 Ga0495670_0002386 3300046691 Bacteria 9255
418 Ga0495670_0015246 3300046691 Bacteria 3778
419 Ga0495670_0018789 3300046691 Bacteria 3404
420 Ga0495670_0037706 3300046691 Bacteria 2409
421 Ga0495671_0001145 3300046692 Bacteria 18227
422 Ga0495671_0001936 3300046692 Bacteria 13281
423 Ga0495671_0006810 3300046692 Bacteria 6565
424 Ga0495671_0010211 3300046692 Bacteria 5215
425 Ga0495649_0001435 3300046694 Bacteria 18015
426 Ga0495649_0001621 3300046694 Bacteria 16733
427 Ga0495649_0040553 3300046694 Bacteria 2549
428 Ga0495649_0082829 3300046694 Bacteria 1714
429 Ga0495589_0000047 3300046794 Bacteria 117810
430 Ga0495589_0000752 3300046794 Bacteria 20816
431 Ga0495589_0002437 3300046794 Bacteria 10453
432 Ga0495589_0119664 3300046794 Bacteria 1268
433 Ga0495600_0026151 3300046809 Bacteria 3765
434 Ga0495660_0000135 3300046810 Bacteria 80391
435 Ga0495660_0006314 3300046810 Bacteria 7026
436 Ga0495660_0015921 3300046810 Bacteria 4339
437 Ga0495660_0041442 3300046810 Bacteria 2549
438 Ga0495660_0047736 3300046810 Bacteria 2343
439 Ga0495660_0122677 3300046810 Bacteria 1312
440 Ga0495604_0038720 3300047317 Bacteria 3751
441 Ga0495604_0142603 3300047317 Bacteria 1710
442 Ga0495674_0031550 3300047319 Bacteria 4813
443 Ga0495672_0000175 3300047320 Bacteria 93127
444 Ga0495672_0001994 3300047320 Bacteria 19290
445 Ga0495672_0008748 3300047320 Bacteria 7422
446 Ga0495672_0015357 3300047320 Bacteria 5202
447 Ga0495672_0146808 3300047320 Bacteria 1226
448 Ga0495676_0000249 3300047321 Bacteria 43337
449 Ga0495680_0021322 3300047322 Bacteria 5425
450 Ga0495680_0165041 3300047322 Bacteria 1606
451 Ga0495683_0000224 3300047323 Bacteria 53121
452 Ga0495683_0000379 3300047323 Bacteria 36310
453 Ga0495683_0030313 3300047323 Bacteria 2759
454 Ga0495683_0085767 3300047323 Bacteria 1530
455 Ga0495687_000145 3300047443 Bacteria 108089
456 Ga0495687_000146 3300047443 Bacteria 107228
457 Ga0495687_000431 3300047443 Bacteria 51764
458 Ga0495687_000987 3300047443 Bacteria 28644
459 Ga0495687_128686 3300047443 Bacteria 900
460 Ga0495675_0005786 3300047444 Bacteria 7558
461 Ga0495675_0009434 3300047444 Bacteria 6072
462 Ga0495675_0050420 3300047444 Bacteria 2646
463 Ga0495675_0193596 3300047444 Bacteria 1240
464 Ga0495677_0001206 3300047445 Bacteria 10351
465 Ga0495677_0001850 3300047445 Bacteria 8457
466 Ga0495677_0002504 3300047445 Bacteria 7193
467 Ga0495677_0007827 3300047445 Bacteria 3980
468 Ga0495677_0036217 3300047445 Bacteria 1802
469 Ga0495679_001114 3300047446 Bacteria 16202
470 Ga0495679_014147 3300047446 Bacteria 2968
471 Ga0495679_016473 3300047446 Bacteria 2674
472 Ga0495685_005512 3300047447 Bacteria 4133
473 Ga0495685_010208 3300047447 Bacteria 3147
474 Ga0495681_0001400 3300047470 Bacteria 18155
475 Ga0495681_0003608 3300047470 Bacteria 10767
476 Ga0495681_0008588 3300047470 Bacteria 6384
477 Ga0495681_0009217 3300047470 Bacteria 6101
478 Ga0495681_0016830 3300047470 Bacteria 4079
479 Ga0495681_0053176 3300047470 Bacteria 1897
480 Ga0495686_0000240 3300047472 Bacteria 99258
481 Ga0495686_0002491 3300047472 Bacteria 17303
482 Ga0495686_0078497 3300047472 Bacteria 2020
483 Ga0495602_0071712 3300048088 Bacteria 2957
484 Ga0495626_0000047 3300048091 Bacteria 161939
485 Ga0495626_0000141 3300048091 Bacteria 91317
486 Ga0495626_0011869 3300048091 Bacteria 4587
487 Ga0495626_0013727 3300048091 Bacteria 4202
488 Ga0495626_0020501 3300048091 Bacteria 3292
489 Ga0495626_0022439 3300048091 Bacteria 3117
490 Ga0495626_0035611 3300048091 Bacteria 2375
491 Ga0495626_0039031 3300048091 Bacteria 2248
492 Ga0496100_0028287 3300048903 Bacteria 3456
493 Ga0496102_0000202 3300048905 Bacteria 80040
494 Ga0496102_0000582 3300048905 Bacteria 38683
495 Ga0496102_0142426 3300048905 Bacteria 2248
496 Ga0496102_0185238 3300048905 Bacteria 1962
497 Ga0496103_0004610 3300048906 Bacteria 8342
498 Ga0496103_0009233 3300048906 Bacteria 5842
499 Ga0496104_0090589 3300048907 Bacteria 2922
500 Ga0496105_0217293 3300048908 Bacteria 1556
501 Ga0496106_0035375 3300048909 Bacteria 3735
502 Ga0496106_0072129 3300048909 Bacteria 2640
503 Ga0496107_0208637 3300048910 Bacteria 1452
504 Ga0496108_0106417 3300048911 Bacteria 2395
505 Ga0496108_0127577 3300048911 Bacteria 2185
506 Ga0496109_0206027 3300048912 Bacteria 1849
507 Ga0496110_0000454 3300048913 Bacteria 27858
508 Ga0496110_0039283 3300048913 Bacteria 4121
509 Ga0496113_0029859 3300048916 Bacteria 3941
510 Ga0496113_0065748 3300048916 Bacteria 2745
511 Ga0496113_0441934 3300048916 Bacteria 1045
512 Ga0496114_0001018 3300048917 Bacteria 21052
513 Ga0496115_0516594 3300048918 Bacteria 958
514 Ga0496122_0004661 3300048925 Bacteria 16840
515 Ga0496122_0004891 3300048925 Bacteria 16272
516 Ga0496122_0028804 3300048925 Bacteria 4701
517 Ga0496122_0164218 3300048925 Bacteria 1349
518 Ga0496123_0001430 3300048926 Bacteria 33347
519 Ga0496123_0002318 3300048926 Bacteria 23910
520 Ga0496123_0039144 3300048926 Bacteria 3320
521 Ga0496124_0032515 3300048927 Bacteria 4605
522 Ga0496124_0078281 3300048927 Bacteria 2725
523 Ga0496125_0016060 3300048928 Bacteria 7208
524 Ga0496125_0049443 3300048928 Bacteria 3494
525 Ga0495678_000544 3300049459 Bacteria 36334
526 Ga0495678_000698 3300049459 Bacteria 30571
527 Ga0495678_001457 3300049459 Bacteria 18575
528 Ga0495678_006706 3300049459 Bacteria 6076
529 Ga0495682_0001112 3300049460 Bacteria 15642
530 Ga0495682_0047074 3300049460 Bacteria 1573
531 Ga0501298_020675 3300049521 Unclassified 1229
532 Ga0501034_0208146 3300049571 Bacteria 1912
533 Ga0501036_0002154 3300049572 Bacteria 15371
534 Ga0501036_0098694 3300049572 Bacteria 2469
535 Ga0501036_0408505 3300049572 Bacteria 1132
536 Ga0501037_0111761 3300049573 Bacteria 1968
537 Ga0501038_0036998 3300049574 Bacteria 4281
538 Ga0501038_0251052 3300049574 Bacteria 1401
539 Ga0501039_0005578 3300049575 Bacteria 9525
540 Ga0501039_0025869 3300049575 Bacteria 4512
541 Ga0501039_0050091 3300049575 Bacteria 3230
542 Ga0501039_0060846 3300049575 Bacteria 2924
543 Ga0501040_0000895 3300049576 Bacteria 18719
544 Ga0501040_0102178 3300049576 Bacteria 2000
545 Ga0501041_0002499 3300049577 Bacteria 10465
546 Ga0501041_0006167 3300049577 Bacteria 7006
547 Ga0501041_0046079 3300049577 Bacteria 2652
548 Ga0501041_0090457 3300049577 Bacteria 1889
549 Ga0501041_0277671 3300049577 Bacteria 1054
550 Ga0501042_0002392 3300049578 Bacteria 11500
551 Ga0501042_0009373 3300049578 Bacteria 6522
552 Ga0501042_0130800 3300049578 Bacteria 1809
553 Ga0501043_0055127 3300049579 Bacteria 3123
554 Ga0501046_0011525 3300049580 Bacteria 7559
555 Ga0501046_0083137 3300049580 Bacteria 2472
556 Ga0501046_0104215 3300049580 Bacteria 2174
557 Ga0501048_0001609 3300049582 Bacteria 17179
558 Ga0501048_0002534 3300049582 Bacteria 13979
559 Ga0501067_0004163 3300049583 Bacteria 7991
560 Ga0501068_0020792 3300049584 Bacteria 3829
561 Ga0501068_0080282 3300049584 Bacteria 2001
562 Ga0501069_0111909 3300049585 Bacteria 1555
563 Ga0501071_0000576 3300049587 Bacteria 19026
564 Ga0501071_0037011 3300049587 Bacteria 3482
565 Ga0501071_0131770 3300049587 Bacteria 1858
566 Ga0501072_0002515 3300049588 Bacteria 13729
567 Ga0501072_0005266 3300049588 Bacteria 9851
568 Ga0501072_0302939 3300049588 Bacteria 1270
569 Ga0501073_0012208 3300049589 Bacteria 6273
570 Ga0501073_0060039 3300049589 Bacteria 2654
571 Ga0501073_0393100 3300049589 Bacteria 958
572 Ga0501074_0074650 3300049590 Bacteria 2435
573 Ga0501075_0000831 3300049591 Bacteria 19430
574 Ga0501075_0013889 3300049591 Bacteria 5760
575 Ga0501075_0032595 3300049591 Bacteria 3871
576 Ga0501075_0062382 3300049591 Bacteria 2809
577 Ga0501076_0000169 3300049592 Bacteria 38046
578 Ga0501076_0045240 3300049592 Bacteria 3475
579 Ga0501076_0070380 3300049592 Bacteria 2797
580 Ga0501076_0086585 3300049592 Bacteria 2518
581 Ga0501076_0126290 3300049592 Bacteria 2073
582 Ga0501076_0154253 3300049592 Bacteria 1869
583 Ga0501077_0017765 3300049593 Bacteria 4493
584 Ga0501077_0080443 3300049593 Bacteria 2064
585 Ga0501079_0000300 3300049741 Bacteria 30601
586 Ga0501079_0063328 3300049741 Bacteria 2853
587 Ga0501080_0003284 3300049742 Bacteria 14289
588 Ga0501080_0040835 3300049742 Bacteria 4327
589 Ga0501080_0054724 3300049742 Bacteria 3716
590 Ga0501080_0117001 3300049742 Bacteria 2470
591 Ga0501080_0145167 3300049742 Bacteria 2193
592 Ga0501080_0226957 3300049742 Bacteria 1707
593 Ga0501081_0000559 3300049743 Bacteria 21161
594 Ga0501081_0006064 3300049743 Bacteria 7832
595 Ga0501081_0012069 3300049743 Bacteria 5662
596 Ga0501081_0013353 3300049743 Bacteria 5402
597 Ga0501081_0036531 3300049743 Bacteria 3350
598 Ga0501081_0060978 3300049743 Bacteria 2615
599 Ga0501081_0075406 3300049743 Bacteria 2355
600 Ga0501083_0020428 3300049744 Bacteria 4608
601 Ga0501083_0031766 3300049744 Bacteria 3624
602 Ga0501083_0080967 3300049744 Bacteria 2153
603 Ga0501035_0003049 3300049822 Bacteria 16067
604 Ga0501035_0037680 3300049822 Bacteria 4377
605 Ga0501035_0084283 3300049822 Bacteria 2803
606 Ga0501035_0113032 3300049822 Bacteria 2379
607 Ga0501045_0001189 3300049824 Bacteria 17314
608 Ga0501045_0032651 3300049824 Bacteria 3773
609 Ga0501045_0054380 3300049824 Bacteria 2926
610 Ga0501045_0085852 3300049824 Bacteria 2323
611 nmdc:mga05p37_1145_c1 3300050507 Bacteria 30507
612 nmdc:mga09592_138071_c1 3300050508 Bacteria 2100
613 nmdc:mga09592_3989_c1 3300050508 Bacteria 11894
614 nmdc:mga0qj67_114022_c1 3300050509 Bacteria 2183
615 nmdc:mga0qj67_83310_c1 3300050509 Bacteria 2564
616 nmdc:mga06r32_2704_c1 3300050510 Bacteria 15862
617 nmdc:mga06r32_6144_c1 3300050510 Bacteria 10785
618 nmdc:mga06r32_67680_c1 3300050510 Bacteria 3448
619 nmdc:mga06r32_9158_c1 3300050510 Bacteria 8923
620 nmdc:mga08y16_12463_c1 3300050511 Bacteria 8944
621 nmdc:mga08y16_173259_c1 3300050511 Bacteria 2241
622 nmdc:mga08y16_1919_c1 3300050511 Bacteria 20743
623 nmdc:mga0n895_274257_c1 3300050512 Bacteria 1711
624 nmdc:mga0n895_578485_c1 3300050512 Bacteria 1127
625 nmdc:mga0rr50_119064_c1 3300050513 Bacteria 2099
626 nmdc:mga0a205_3522_c1 3300050515 Bacteria 13991
627 Ga0495619_0118817 3300053085 Bacteria 1812
628 Ga0500583_0189242 3300053092 Bacteria 1024
629 Ga0500556_0000121 3300053104 Bacteria 67560
630 Ga0500588_0021762 3300053146 Bacteria 1736
631 Ga0500616_0000074 3300053153 Bacteria 222910
632 Ga0500616_0092118 3300053153 Unclassified 1499
633 Ga0500622_0010251 3300053156 Bacteria 5150
634 Ga0501084_0001791 3300054114 Bacteria 17108
635 Ga0501084_0015047 3300054114 Bacteria 6415
636 Ga0501084_0306571 3300054114 Bacteria 1341
637 Ga0501082_0004462 3300060353 Bacteria 12220
638 Ga0501082_0057629 3300060353 Bacteria 3346
639 Ga0501082_0060030 3300060353 Bacteria 3276
640 Ga0501082_0139361 3300060353 Bacteria 2105
641 Ga0466962_0040607 3300061719 Bacteria 2226
642 Ga0530510_0002658 3300061734 Bacteria 12282
643 Ga0530510_0024362 3300061734 Bacteria 4318
644 Ga0530510_0039342 3300061734 Bacteria 3413
645 2643796997 2643221556 Bacteria 7251154
646 2644469899 2643221684 Bacteria 7145183
647 2809147309 2808606418 Bacteria 6724496
648 8047676739 8047673197 Bacteria 7395230
649 Ga0500622_0004686
650 SwRhRL2b_contig_1927969
651 SwRhRL2b_contig_38418
652 Ga0065165_1001411
653 Ga0065704_10073332
654 Ga0065712_10075276
655 Ga0065715_10212272
656 Ga0065715_10224058
657 Ga0070690_100003324
658 Ga0070670_100005970
659 Ga0070670_100170949
660 Ga0070670_100284241
661 Ga0070677_10005189
662 Ga0068869_100079676
663 Ga0068869_100251148
664 Ga0068869_100312570
665 Ga0070689_100000518
666 Ga0070689_100142597
667 Ga0070687_100045706
668 Ga0070661_100004943
669 Ga0070668_100002230
670 Ga0070669_100090500
671 Ga0070669_100201868
672 Ga0070675_100106635
673 Ga0070675_100154374
674 Ga0070671_100037309
675 Ga0070674_100050435
676 Ga0070673_100052696
677 Ga0070673_100137870
678 Ga0070659_100359226
679 Ga0070667_100052602
680 Ga0070705_100002762
681 Ga0070678_100037982
682 Ga0070662_100002859
683 Ga0070662_100313558
684 Ga0068867_100006399
685 Ga0068867_100151374
686 Ga0070685_10016714
687 Ga0070679_100056795
688 Ga0070684_100000535
689 Ga0070672_100046176
690 Ga0070672_100150723
691 Ga0070686_100460882
692 Ga0070695_100097401
693 Ga0070665_100008198
694 Ga0070704_100334504
695 Ga0070664_100006562
696 Ga0068857_100073574
697 Ga0068857_100451728
698 Ga0070702_100011993
699 Ga0068859_100000800
700 Ga0068859_100191177
701 Ga0068864_100003622
702 Ga0068861_100003141
703 Ga0068861_100069973
704 Ga0068861_100176819
705 Ga0068861_100182096
706 Ga0068863_100000641
707 Ga0068858_100016716
708 Ga0068860_100008543
709 Ga0068862_100006284
710 Ga0068862_100009495
711 Ga0068862_100057279
712 Ga0070716_100079196
713 Ga0068871_100503914
714 Ga0075428_100011470
715 Ga0075428_100027952
716 Ga0075428_100082925
717 Ga0075430_100017829
718 Ga0075430_100301414
719 Ga0075431_100010551
720 Ga0075431_100026041
721 Ga0075431_100174283
722 Ga0075431_100240387
723 Ga0075433_10002252
724 Ga0075434_100000822
725 Ga0075434_100324572
726 Ga0075429_100002254
727 Ga0075429_100074277
728 Ga0068865_100049949
729 Ga0097620_100000800
730 Ga0097620_100191170
731 Ga0075435_100029490
732 Ga0111539_10014678
733 Ga0111539_10040565
734 Ga0111539_10058623
735 Ga0111539_10073831
736 Ga0111539_10308552
737 Ga0105247_10084290
738 Ga0114129_10002637
739 Ga0114129_10012563
740 Ga0114129_10052221
741 Ga0105243_10023263
742 Ga0105243_10050933
743 Ga0105242_10381456
744 Ga0105248_10000895
745 Ga0105249_10020639
746 Ga0105249_10022662
747 Ga0157378_10288501
748 Ga0157372_10319779
749 Ga0157375_10027071
750 Ga0157375_10512477
751 Ga0157514_132735
752 Ga0163163_10003361
753 Ga0163163_10063722
754 Ga0163163_10197026
755 Ga0163163_10564295
756 Ga0157380_10140281
757 Ga0157380_10304133
758 Ga0157377_10001449
759 Ga0157379_10070040
760 Ga0209563_100022
761 Ga0209677_110628
762 Ga0207697_10038466
763 Ga0207682_10018244
764 Ga0207682_10045950
765 Ga0207642_10045384
766 Ga0207688_10080977
767 Ga0207645_10058030
768 Ga0207643_10017292
769 Ga0207660_10195433
770 Ga0207662_10002920
771 Ga0207657_10015055
772 Ga0207649_10050897
773 Ga0207650_10019103
774 Ga0207659_10004777
775 Ga0207659_10030982
776 Ga0207659_10447045
777 Ga0207644_10103904
778 Ga0207706_10005686
779 Ga0207686_10219726
780 Ga0207709_10045067
781 Ga0207670_10011922
782 Ga0207670_10266156
783 Ga0207669_10031133
784 Ga0207704_10017981
785 Ga0207665_10091048
786 Ga0207691_10009188
787 Ga0207691_10014816
788 Ga0207691_10054902
789 Ga0207711_10090776
790 Ga0207689_10016166
791 Ga0207689_10018683
792 Ga0207689_10020364
793 Ga0207679_10003697
794 Ga0207679_10183586
795 Ga0207651_10012849
796 Ga0207651_10136885
797 Ga0207712_10009525
798 Ga0207712_10037028
799 Ga0207668_10002493
800 Ga0207668_10178882
801 Ga0207658_10046714
802 Ga0207703_10049246
803 Ga0207641_10006163
804 Ga0207641_10357170
805 Ga0207641_10593663
806 Ga0207648_10004869
807 Ga0207676_10003107
808 Ga0207674_10105386
809 Ga0207674_10306261
810 Ga0207675_100002949
811 Ga0207675_100011263
812 Ga0207675_100044693
813 Ga0207683_10014654
814 Ga0207683_10056349
815 Ga0207683_10081214
816 Ga0209971_1025878
817 Ga0207428_10008110
818 Ga0207428_10041811
819 Ga0207428_10072783
820 Ga0207428_10092787
821 Ga0207428_10123457
822 Ga0268266_10066423
823 Ga0268266_10120731
824 Ga0268265_10002021
825 Ga0268265_10114121
826 Ga0268264_10044676
827 Ga0265338_10238581
828 Ga0265770_1000304
829 Ga0265760_10001385
830 Ga0307408_100019871
831 Ga0307408_100280192
832 Ga0316575_10001493
833 Ga0316575_10025914
834 Ga0316578_10026778
835 Ga0307413_10040649
836 Ga0307410_10057114
837 Ga0307406_10085626
838 Ga0307407_10026773
839 Ga0307412_10011602
840 Ga0307412_10074927
841 Ga0307409_100019806
842 Ga0307409_100151799
843 Ga0307416_100006976
844 Ga0307416_100037042
845 Ga0307416_100596844
846 Ga0307411_10017072
847 Ga0307411_10070186
848 Ga0307411_10204188
849 Ga0307415_100076242
850 Ga0307415_100391619
851 Ga0316580_10009313
852 Ga0373930_0005720
853 Ga0316574_0032274
854 Ga0316574_0239445
855 Ga0316582_0025599
856 Ga0316584_0027053
857 Ga0395899_0006928
858 Ga0395899_0093337
859 Ga0395900_0000992
860 Ga0395900_0036534
861 Ga0395900_0059863
862 Ga0395900_0420405
863 Ga0395898_0327665
864 Ga0395905_0027921
865 Ga0395905_0074984
866 Ga0395905_0244196
867 Ga0439453_0021112
868 Ga0450919_009018
869 Ga0450920_000423
870 Ga0450923_000265
871 Ga0450894_002255
872 Ga0450896_000010
873 Ga0450896_011154
874 Ga0450907_002324
875 Ga0439446_0004492
876 Ga0450908_000545
877 Ga0450908_003723
878 Ga0451577_0058939
879 Ga0451577_0124546
880 Ga0466969_0075168
881 Ga0466972_0004758
882 Ga0466972_0064867
883 Ga0466965_0044311
884 Ga0466966_0033025
885 Ga0466964_0002589
886 Ga0453684_0081953
887 Ga0453684_0317192
888 Ga0466968_0003632
889 Ga0466970_0172693
890 Ga0466957_0012682
891 Ga0466957_0208127
892 Ga0466957_0314903
893 Ga0466959_0012399
894 Ga0451576_0006856
895 Ga0451576_0113928
896 Ga0451576_0363178
897 Ga0466967_0041804
898 Ga0495617_000104
899 Ga0495617_049847
900 Ga0495627_001021
901 Ga0495603_0003286
902 Ga0495590_0000179
903 Ga0495590_0001207
904 Ga0495590_0002723
905 Ga0495591_000127
906 Ga0495591_008318
907 Ga0495653_0024831
908 Ga0495653_0052113
909 Ga0495650_0000458
910 Ga0495650_0021617
911 Ga0495650_0046597
912 Ga0495582_0002269
913 Ga0495605_0000039
914 Ga0495605_0000445
915 Ga0495605_0006494
916 Ga0495605_0020041
917 Ga0495605_0022905
918 Ga0495605_0029613
919 Ga0495584_0000611
920 Ga0495584_0000923
921 Ga0495584_0001206
922 Ga0495584_0001621
923 Ga0495584_0002947
924 Ga0495584_0007947
925 Ga0495584_0035086
926 Ga0495584_0057806
927 Ga0495585_0002267
928 Ga0495585_0003173
929 Ga0495585_0004115
930 Ga0495585_0009756
931 Ga0495585_0010382
932 Ga0495585_0014103
933 Ga0495585_0015922
934 Ga0495585_0016058
935 Ga0495585_0030995
936 Ga0495585_0031225
937 Ga0495585_0051771
938 Ga0495585_0195208
939 Ga0495594_0023427
940 Ga0495594_0039972
941 Ga0495596_0000693
942 Ga0495596_0006700
943 Ga0495596_0018120
944 Ga0495596_0020594
945 Ga0495596_0037631
946 Ga0495596_0038440
947 Ga0495607_0001269
948 Ga0495607_0002439
949 Ga0495607_0006218
950 Ga0495607_0017431
951 Ga0495607_0018737
952 Ga0495607_0033717
953 Ga0495583_0000116
954 Ga0495583_0000881
955 Ga0495583_0004966
956 Ga0495583_0014374
957 Ga0495583_0024832
958 Ga0495583_0033790
959 Ga0495583_0041449
960 Ga0495606_0010194
961 Ga0495606_0010670
962 Ga0495606_0012517
963 Ga0495606_0089164
964 Ga0495610_0000452
965 Ga0495616_0001143
966 Ga0495616_0002215
967 Ga0495616_0004692
968 Ga0495616_0020722
969 Ga0495616_0027545
970 Ga0495616_0062458
971 Ga0495620_0004231
972 Ga0495631_0000480
973 Ga0495631_0002440
974 Ga0495631_0004833
975 Ga0495631_0012560
976 Ga0495631_0020346
977 Ga0495631_0034589
978 Ga0495631_0044541
979 Ga0495632_0000103
980 Ga0495632_0000430
981 Ga0495632_0001860
982 Ga0495632_0009344
983 Ga0495632_0011598
984 Ga0495632_0012757
985 Ga0495632_0024594
986 Ga0495637_0000029
987 Ga0495637_0005839
988 Ga0495637_0006019
989 Ga0495643_0002233
990 Ga0495643_0003666
991 Ga0495643_0007173
992 Ga0495643_0047184
993 Ga0495644_0032399
994 Ga0495648_0000795
995 Ga0495648_0009583
996 Ga0495648_0013788
997 Ga0495648_0020208
998 Ga0495648_0031075
999 Ga0495648_0088102
1000 Ga0495648_0150122
1001 Ga0495663_0001068
1002 Ga0495663_0061055
1003 Ga0495666_0000504
1004 Ga0495642_0000469
1005 Ga0495642_0002531
1006 Ga0495642_0003257
1007 Ga0495642_0008030
1008 Ga0495642_0021116
1009 Ga0495642_0122650
1010 Ga0495652_0030667
1011 Ga0495654_0033497
1012 Ga0495654_0058421
1013 Ga0495654_0058749
1014 Ga0495654_0072991
1015 Ga0495654_0073682
1016 Ga0495665_0009102
1017 Ga0495665_0009467
1018 Ga0495665_0082504
1019 Ga0495586_0028584
1020 Ga0495586_0054079
1021 Ga0495609_0008158
1022 Ga0495609_0010397
1023 Ga0495609_0014122
1024 Ga0495609_0014754
1025 Ga0495609_0137183
1026 Ga0495597_0000975
1027 Ga0495597_0001582
1028 Ga0495597_0003431
1029 Ga0495597_0003997
1030 Ga0495597_0005815
1031 Ga0495633_0006535
1032 Ga0495633_0117069
1033 Ga0495668_0002707
1034 Ga0495668_0003785
1035 Ga0495668_0003845
1036 Ga0495668_0018825
1037 Ga0495668_0021434
1038 Ga0495611_0000701
1039 Ga0495611_0011941
1040 Ga0495611_0015461
1041 Ga0495611_0020830
1042 Ga0495611_0051398
1043 Ga0495635_0012232
1044 Ga0495661_0001196
1045 Ga0495661_0001409
1046 Ga0495661_0001667
1047 Ga0495661_0001962
1048 Ga0495661_0019662
1049 Ga0495661_0020800
1050 Ga0495661_0026283
1051 Ga0495661_0027605
1052 Ga0495661_0028911
1053 Ga0495661_0049860
1054 Ga0495661_0061333
1055 Ga0495588_0000059
1056 Ga0495588_0001562
1057 Ga0495588_0004011
1058 Ga0495588_0127656
1059 Ga0495623_0002959
1060 Ga0495669_0000781
1061 Ga0495669_0003090
1062 Ga0495669_0077351
1063 Ga0495613_0287028
1064 Ga0495670_0001638
1065 Ga0495670_0002386
1066 Ga0495670_0015246
1067 Ga0495670_0018789
1068 Ga0495670_0037706
1069 Ga0495671_0001145
1070 Ga0495671_0001936
1071 Ga0495671_0006810
1072 Ga0495671_0010211
1073 Ga0495649_0001435
1074 Ga0495649_0001621
1075 Ga0495649_0040553
1076 Ga0495649_0082829
1077 Ga0495589_0000047
1078 Ga0495589_0000752
1079 Ga0495589_0002437
1080 Ga0495589_0119664
1081 Ga0495600_0026151
1082 Ga0495660_0000135
1083 Ga0495660_0006314
1084 Ga0495660_0015921
1085 Ga0495660_0041442
1086 Ga0495660_0047736
1087 Ga0495660_0122677
1088 Ga0495604_0038720
1089 Ga0495604_0142603
1090 Ga0495674_0031550
1091 Ga0495672_0000175
1092 Ga0495672_0001994
1093 Ga0495672_0008748
1094 Ga0495672_0015357
1095 Ga0495672_0146808
1096 Ga0495676_0000249
1097 Ga0495680_0021322
1098 Ga0495680_0165041
1099 Ga0495683_0000224
1100 Ga0495683_0000379
1101 Ga0495683_0030313
1102 Ga0495683_0085767
1103 Ga0495687_000145
1104 Ga0495687_000146
1105 Ga0495687_000431
1106 Ga0495687_000987
1107 Ga0495687_128686
1108 Ga0495675_0005786
1109 Ga0495675_0009434
1110 Ga0495675_0050420
1111 Ga0495675_0193596
1112 Ga0495677_0001206
1113 Ga0495677_0001850
1114 Ga0495677_0002504
1115 Ga0495677_0007827
1116 Ga0495677_0036217
1117 Ga0495679_001114
1118 Ga0495679_014147
1119 Ga0495679_016473
1120 Ga0495685_005512
1121 Ga0495685_010208
1122 Ga0495681_0001400
1123 Ga0495681_0003608
1124 Ga0495681_0008588
1125 Ga0495681_0009217
1126 Ga0495681_0016830
1127 Ga0495681_0053176
1128 Ga0495686_0000240
1129 Ga0495686_0002491
1130 Ga0495686_0078497
1131 Ga0495602_0071712
1132 Ga0495626_0000047
1133 Ga0495626_0000141
1134 Ga0495626_0011869
1135 Ga0495626_0013727
1136 Ga0495626_0020501
1137 Ga0495626_0022439
1138 Ga0495626_0035611
1139 Ga0495626_0039031
1140 Ga0496100_0028287
1141 Ga0496102_0000202
1142 Ga0496102_0000582
1143 Ga0496102_0142426
1144 Ga0496102_0185238
1145 Ga0496103_0004610
1146 Ga0496103_0009233
1147 Ga0496104_0090589
1148 Ga0496105_0217293
1149 Ga0496106_0035375
1150 Ga0496106_0072129
1151 Ga0496107_0208637
1152 Ga0496108_0106417
1153 Ga0496108_0127577
1154 Ga0496109_0206027
1155 Ga0496110_0000454
1156 Ga0496110_0039283
1157 Ga0496113_0029859
1158 Ga0496113_0065748
1159 Ga0496113_0441934
1160 Ga0496114_0001018
1161 Ga0496115_0516594
1162 Ga0496122_0004661
1163 Ga0496122_0004891
1164 Ga0496122_0028804
1165 Ga0496122_0164218
1166 Ga0496123_0001430
1167 Ga0496123_0002318
1168 Ga0496123_0039144
1169 Ga0496124_0032515
1170 Ga0496124_0078281
1171 Ga0496125_0016060
1172 Ga0496125_0049443
1173 Ga0495678_000544
1174 Ga0495678_000698
1175 Ga0495678_001457
1176 Ga0495678_006706
1177 Ga0495682_0001112
1178 Ga0495682_0047074
1179 Ga0501298_020675
1180 Ga0501034_0208146
1181 Ga0501036_0002154
1182 Ga0501036_0098694
1183 Ga0501036_0408505
1184 Ga0501037_0111761
1185 Ga0501038_0036998
1186 Ga0501038_0251052
1187 Ga0501039_0005578
1188 Ga0501039_0025869
1189 Ga0501039_0050091
1190 Ga0501039_0060846
1191 Ga0501040_0000895
1192 Ga0501040_0102178
1193 Ga0501041_0002499
1194 Ga0501041_0006167
1195 Ga0501041_0046079
1196 Ga0501041_0090457
1197 Ga0501041_0277671
1198 Ga0501042_0002392
1199 Ga0501042_0009373
1200 Ga0501042_0130800
1201 Ga0501043_0055127
1202 Ga0501046_0011525
1203 Ga0501046_0083137
1204 Ga0501046_0104215
1205 Ga0501048_0001609
1206 Ga0501048_0002534
1207 Ga0501067_0004163
1208 Ga0501068_0020792
1209 Ga0501068_0080282
1210 Ga0501069_0111909
1211 Ga0501071_0000576
1212 Ga0501071_0037011
1213 Ga0501071_0131770
1214 Ga0501072_0002515
1215 Ga0501072_0005266
1216 Ga0501072_0302939
1217 Ga0501073_0012208
1218 Ga0501073_0060039
1219 Ga0501073_0393100
1220 Ga0501074_0074650
1221 Ga0501075_0000831
1222 Ga0501075_0013889
1223 Ga0501075_0032595
1224 Ga0501075_0062382
1225 Ga0501076_0000169
1226 Ga0501076_0045240
1227 Ga0501076_0070380
1228 Ga0501076_0086585
1229 Ga0501076_0126290
1230 Ga0501076_0154253
1231 Ga0501077_0017765
1232 Ga0501077_0080443
1233 Ga0501079_0000300
1234 Ga0501079_0063328
1235 Ga0501080_0003284
1236 Ga0501080_0040835
1237 Ga0501080_0054724
1238 Ga0501080_0117001
1239 Ga0501080_0145167
1240 Ga0501080_0226957
1241 Ga0501081_0000559
1242 Ga0501081_0006064
1243 Ga0501081_0012069
1244 Ga0501081_0013353
1245 Ga0501081_0036531
1246 Ga0501081_0060978
1247 Ga0501081_0075406
1248 Ga0501083_0020428
1249 Ga0501083_0031766
1250 Ga0501083_0080967
1251 Ga0501035_0003049
1252 Ga0501035_0037680
1253 Ga0501035_0084283
1254 Ga0501035_0113032
1255 Ga0501045_0001189
1256 Ga0501045_0032651
1257 Ga0501045_0054380
1258 Ga0501045_0085852
1259 nmdc:mga05p37_1145_c1
1260 nmdc:mga09592_138071_c1
1261 nmdc:mga09592_3989_c1
1262 nmdc:mga0qj67_114022_c1
1263 nmdc:mga0qj67_83310_c1
1264 nmdc:mga06r32_2704_c1
1265 nmdc:mga06r32_6144_c1
1266 nmdc:mga06r32_67680_c1
1267 nmdc:mga06r32_9158_c1
1268 nmdc:mga08y16_12463_c1
1269 nmdc:mga08y16_173259_c1
1270 nmdc:mga08y16_1919_c1
1271 nmdc:mga0n895_274257_c1
1272 nmdc:mga0n895_578485_c1
1273 nmdc:mga0rr50_119064_c1
1274 nmdc:mga0a205_3522_c1
1275 Ga0495619_0118817
1276 Ga0500583_0189242
1277 Ga0500556_0000121
1278 Ga0500588_0021762
1279 Ga0500616_0000074
1280 Ga0500616_0092118
1281 Ga0500622_0010251
1282 Ga0501084_0001791
1283 Ga0501084_0015047
1284 Ga0501084_0306571
1285 Ga0501082_0004462
1286 Ga0501082_0057629
1287 Ga0501082_0060030
1288 Ga0501082_0139361
1289 Ga0466962_0040607
1290 Ga0530510_0002658
1291 Ga0530510_0024362
1292 Ga0530510_0039342
1293 2643796997
1294 2644469899
1295 2809147309
1296 8047676739

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

107

358

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8746 36 297
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8337 36 297
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7695 20 301
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7625 20 301
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.7207 18 297
ID Description Score Start End Superfamily
af_P0AGK1_170_289_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9826 181 298 1.20.120.1780
af_P0AGK1_23_169_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9776 35 178 1.10.357.140
af_P0AGK1_170_289_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9586 181 298 1.20.120.1780
af_P0AGK1_23_169_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9516 35 178 1.10.357.140
af_Q8I7J4_224_349_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9412 181 299 1.20.120.1780
ID Description Score Start End GO Terms
AF-A0A521WIX1-F1-model_v4 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) 0.991 21 301 GO:0005886
GO:0006744
GO:0008412
AF-A0A2H9U6P2-F1-model_v4 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) 0.9909 20 297 GO:0005886
GO:0006744
GO:0008412
AF-A0A829Y5B9-F1-model_v4 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) 0.9904 20 301 GO:0005886
GO:0006744
GO:0008412
AF-A0A6N8XIL8-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9903 153 300 GO:0005886
GO:0006744
GO:0008412
AF-A0A382VXH5-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9893 141 298 GO:0005886
GO:0006744
GO:0008412

Map