F472415
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 648 | 289 | 1296 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300053156|Ga0500622_0004686|Ga0500622_0004686_3585_5435 |
| Length | 369 |
| Sequence | VADSQNAHNPDKTQPLDAMPAAPKPPPAQMDMLKPATSALSSSHSLPDIEQLRIPTPTSPVSDRFRWLGHKIATTAFVTEILPGAAAKLNAYAALTRLNKPIGIWLLLWPVLWALWLSSGGKPDPHVFIVFVLGTILTRSAGCAINDYADRNFDGHVKRTKNRPLVTGAVDPIEALALCAGLGLIALGLTLTLNQLAQKLTLVGGVLVVTYPFFKRFFPLPQAYLGIAFTWSVPMAYAAQTGDVPRAAIVMFLAGLAWTVAYDTMYAMVDREDDKKLGIRSSAILFGDADRFIIGIMQLMTLLGLWLIGHEMELGLWYGLGLAFAATFALYQQLLIRKRKPEDCFKAFLNNNYFGMSVFIGIFLEYTFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 117 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 126 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 127 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 128 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 129 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 130 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 131 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 137 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 138 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 139 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 140 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 141 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 142 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 143 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 144 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 153 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 236 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 237 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 238 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 239 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 279 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 280 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 281 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 285 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 286 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 287 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 288 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 289 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0.31 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.54 |
| Nodule | 0 |
| Rhizoplane | 3.4 |
| Rhizosphere | 93.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500622_0004686 | 3300053156 | Bacteria | 8461 |
| 2 | SwRhRL2b_contig_1927969 | 2162886007 | Bacteria | 2814 |
| 3 | SwRhRL2b_contig_38418 | 2162886007 | Bacteria | 2814 |
| 4 | Ga0065165_1001411 | 3300005262 | Bacteria | 26128 |
| 5 | Ga0065704_10073332 | 3300005289 | Bacteria | 7281 |
| 6 | Ga0065712_10075276 | 3300005290 | Bacteria | 3895 |
| 7 | Ga0065715_10212272 | 3300005293 | Bacteria | 1309 |
| 8 | Ga0065715_10224058 | 3300005293 | Bacteria | 1260 |
| 9 | Ga0070690_100003324 | 3300005330 | Bacteria | 8763 |
| 10 | Ga0070670_100005970 | 3300005331 | Bacteria | 10302 |
| 11 | Ga0070670_100170949 | 3300005331 | Bacteria | 1885 |
| 12 | Ga0070670_100284241 | 3300005331 | Bacteria | 1445 |
| 13 | Ga0070677_10005189 | 3300005333 | Bacteria | 4283 |
| 14 | Ga0068869_100079676 | 3300005334 | Bacteria | 2441 |
| 15 | Ga0068869_100251148 | 3300005334 | Bacteria | 1412 |
| 16 | Ga0068869_100312570 | 3300005334 | Bacteria | 1272 |
| 17 | Ga0070689_100000518 | 3300005340 | Bacteria | 22782 |
| 18 | Ga0070689_100142597 | 3300005340 | Bacteria | 1927 |
| 19 | Ga0070687_100045706 | 3300005343 | Bacteria | 2238 |
| 20 | Ga0070661_100004943 | 3300005344 | Bacteria | 9177 |
| 21 | Ga0070668_100002230 | 3300005347 | Bacteria | 14244 |
| 22 | Ga0070669_100090500 | 3300005353 | Bacteria | 2293 |
| 23 | Ga0070669_100201868 | 3300005353 | Bacteria | 1565 |
| 24 | Ga0070675_100106635 | 3300005354 | Bacteria | 2365 |
| 25 | Ga0070675_100154374 | 3300005354 | Bacteria | 1970 |
| 26 | Ga0070671_100037309 | 3300005355 | Bacteria | 4030 |
| 27 | Ga0070674_100050435 | 3300005356 | Bacteria | 2865 |
| 28 | Ga0070673_100052696 | 3300005364 | Bacteria | 3193 |
| 29 | Ga0070673_100137870 | 3300005364 | Bacteria | 2055 |
| 30 | Ga0070659_100359226 | 3300005366 | Bacteria | 1223 |
| 31 | Ga0070667_100052602 | 3300005367 | Bacteria | 3437 |
| 32 | Ga0070705_100002762 | 3300005440 | Bacteria | 8759 |
| 33 | Ga0070678_100037982 | 3300005456 | Bacteria | 3387 |
| 34 | Ga0070662_100002859 | 3300005457 | Bacteria | 10702 |
| 35 | Ga0070662_100313558 | 3300005457 | Bacteria | 1277 |
| 36 | Ga0068867_100006399 | 3300005459 | Bacteria | 8323 |
| 37 | Ga0068867_100151374 | 3300005459 | Bacteria | 1822 |
| 38 | Ga0070685_10016714 | 3300005466 | Bacteria | 3914 |
| 39 | Ga0070679_100056795 | 3300005530 | Bacteria | 3901 |
| 40 | Ga0070684_100000535 | 3300005535 | Bacteria | 26071 |
| 41 | Ga0070672_100046176 | 3300005543 | Bacteria | 3374 |
| 42 | Ga0070672_100150723 | 3300005543 | Bacteria | 1923 |
| 43 | Ga0070686_100460882 | 3300005544 | Bacteria | 979 |
| 44 | Ga0070695_100097401 | 3300005545 | Bacteria | 1975 |
| 45 | Ga0070665_100008198 | 3300005548 | Bacteria | 10578 |
| 46 | Ga0070704_100334504 | 3300005549 | Bacteria | 1273 |
| 47 | Ga0070664_100006562 | 3300005564 | Bacteria | 9385 |
| 48 | Ga0068857_100073574 | 3300005577 | Bacteria | 3045 |
| 49 | Ga0068857_100451728 | 3300005577 | Bacteria | 1201 |
| 50 | Ga0070702_100011993 | 3300005615 | Bacteria | 4327 |
| 51 | Ga0068859_100000800 | 3300005617 | Bacteria | 31891 |
| 52 | Ga0068859_100191177 | 3300005617 | Bacteria | 2131 |
| 53 | Ga0068864_100003622 | 3300005618 | Bacteria | 12771 |
| 54 | Ga0068861_100003141 | 3300005719 | Bacteria | 10915 |
| 55 | Ga0068861_100069973 | 3300005719 | Bacteria | 2716 |
| 56 | Ga0068861_100176819 | 3300005719 | Bacteria | 1773 |
| 57 | Ga0068861_100182096 | 3300005719 | Bacteria | 1750 |
| 58 | Ga0068863_100000641 | 3300005841 | Bacteria | 35462 |
| 59 | Ga0068858_100016716 | 3300005842 | Bacteria | 6890 |
| 60 | Ga0068860_100008543 | 3300005843 | Bacteria | 10204 |
| 61 | Ga0068862_100006284 | 3300005844 | Bacteria | 9886 |
| 62 | Ga0068862_100009495 | 3300005844 | Bacteria | 8050 |
| 63 | Ga0068862_100057279 | 3300005844 | Bacteria | 3342 |
| 64 | Ga0070716_100079196 | 3300006173 | Bacteria | 1956 |
| 65 | Ga0068871_100503914 | 3300006358 | Bacteria | 1091 |
| 66 | Ga0075428_100011470 | 3300006844 | Bacteria | 9859 |
| 67 | Ga0075428_100027952 | 3300006844 | Bacteria | 6241 |
| 68 | Ga0075428_100082925 | 3300006844 | Bacteria | 3498 |
| 69 | Ga0075430_100017829 | 3300006846 | Bacteria | 6043 |
| 70 | Ga0075430_100301414 | 3300006846 | Bacteria | 1325 |
| 71 | Ga0075431_100010551 | 3300006847 | Bacteria | 9287 |
| 72 | Ga0075431_100026041 | 3300006847 | Bacteria | 5997 |
| 73 | Ga0075431_100174283 | 3300006847 | Bacteria | 2210 |
| 74 | Ga0075431_100240387 | 3300006847 | Bacteria | 1842 |
| 75 | Ga0075433_10002252 | 3300006852 | Bacteria | 14650 |
| 76 | Ga0075434_100000822 | 3300006871 | Bacteria | 24682 |
| 77 | Ga0075434_100324572 | 3300006871 | Bacteria | 1560 |
| 78 | Ga0075429_100002254 | 3300006880 | Bacteria | 16146 |
| 79 | Ga0075429_100074277 | 3300006880 | Bacteria | 2962 |
| 80 | Ga0068865_100049949 | 3300006881 | Bacteria | 2887 |
| 81 | Ga0097620_100000800 | 3300006931 | Bacteria | 31891 |
| 82 | Ga0097620_100191170 | 3300006931 | Bacteria | 2131 |
| 83 | Ga0075435_100029490 | 3300007076 | Bacteria | 4306 |
| 84 | Ga0111539_10014678 | 3300009094 | Bacteria | 9774 |
| 85 | Ga0111539_10040565 | 3300009094 | Bacteria | 5603 |
| 86 | Ga0111539_10058623 | 3300009094 | Bacteria | 4567 |
| 87 | Ga0111539_10073831 | 3300009094 | Bacteria | 4020 |
| 88 | Ga0111539_10308552 | 3300009094 | Bacteria | 1841 |
| 89 | Ga0105247_10084290 | 3300009101 | Bacteria | 2008 |
| 90 | Ga0114129_10002637 | 3300009147 | Bacteria | 24969 |
| 91 | Ga0114129_10012563 | 3300009147 | Bacteria | 12058 |
| 92 | Ga0114129_10052221 | 3300009147 | Bacteria | 5737 |
| 93 | Ga0105243_10023263 | 3300009148 | Bacteria | 4716 |
| 94 | Ga0105243_10050933 | 3300009148 | Bacteria | 3273 |
| 95 | Ga0105242_10381456 | 3300009176 | Bacteria | 1310 |
| 96 | Ga0105248_10000895 | 3300009177 | Bacteria | 33359 |
| 97 | Ga0105249_10020639 | 3300009553 | Bacteria | 5890 |
| 98 | Ga0105249_10022662 | 3300009553 | Bacteria | 5628 |
| 99 | Ga0157378_10288501 | 3300013297 | Bacteria | 1584 |
| 100 | Ga0157372_10319779 | 3300013307 | Bacteria | 1807 |
| 101 | Ga0157375_10027071 | 3300013308 | Bacteria | 5355 |
| 102 | Ga0157375_10512477 | 3300013308 | Bacteria | 1363 |
| 103 | Ga0157514_132735 | 3300013874 | Bacteria | 1074 |
| 104 | Ga0163163_10003361 | 3300014325 | Bacteria | 13580 |
| 105 | Ga0163163_10063722 | 3300014325 | Bacteria | 3656 |
| 106 | Ga0163163_10197026 | 3300014325 | Bacteria | 2062 |
| 107 | Ga0163163_10564295 | 3300014325 | Bacteria | 1201 |
| 108 | Ga0157380_10140281 | 3300014326 | Bacteria | 2076 |
| 109 | Ga0157380_10304133 | 3300014326 | Bacteria | 1471 |
| 110 | Ga0157377_10001449 | 3300014745 | Bacteria | 10252 |
| 111 | Ga0157379_10070040 | 3300014968 | Bacteria | 3137 |
| 112 | Ga0209563_100022 | 3300025230 | Bacteria | 643318 |
| 113 | Ga0209677_110628 | 3300025253 | Bacteria | 1511 |
| 114 | Ga0207697_10038466 | 3300025315 | Bacteria | 1962 |
| 115 | Ga0207682_10018244 | 3300025893 | Bacteria | 2744 |
| 116 | Ga0207682_10045950 | 3300025893 | Bacteria | 1793 |
| 117 | Ga0207642_10045384 | 3300025899 | Bacteria | 1951 |
| 118 | Ga0207688_10080977 | 3300025901 | Bacteria | 1854 |
| 119 | Ga0207645_10058030 | 3300025907 | Bacteria | 2471 |
| 120 | Ga0207643_10017292 | 3300025908 | Bacteria | 3942 |
| 121 | Ga0207660_10195433 | 3300025917 | Bacteria | 1578 |
| 122 | Ga0207662_10002920 | 3300025918 | Bacteria | 8668 |
| 123 | Ga0207657_10015055 | 3300025919 | Bacteria | 7511 |
| 124 | Ga0207649_10050897 | 3300025920 | Bacteria | 2564 |
| 125 | Ga0207650_10019103 | 3300025925 | Bacteria | 4816 |
| 126 | Ga0207659_10004777 | 3300025926 | Bacteria | 8216 |
| 127 | Ga0207659_10030982 | 3300025926 | Bacteria | 3658 |
| 128 | Ga0207659_10447045 | 3300025926 | Bacteria | 1088 |
| 129 | Ga0207644_10103904 | 3300025931 | Bacteria | 2138 |
| 130 | Ga0207706_10005686 | 3300025933 | Bacteria | 11611 |
| 131 | Ga0207686_10219726 | 3300025934 | Bacteria | 1371 |
| 132 | Ga0207709_10045067 | 3300025935 | Bacteria | 2669 |
| 133 | Ga0207670_10011922 | 3300025936 | Bacteria | 5062 |
| 134 | Ga0207670_10266156 | 3300025936 | Bacteria | 1331 |
| 135 | Ga0207669_10031133 | 3300025937 | Bacteria | 2976 |
| 136 | Ga0207704_10017981 | 3300025938 | Bacteria | 3679 |
| 137 | Ga0207665_10091048 | 3300025939 | Bacteria | 2114 |
| 138 | Ga0207691_10009188 | 3300025940 | Bacteria | 9488 |
| 139 | Ga0207691_10014816 | 3300025940 | Bacteria | 7429 |
| 140 | Ga0207691_10054902 | 3300025940 | Bacteria | 3633 |
| 141 | Ga0207711_10090776 | 3300025941 | Bacteria | 2686 |
| 142 | Ga0207689_10016166 | 3300025942 | Bacteria | 6320 |
| 143 | Ga0207689_10018683 | 3300025942 | Bacteria | 5848 |
| 144 | Ga0207689_10020364 | 3300025942 | Bacteria | 5584 |
| 145 | Ga0207679_10003697 | 3300025945 | Bacteria | 9481 |
| 146 | Ga0207679_10183586 | 3300025945 | Bacteria | 1733 |
| 147 | Ga0207651_10012849 | 3300025960 | Bacteria | 4760 |
| 148 | Ga0207651_10136885 | 3300025960 | Bacteria | 1885 |
| 149 | Ga0207712_10009525 | 3300025961 | Bacteria | 6146 |
| 150 | Ga0207712_10037028 | 3300025961 | Bacteria | 3326 |
| 151 | Ga0207668_10002493 | 3300025972 | Bacteria | 10747 |
| 152 | Ga0207668_10178882 | 3300025972 | Bacteria | 1671 |
| 153 | Ga0207658_10046714 | 3300025986 | Bacteria | 3164 |
| 154 | Ga0207703_10049246 | 3300026035 | Bacteria | 3405 |
| 155 | Ga0207641_10006163 | 3300026088 | Bacteria | 10147 |
| 156 | Ga0207641_10357170 | 3300026088 | Bacteria | 1394 |
| 157 | Ga0207641_10593663 | 3300026088 | Bacteria | 1083 |
| 158 | Ga0207648_10004869 | 3300026089 | Bacteria | 13690 |
| 159 | Ga0207676_10003107 | 3300026095 | Bacteria | 11849 |
| 160 | Ga0207674_10105386 | 3300026116 | Bacteria | 2798 |
| 161 | Ga0207674_10306261 | 3300026116 | Bacteria | 1538 |
| 162 | Ga0207675_100002949 | 3300026118 | Bacteria | 16729 |
| 163 | Ga0207675_100011263 | 3300026118 | Bacteria | 8375 |
| 164 | Ga0207675_100044693 | 3300026118 | Bacteria | 4140 |
| 165 | Ga0207683_10014654 | 3300026121 | Bacteria | 6678 |
| 166 | Ga0207683_10056349 | 3300026121 | Bacteria | 3447 |
| 167 | Ga0207683_10081214 | 3300026121 | Bacteria | 2877 |
| 168 | Ga0209971_1025878 | 3300027682 | Bacteria | 1402 |
| 169 | Ga0207428_10008110 | 3300027907 | Bacteria | 9519 |
| 170 | Ga0207428_10041811 | 3300027907 | Bacteria | 3709 |
| 171 | Ga0207428_10072783 | 3300027907 | Bacteria | 2697 |
| 172 | Ga0207428_10092787 | 3300027907 | Bacteria | 2343 |
| 173 | Ga0207428_10123457 | 3300027907 | Bacteria | 1984 |
| 174 | Ga0268266_10066423 | 3300028379 | Bacteria | 3119 |
| 175 | Ga0268266_10120731 | 3300028379 | Bacteria | 2332 |
| 176 | Ga0268265_10002021 | 3300028380 | Bacteria | 15917 |
| 177 | Ga0268265_10114121 | 3300028380 | Bacteria | 2212 |
| 178 | Ga0268264_10044676 | 3300028381 | Bacteria | 3675 |
| 179 | Ga0265338_10238581 | 3300028800 | Bacteria | 1348 |
| 180 | Ga0265770_1000304 | 3300030878 | Bacteria | 6669 |
| 181 | Ga0265760_10001385 | 3300031090 | Bacteria | 7113 |
| 182 | Ga0307408_100019871 | 3300031548 | Bacteria | 4525 |
| 183 | Ga0307408_100280192 | 3300031548 | Bacteria | 1388 |
| 184 | Ga0316575_10001493 | 3300031665 | Bacteria | 7552 |
| 185 | Ga0316575_10025914 | 3300031665 | Bacteria | 2277 |
| 186 | Ga0316578_10026778 | 3300031728 | Bacteria | 3253 |
| 187 | Ga0307413_10040649 | 3300031824 | Bacteria | 2715 |
| 188 | Ga0307410_10057114 | 3300031852 | Bacteria | 2656 |
| 189 | Ga0307406_10085626 | 3300031901 | Bacteria | 2108 |
| 190 | Ga0307407_10026773 | 3300031903 | Bacteria | 3059 |
| 191 | Ga0307412_10011602 | 3300031911 | Bacteria | 5110 |
| 192 | Ga0307412_10074927 | 3300031911 | Bacteria | 2320 |
| 193 | Ga0307409_100019806 | 3300031995 | Bacteria | 4568 |
| 194 | Ga0307409_100151799 | 3300031995 | Bacteria | 2012 |
| 195 | Ga0307416_100006976 | 3300032002 | Bacteria | 7123 |
| 196 | Ga0307416_100037042 | 3300032002 | Bacteria | 3749 |
| 197 | Ga0307416_100596844 | 3300032002 | Bacteria | 1183 |
| 198 | Ga0307411_10017072 | 3300032005 | Bacteria | 4124 |
| 199 | Ga0307411_10070186 | 3300032005 | Bacteria | 2370 |
| 200 | Ga0307411_10204188 | 3300032005 | Bacteria | 1520 |
| 201 | Ga0307415_100076242 | 3300032126 | Bacteria | 2376 |
| 202 | Ga0307415_100391619 | 3300032126 | Bacteria | 1183 |
| 203 | Ga0316580_10009313 | 3300032139 | Bacteria | 2950 |
| 204 | Ga0373930_0005720 | 3300034816 | Bacteria | 2076 |
| 205 | Ga0316574_0032274 | 3300035398 | Bacteria | 3182 |
| 206 | Ga0316574_0239445 | 3300035398 | Bacteria | 1160 |
| 207 | Ga0316582_0025599 | 3300036647 | Bacteria | 3545 |
| 208 | Ga0316584_0027053 | 3300036712 | Bacteria | 4219 |
| 209 | Ga0395899_0006928 | 3300037312 | Bacteria | 8778 |
| 210 | Ga0395899_0093337 | 3300037312 | Bacteria | 2178 |
| 211 | Ga0395900_0000992 | 3300037418 | Bacteria | 36889 |
| 212 | Ga0395900_0036534 | 3300037418 | Bacteria | 5064 |
| 213 | Ga0395900_0059863 | 3300037418 | Bacteria | 3920 |
| 214 | Ga0395900_0420405 | 3300037418 | Bacteria | 1297 |
| 215 | Ga0395898_0327665 | 3300037466 | Bacteria | 1460 |
| 216 | Ga0395905_0027921 | 3300037471 | Bacteria | 5321 |
| 217 | Ga0395905_0074984 | 3300037471 | Bacteria | 3170 |
| 218 | Ga0395905_0244196 | 3300037471 | Bacteria | 1677 |
| 219 | Ga0439453_0021112 | 3300041408 | Bacteria | 1172 |
| 220 | Ga0450919_009018 | 3300042121 | Bacteria | 1150 |
| 221 | Ga0450920_000423 | 3300042122 | Bacteria | 6609 |
| 222 | Ga0450923_000265 | 3300042125 | Bacteria | 5201 |
| 223 | Ga0450894_002255 | 3300042131 | Bacteria | 2614 |
| 224 | Ga0450896_000010 | 3300042133 | Bacteria | 10059 |
| 225 | Ga0450896_011154 | 3300042133 | Bacteria | 1264 |
| 226 | Ga0450907_002324 | 3300042146 | Bacteria | 3677 |
| 227 | Ga0439446_0004492 | 3300042156 | Bacteria | 3538 |
| 228 | Ga0450908_000545 | 3300042184 | Bacteria | 7229 |
| 229 | Ga0450908_003723 | 3300042184 | Bacteria | 2954 |
| 230 | Ga0451577_0058939 | 3300042876 | Bacteria | 3423 |
| 231 | Ga0451577_0124546 | 3300042876 | Bacteria | 2309 |
| 232 | Ga0466969_0075168 | 3300044656 | Bacteria | 1620 |
| 233 | Ga0466972_0004758 | 3300044658 | Bacteria | 6797 |
| 234 | Ga0466972_0064867 | 3300044658 | Bacteria | 1747 |
| 235 | Ga0466965_0044311 | 3300044683 | Bacteria | 2198 |
| 236 | Ga0466966_0033025 | 3300044684 | Bacteria | 3350 |
| 237 | Ga0466964_0002589 | 3300044706 | Bacteria | 6462 |
| 238 | Ga0453684_0081953 | 3300044712 | Bacteria | 4021 |
| 239 | Ga0453684_0317192 | 3300044712 | Bacteria | 1766 |
| 240 | Ga0466968_0003632 | 3300044735 | Bacteria | 5715 |
| 241 | Ga0466970_0172693 | 3300044765 | Bacteria | 1198 |
| 242 | Ga0466957_0012682 | 3300044842 | Bacteria | 4883 |
| 243 | Ga0466957_0208127 | 3300044842 | Bacteria | 1287 |
| 244 | Ga0466957_0314903 | 3300044842 | Bacteria | 1054 |
| 245 | Ga0466959_0012399 | 3300045049 | Bacteria | 6158 |
| 246 | Ga0451576_0006856 | 3300045051 | Bacteria | 13809 |
| 247 | Ga0451576_0113928 | 3300045051 | Bacteria | 2814 |
| 248 | Ga0451576_0363178 | 3300045051 | Bacteria | 1516 |
| 249 | Ga0466967_0041804 | 3300045976 | Bacteria | 3956 |
| 250 | Ga0495617_000104 | 3300046452 | Bacteria | 61298 |
| 251 | Ga0495617_049847 | 3300046452 | Bacteria | 1393 |
| 252 | Ga0495627_001021 | 3300046453 | Bacteria | 18746 |
| 253 | Ga0495603_0003286 | 3300046455 | Bacteria | 9630 |
| 254 | Ga0495590_0000179 | 3300046457 | Bacteria | 37217 |
| 255 | Ga0495590_0001207 | 3300046457 | Bacteria | 11301 |
| 256 | Ga0495590_0002723 | 3300046457 | Bacteria | 7299 |
| 257 | Ga0495591_000127 | 3300046458 | Bacteria | 83271 |
| 258 | Ga0495591_008318 | 3300046458 | Bacteria | 4269 |
| 259 | Ga0495653_0024831 | 3300046463 | Bacteria | 4823 |
| 260 | Ga0495653_0052113 | 3300046463 | Bacteria | 3137 |
| 261 | Ga0495650_0000458 | 3300046471 | Bacteria | 63663 |
| 262 | Ga0495650_0021617 | 3300046471 | Bacteria | 3103 |
| 263 | Ga0495650_0046597 | 3300046471 | Bacteria | 1818 |
| 264 | Ga0495582_0002269 | 3300046473 | Bacteria | 10757 |
| 265 | Ga0495605_0000039 | 3300046474 | Bacteria | 196802 |
| 266 | Ga0495605_0000445 | 3300046474 | Bacteria | 37241 |
| 267 | Ga0495605_0006494 | 3300046474 | Bacteria | 6717 |
| 268 | Ga0495605_0020041 | 3300046474 | Bacteria | 3558 |
| 269 | Ga0495605_0022905 | 3300046474 | Bacteria | 3291 |
| 270 | Ga0495605_0029613 | 3300046474 | Bacteria | 2814 |
| 271 | Ga0495584_0000611 | 3300046491 | Bacteria | 23905 |
| 272 | Ga0495584_0000923 | 3300046491 | Bacteria | 18628 |
| 273 | Ga0495584_0001206 | 3300046491 | Bacteria | 15841 |
| 274 | Ga0495584_0001621 | 3300046491 | Bacteria | 13232 |
| 275 | Ga0495584_0002947 | 3300046491 | Bacteria | 9473 |
| 276 | Ga0495584_0007947 | 3300046491 | Bacteria | 5514 |
| 277 | Ga0495584_0035086 | 3300046491 | Bacteria | 2535 |
| 278 | Ga0495584_0057806 | 3300046491 | Bacteria | 1951 |
| 279 | Ga0495585_0002267 | 3300046492 | Bacteria | 13909 |
| 280 | Ga0495585_0003173 | 3300046492 | Bacteria | 11254 |
| 281 | Ga0495585_0004115 | 3300046492 | Bacteria | 9531 |
| 282 | Ga0495585_0009756 | 3300046492 | Bacteria | 5746 |
| 283 | Ga0495585_0010382 | 3300046492 | Bacteria | 5545 |
| 284 | Ga0495585_0014103 | 3300046492 | Bacteria | 4666 |
| 285 | Ga0495585_0015922 | 3300046492 | Bacteria | 4362 |
| 286 | Ga0495585_0016058 | 3300046492 | Bacteria | 4341 |
| 287 | Ga0495585_0030995 | 3300046492 | Bacteria | 3039 |
| 288 | Ga0495585_0031225 | 3300046492 | Bacteria | 3024 |
| 289 | Ga0495585_0051771 | 3300046492 | Bacteria | 2274 |
| 290 | Ga0495585_0195208 | 3300046492 | Bacteria | 1033 |
| 291 | Ga0495594_0023427 | 3300046499 | Bacteria | 3308 |
| 292 | Ga0495594_0039972 | 3300046499 | Bacteria | 2565 |
| 293 | Ga0495596_0000693 | 3300046500 | Bacteria | 20891 |
| 294 | Ga0495596_0006700 | 3300046500 | Bacteria | 5271 |
| 295 | Ga0495596_0018120 | 3300046500 | Bacteria | 2905 |
| 296 | Ga0495596_0020594 | 3300046500 | Bacteria | 2698 |
| 297 | Ga0495596_0037631 | 3300046500 | Bacteria | 1912 |
| 298 | Ga0495596_0038440 | 3300046500 | Bacteria | 1891 |
| 299 | Ga0495607_0001269 | 3300046501 | Bacteria | 22570 |
| 300 | Ga0495607_0002439 | 3300046501 | Bacteria | 15146 |
| 301 | Ga0495607_0006218 | 3300046501 | Bacteria | 8422 |
| 302 | Ga0495607_0017431 | 3300046501 | Bacteria | 4609 |
| 303 | Ga0495607_0018737 | 3300046501 | Bacteria | 4403 |
| 304 | Ga0495607_0033717 | 3300046501 | Bacteria | 3113 |
| 305 | Ga0495583_0000116 | 3300046506 | Bacteria | 135355 |
| 306 | Ga0495583_0000881 | 3300046506 | Bacteria | 36218 |
| 307 | Ga0495583_0004966 | 3300046506 | Bacteria | 9230 |
| 308 | Ga0495583_0014374 | 3300046506 | Bacteria | 4371 |
| 309 | Ga0495583_0024832 | 3300046506 | Bacteria | 3004 |
| 310 | Ga0495583_0033790 | 3300046506 | Bacteria | 2456 |
| 311 | Ga0495583_0041449 | 3300046506 | Bacteria | 2156 |
| 312 | Ga0495606_0010194 | 3300046507 | Bacteria | 7834 |
| 313 | Ga0495606_0010670 | 3300046507 | Bacteria | 7595 |
| 314 | Ga0495606_0012517 | 3300046507 | Bacteria | 6795 |
| 315 | Ga0495606_0089164 | 3300046507 | Bacteria | 1900 |
| 316 | Ga0495610_0000452 | 3300046512 | Bacteria | 42500 |
| 317 | Ga0495616_0001143 | 3300046513 | Bacteria | 18750 |
| 318 | Ga0495616_0002215 | 3300046513 | Bacteria | 12998 |
| 319 | Ga0495616_0004692 | 3300046513 | Bacteria | 8572 |
| 320 | Ga0495616_0020722 | 3300046513 | Bacteria | 3571 |
| 321 | Ga0495616_0027545 | 3300046513 | Bacteria | 3014 |
| 322 | Ga0495616_0062458 | 3300046513 | Bacteria | 1824 |
| 323 | Ga0495620_0004231 | 3300046515 | Bacteria | 8116 |
| 324 | Ga0495631_0000480 | 3300046518 | Bacteria | 26693 |
| 325 | Ga0495631_0002440 | 3300046518 | Bacteria | 10485 |
| 326 | Ga0495631_0004833 | 3300046518 | Bacteria | 7102 |
| 327 | Ga0495631_0012560 | 3300046518 | Bacteria | 4133 |
| 328 | Ga0495631_0020346 | 3300046518 | Bacteria | 3101 |
| 329 | Ga0495631_0034589 | 3300046518 | Bacteria | 2264 |
| 330 | Ga0495631_0044541 | 3300046518 | Bacteria | 1954 |
| 331 | Ga0495632_0000103 | 3300046519 | Bacteria | 86898 |
| 332 | Ga0495632_0000430 | 3300046519 | Bacteria | 39988 |
| 333 | Ga0495632_0001860 | 3300046519 | Bacteria | 16956 |
| 334 | Ga0495632_0009344 | 3300046519 | Bacteria | 5919 |
| 335 | Ga0495632_0011598 | 3300046519 | Bacteria | 5133 |
| 336 | Ga0495632_0012757 | 3300046519 | Bacteria | 4826 |
| 337 | Ga0495632_0024594 | 3300046519 | Bacteria | 3196 |
| 338 | Ga0495637_0000029 | 3300046520 | Bacteria | 143929 |
| 339 | Ga0495637_0005839 | 3300046520 | Bacteria | 6228 |
| 340 | Ga0495637_0006019 | 3300046520 | Bacteria | 6128 |
| 341 | Ga0495643_0002233 | 3300046522 | Bacteria | 15734 |
| 342 | Ga0495643_0003666 | 3300046522 | Bacteria | 11145 |
| 343 | Ga0495643_0007173 | 3300046522 | Bacteria | 7230 |
| 344 | Ga0495643_0047184 | 3300046522 | Bacteria | 2333 |
| 345 | Ga0495644_0032399 | 3300046523 | Bacteria | 1974 |
| 346 | Ga0495648_0000795 | 3300046524 | Bacteria | 33423 |
| 347 | Ga0495648_0009583 | 3300046524 | Bacteria | 7476 |
| 348 | Ga0495648_0013788 | 3300046524 | Bacteria | 5955 |
| 349 | Ga0495648_0020208 | 3300046524 | Bacteria | 4655 |
| 350 | Ga0495648_0031075 | 3300046524 | Bacteria | 3522 |
| 351 | Ga0495648_0088102 | 3300046524 | Bacteria | 1745 |
| 352 | Ga0495648_0150122 | 3300046524 | Bacteria | 1216 |
| 353 | Ga0495663_0001068 | 3300046525 | Bacteria | 8944 |
| 354 | Ga0495663_0061055 | 3300046525 | Bacteria | 1185 |
| 355 | Ga0495666_0000504 | 3300046526 | Bacteria | 17330 |
| 356 | Ga0495642_0000469 | 3300046528 | Bacteria | 20946 |
| 357 | Ga0495642_0002531 | 3300046528 | Bacteria | 7394 |
| 358 | Ga0495642_0003257 | 3300046528 | Bacteria | 6428 |
| 359 | Ga0495642_0008030 | 3300046528 | Bacteria | 4037 |
| 360 | Ga0495642_0021116 | 3300046528 | Bacteria | 2559 |
| 361 | Ga0495642_0122650 | 3300046528 | Bacteria | 1115 |
| 362 | Ga0495652_0030667 | 3300046529 | Bacteria | 4713 |
| 363 | Ga0495654_0033497 | 3300046530 | Bacteria | 2599 |
| 364 | Ga0495654_0058421 | 3300046530 | Bacteria | 1861 |
| 365 | Ga0495654_0058749 | 3300046530 | Bacteria | 1854 |
| 366 | Ga0495654_0072991 | 3300046530 | Bacteria | 1623 |
| 367 | Ga0495654_0073682 | 3300046530 | Bacteria | 1614 |
| 368 | Ga0495665_0009102 | 3300046531 | Bacteria | 5382 |
| 369 | Ga0495665_0009467 | 3300046531 | Bacteria | 5273 |
| 370 | Ga0495665_0082504 | 3300046531 | Bacteria | 1690 |
| 371 | Ga0495586_0028584 | 3300046535 | Bacteria | 2983 |
| 372 | Ga0495586_0054079 | 3300046535 | Bacteria | 2175 |
| 373 | Ga0495609_0008158 | 3300046538 | Bacteria | 5146 |
| 374 | Ga0495609_0010397 | 3300046538 | Bacteria | 4464 |
| 375 | Ga0495609_0014122 | 3300046538 | Bacteria | 3759 |
| 376 | Ga0495609_0014754 | 3300046538 | Bacteria | 3668 |
| 377 | Ga0495609_0137183 | 3300046538 | Bacteria | 1045 |
| 378 | Ga0495597_0000975 | 3300046542 | Bacteria | 22068 |
| 379 | Ga0495597_0001582 | 3300046542 | Bacteria | 16002 |
| 380 | Ga0495597_0003431 | 3300046542 | Bacteria | 9258 |
| 381 | Ga0495597_0003997 | 3300046542 | Bacteria | 8284 |
| 382 | Ga0495597_0005815 | 3300046542 | Bacteria | 6461 |
| 383 | Ga0495633_0006535 | 3300046558 | Bacteria | 6889 |
| 384 | Ga0495633_0117069 | 3300046558 | Bacteria | 1235 |
| 385 | Ga0495668_0002707 | 3300046616 | Bacteria | 14215 |
| 386 | Ga0495668_0003785 | 3300046616 | Bacteria | 11086 |
| 387 | Ga0495668_0003845 | 3300046616 | Bacteria | 10990 |
| 388 | Ga0495668_0018825 | 3300046616 | Bacteria | 3989 |
| 389 | Ga0495668_0021434 | 3300046616 | Bacteria | 3705 |
| 390 | Ga0495611_0000701 | 3300046648 | Bacteria | 18999 |
| 391 | Ga0495611_0011941 | 3300046648 | Bacteria | 3688 |
| 392 | Ga0495611_0015461 | 3300046648 | Bacteria | 3263 |
| 393 | Ga0495611_0020830 | 3300046648 | Bacteria | 2826 |
| 394 | Ga0495611_0051398 | 3300046648 | Bacteria | 1857 |
| 395 | Ga0495635_0012232 | 3300046663 | Bacteria | 6014 |
| 396 | Ga0495661_0001196 | 3300046665 | Bacteria | 22530 |
| 397 | Ga0495661_0001409 | 3300046665 | Bacteria | 20155 |
| 398 | Ga0495661_0001667 | 3300046665 | Bacteria | 18095 |
| 399 | Ga0495661_0001962 | 3300046665 | Bacteria | 16328 |
| 400 | Ga0495661_0019662 | 3300046665 | Bacteria | 4421 |
| 401 | Ga0495661_0020800 | 3300046665 | Bacteria | 4278 |
| 402 | Ga0495661_0026283 | 3300046665 | Bacteria | 3750 |
| 403 | Ga0495661_0027605 | 3300046665 | Bacteria | 3641 |
| 404 | Ga0495661_0028911 | 3300046665 | Bacteria | 3542 |
| 405 | Ga0495661_0049860 | 3300046665 | Bacteria | 2536 |
| 406 | Ga0495661_0061333 | 3300046665 | Bacteria | 2232 |
| 407 | Ga0495588_0000059 | 3300046674 | Bacteria | 263358 |
| 408 | Ga0495588_0001562 | 3300046674 | Bacteria | 9808 |
| 409 | Ga0495588_0004011 | 3300046674 | Bacteria | 6475 |
| 410 | Ga0495588_0127656 | 3300046674 | Bacteria | 1341 |
| 411 | Ga0495623_0002959 | 3300046679 | Bacteria | 11176 |
| 412 | Ga0495669_0000781 | 3300046684 | Bacteria | 13593 |
| 413 | Ga0495669_0003090 | 3300046684 | Bacteria | 6846 |
| 414 | Ga0495669_0077351 | 3300046684 | Bacteria | 1523 |
| 415 | Ga0495613_0287028 | 3300046689 | Bacteria | 1141 |
| 416 | Ga0495670_0001638 | 3300046691 | Bacteria | 10957 |
| 417 | Ga0495670_0002386 | 3300046691 | Bacteria | 9255 |
| 418 | Ga0495670_0015246 | 3300046691 | Bacteria | 3778 |
| 419 | Ga0495670_0018789 | 3300046691 | Bacteria | 3404 |
| 420 | Ga0495670_0037706 | 3300046691 | Bacteria | 2409 |
| 421 | Ga0495671_0001145 | 3300046692 | Bacteria | 18227 |
| 422 | Ga0495671_0001936 | 3300046692 | Bacteria | 13281 |
| 423 | Ga0495671_0006810 | 3300046692 | Bacteria | 6565 |
| 424 | Ga0495671_0010211 | 3300046692 | Bacteria | 5215 |
| 425 | Ga0495649_0001435 | 3300046694 | Bacteria | 18015 |
| 426 | Ga0495649_0001621 | 3300046694 | Bacteria | 16733 |
| 427 | Ga0495649_0040553 | 3300046694 | Bacteria | 2549 |
| 428 | Ga0495649_0082829 | 3300046694 | Bacteria | 1714 |
| 429 | Ga0495589_0000047 | 3300046794 | Bacteria | 117810 |
| 430 | Ga0495589_0000752 | 3300046794 | Bacteria | 20816 |
| 431 | Ga0495589_0002437 | 3300046794 | Bacteria | 10453 |
| 432 | Ga0495589_0119664 | 3300046794 | Bacteria | 1268 |
| 433 | Ga0495600_0026151 | 3300046809 | Bacteria | 3765 |
| 434 | Ga0495660_0000135 | 3300046810 | Bacteria | 80391 |
| 435 | Ga0495660_0006314 | 3300046810 | Bacteria | 7026 |
| 436 | Ga0495660_0015921 | 3300046810 | Bacteria | 4339 |
| 437 | Ga0495660_0041442 | 3300046810 | Bacteria | 2549 |
| 438 | Ga0495660_0047736 | 3300046810 | Bacteria | 2343 |
| 439 | Ga0495660_0122677 | 3300046810 | Bacteria | 1312 |
| 440 | Ga0495604_0038720 | 3300047317 | Bacteria | 3751 |
| 441 | Ga0495604_0142603 | 3300047317 | Bacteria | 1710 |
| 442 | Ga0495674_0031550 | 3300047319 | Bacteria | 4813 |
| 443 | Ga0495672_0000175 | 3300047320 | Bacteria | 93127 |
| 444 | Ga0495672_0001994 | 3300047320 | Bacteria | 19290 |
| 445 | Ga0495672_0008748 | 3300047320 | Bacteria | 7422 |
| 446 | Ga0495672_0015357 | 3300047320 | Bacteria | 5202 |
| 447 | Ga0495672_0146808 | 3300047320 | Bacteria | 1226 |
| 448 | Ga0495676_0000249 | 3300047321 | Bacteria | 43337 |
| 449 | Ga0495680_0021322 | 3300047322 | Bacteria | 5425 |
| 450 | Ga0495680_0165041 | 3300047322 | Bacteria | 1606 |
| 451 | Ga0495683_0000224 | 3300047323 | Bacteria | 53121 |
| 452 | Ga0495683_0000379 | 3300047323 | Bacteria | 36310 |
| 453 | Ga0495683_0030313 | 3300047323 | Bacteria | 2759 |
| 454 | Ga0495683_0085767 | 3300047323 | Bacteria | 1530 |
| 455 | Ga0495687_000145 | 3300047443 | Bacteria | 108089 |
| 456 | Ga0495687_000146 | 3300047443 | Bacteria | 107228 |
| 457 | Ga0495687_000431 | 3300047443 | Bacteria | 51764 |
| 458 | Ga0495687_000987 | 3300047443 | Bacteria | 28644 |
| 459 | Ga0495687_128686 | 3300047443 | Bacteria | 900 |
| 460 | Ga0495675_0005786 | 3300047444 | Bacteria | 7558 |
| 461 | Ga0495675_0009434 | 3300047444 | Bacteria | 6072 |
| 462 | Ga0495675_0050420 | 3300047444 | Bacteria | 2646 |
| 463 | Ga0495675_0193596 | 3300047444 | Bacteria | 1240 |
| 464 | Ga0495677_0001206 | 3300047445 | Bacteria | 10351 |
| 465 | Ga0495677_0001850 | 3300047445 | Bacteria | 8457 |
| 466 | Ga0495677_0002504 | 3300047445 | Bacteria | 7193 |
| 467 | Ga0495677_0007827 | 3300047445 | Bacteria | 3980 |
| 468 | Ga0495677_0036217 | 3300047445 | Bacteria | 1802 |
| 469 | Ga0495679_001114 | 3300047446 | Bacteria | 16202 |
| 470 | Ga0495679_014147 | 3300047446 | Bacteria | 2968 |
| 471 | Ga0495679_016473 | 3300047446 | Bacteria | 2674 |
| 472 | Ga0495685_005512 | 3300047447 | Bacteria | 4133 |
| 473 | Ga0495685_010208 | 3300047447 | Bacteria | 3147 |
| 474 | Ga0495681_0001400 | 3300047470 | Bacteria | 18155 |
| 475 | Ga0495681_0003608 | 3300047470 | Bacteria | 10767 |
| 476 | Ga0495681_0008588 | 3300047470 | Bacteria | 6384 |
| 477 | Ga0495681_0009217 | 3300047470 | Bacteria | 6101 |
| 478 | Ga0495681_0016830 | 3300047470 | Bacteria | 4079 |
| 479 | Ga0495681_0053176 | 3300047470 | Bacteria | 1897 |
| 480 | Ga0495686_0000240 | 3300047472 | Bacteria | 99258 |
| 481 | Ga0495686_0002491 | 3300047472 | Bacteria | 17303 |
| 482 | Ga0495686_0078497 | 3300047472 | Bacteria | 2020 |
| 483 | Ga0495602_0071712 | 3300048088 | Bacteria | 2957 |
| 484 | Ga0495626_0000047 | 3300048091 | Bacteria | 161939 |
| 485 | Ga0495626_0000141 | 3300048091 | Bacteria | 91317 |
| 486 | Ga0495626_0011869 | 3300048091 | Bacteria | 4587 |
| 487 | Ga0495626_0013727 | 3300048091 | Bacteria | 4202 |
| 488 | Ga0495626_0020501 | 3300048091 | Bacteria | 3292 |
| 489 | Ga0495626_0022439 | 3300048091 | Bacteria | 3117 |
| 490 | Ga0495626_0035611 | 3300048091 | Bacteria | 2375 |
| 491 | Ga0495626_0039031 | 3300048091 | Bacteria | 2248 |
| 492 | Ga0496100_0028287 | 3300048903 | Bacteria | 3456 |
| 493 | Ga0496102_0000202 | 3300048905 | Bacteria | 80040 |
| 494 | Ga0496102_0000582 | 3300048905 | Bacteria | 38683 |
| 495 | Ga0496102_0142426 | 3300048905 | Bacteria | 2248 |
| 496 | Ga0496102_0185238 | 3300048905 | Bacteria | 1962 |
| 497 | Ga0496103_0004610 | 3300048906 | Bacteria | 8342 |
| 498 | Ga0496103_0009233 | 3300048906 | Bacteria | 5842 |
| 499 | Ga0496104_0090589 | 3300048907 | Bacteria | 2922 |
| 500 | Ga0496105_0217293 | 3300048908 | Bacteria | 1556 |
| 501 | Ga0496106_0035375 | 3300048909 | Bacteria | 3735 |
| 502 | Ga0496106_0072129 | 3300048909 | Bacteria | 2640 |
| 503 | Ga0496107_0208637 | 3300048910 | Bacteria | 1452 |
| 504 | Ga0496108_0106417 | 3300048911 | Bacteria | 2395 |
| 505 | Ga0496108_0127577 | 3300048911 | Bacteria | 2185 |
| 506 | Ga0496109_0206027 | 3300048912 | Bacteria | 1849 |
| 507 | Ga0496110_0000454 | 3300048913 | Bacteria | 27858 |
| 508 | Ga0496110_0039283 | 3300048913 | Bacteria | 4121 |
| 509 | Ga0496113_0029859 | 3300048916 | Bacteria | 3941 |
| 510 | Ga0496113_0065748 | 3300048916 | Bacteria | 2745 |
| 511 | Ga0496113_0441934 | 3300048916 | Bacteria | 1045 |
| 512 | Ga0496114_0001018 | 3300048917 | Bacteria | 21052 |
| 513 | Ga0496115_0516594 | 3300048918 | Bacteria | 958 |
| 514 | Ga0496122_0004661 | 3300048925 | Bacteria | 16840 |
| 515 | Ga0496122_0004891 | 3300048925 | Bacteria | 16272 |
| 516 | Ga0496122_0028804 | 3300048925 | Bacteria | 4701 |
| 517 | Ga0496122_0164218 | 3300048925 | Bacteria | 1349 |
| 518 | Ga0496123_0001430 | 3300048926 | Bacteria | 33347 |
| 519 | Ga0496123_0002318 | 3300048926 | Bacteria | 23910 |
| 520 | Ga0496123_0039144 | 3300048926 | Bacteria | 3320 |
| 521 | Ga0496124_0032515 | 3300048927 | Bacteria | 4605 |
| 522 | Ga0496124_0078281 | 3300048927 | Bacteria | 2725 |
| 523 | Ga0496125_0016060 | 3300048928 | Bacteria | 7208 |
| 524 | Ga0496125_0049443 | 3300048928 | Bacteria | 3494 |
| 525 | Ga0495678_000544 | 3300049459 | Bacteria | 36334 |
| 526 | Ga0495678_000698 | 3300049459 | Bacteria | 30571 |
| 527 | Ga0495678_001457 | 3300049459 | Bacteria | 18575 |
| 528 | Ga0495678_006706 | 3300049459 | Bacteria | 6076 |
| 529 | Ga0495682_0001112 | 3300049460 | Bacteria | 15642 |
| 530 | Ga0495682_0047074 | 3300049460 | Bacteria | 1573 |
| 531 | Ga0501298_020675 | 3300049521 | Unclassified | 1229 |
| 532 | Ga0501034_0208146 | 3300049571 | Bacteria | 1912 |
| 533 | Ga0501036_0002154 | 3300049572 | Bacteria | 15371 |
| 534 | Ga0501036_0098694 | 3300049572 | Bacteria | 2469 |
| 535 | Ga0501036_0408505 | 3300049572 | Bacteria | 1132 |
| 536 | Ga0501037_0111761 | 3300049573 | Bacteria | 1968 |
| 537 | Ga0501038_0036998 | 3300049574 | Bacteria | 4281 |
| 538 | Ga0501038_0251052 | 3300049574 | Bacteria | 1401 |
| 539 | Ga0501039_0005578 | 3300049575 | Bacteria | 9525 |
| 540 | Ga0501039_0025869 | 3300049575 | Bacteria | 4512 |
| 541 | Ga0501039_0050091 | 3300049575 | Bacteria | 3230 |
| 542 | Ga0501039_0060846 | 3300049575 | Bacteria | 2924 |
| 543 | Ga0501040_0000895 | 3300049576 | Bacteria | 18719 |
| 544 | Ga0501040_0102178 | 3300049576 | Bacteria | 2000 |
| 545 | Ga0501041_0002499 | 3300049577 | Bacteria | 10465 |
| 546 | Ga0501041_0006167 | 3300049577 | Bacteria | 7006 |
| 547 | Ga0501041_0046079 | 3300049577 | Bacteria | 2652 |
| 548 | Ga0501041_0090457 | 3300049577 | Bacteria | 1889 |
| 549 | Ga0501041_0277671 | 3300049577 | Bacteria | 1054 |
| 550 | Ga0501042_0002392 | 3300049578 | Bacteria | 11500 |
| 551 | Ga0501042_0009373 | 3300049578 | Bacteria | 6522 |
| 552 | Ga0501042_0130800 | 3300049578 | Bacteria | 1809 |
| 553 | Ga0501043_0055127 | 3300049579 | Bacteria | 3123 |
| 554 | Ga0501046_0011525 | 3300049580 | Bacteria | 7559 |
| 555 | Ga0501046_0083137 | 3300049580 | Bacteria | 2472 |
| 556 | Ga0501046_0104215 | 3300049580 | Bacteria | 2174 |
| 557 | Ga0501048_0001609 | 3300049582 | Bacteria | 17179 |
| 558 | Ga0501048_0002534 | 3300049582 | Bacteria | 13979 |
| 559 | Ga0501067_0004163 | 3300049583 | Bacteria | 7991 |
| 560 | Ga0501068_0020792 | 3300049584 | Bacteria | 3829 |
| 561 | Ga0501068_0080282 | 3300049584 | Bacteria | 2001 |
| 562 | Ga0501069_0111909 | 3300049585 | Bacteria | 1555 |
| 563 | Ga0501071_0000576 | 3300049587 | Bacteria | 19026 |
| 564 | Ga0501071_0037011 | 3300049587 | Bacteria | 3482 |
| 565 | Ga0501071_0131770 | 3300049587 | Bacteria | 1858 |
| 566 | Ga0501072_0002515 | 3300049588 | Bacteria | 13729 |
| 567 | Ga0501072_0005266 | 3300049588 | Bacteria | 9851 |
| 568 | Ga0501072_0302939 | 3300049588 | Bacteria | 1270 |
| 569 | Ga0501073_0012208 | 3300049589 | Bacteria | 6273 |
| 570 | Ga0501073_0060039 | 3300049589 | Bacteria | 2654 |
| 571 | Ga0501073_0393100 | 3300049589 | Bacteria | 958 |
| 572 | Ga0501074_0074650 | 3300049590 | Bacteria | 2435 |
| 573 | Ga0501075_0000831 | 3300049591 | Bacteria | 19430 |
| 574 | Ga0501075_0013889 | 3300049591 | Bacteria | 5760 |
| 575 | Ga0501075_0032595 | 3300049591 | Bacteria | 3871 |
| 576 | Ga0501075_0062382 | 3300049591 | Bacteria | 2809 |
| 577 | Ga0501076_0000169 | 3300049592 | Bacteria | 38046 |
| 578 | Ga0501076_0045240 | 3300049592 | Bacteria | 3475 |
| 579 | Ga0501076_0070380 | 3300049592 | Bacteria | 2797 |
| 580 | Ga0501076_0086585 | 3300049592 | Bacteria | 2518 |
| 581 | Ga0501076_0126290 | 3300049592 | Bacteria | 2073 |
| 582 | Ga0501076_0154253 | 3300049592 | Bacteria | 1869 |
| 583 | Ga0501077_0017765 | 3300049593 | Bacteria | 4493 |
| 584 | Ga0501077_0080443 | 3300049593 | Bacteria | 2064 |
| 585 | Ga0501079_0000300 | 3300049741 | Bacteria | 30601 |
| 586 | Ga0501079_0063328 | 3300049741 | Bacteria | 2853 |
| 587 | Ga0501080_0003284 | 3300049742 | Bacteria | 14289 |
| 588 | Ga0501080_0040835 | 3300049742 | Bacteria | 4327 |
| 589 | Ga0501080_0054724 | 3300049742 | Bacteria | 3716 |
| 590 | Ga0501080_0117001 | 3300049742 | Bacteria | 2470 |
| 591 | Ga0501080_0145167 | 3300049742 | Bacteria | 2193 |
| 592 | Ga0501080_0226957 | 3300049742 | Bacteria | 1707 |
| 593 | Ga0501081_0000559 | 3300049743 | Bacteria | 21161 |
| 594 | Ga0501081_0006064 | 3300049743 | Bacteria | 7832 |
| 595 | Ga0501081_0012069 | 3300049743 | Bacteria | 5662 |
| 596 | Ga0501081_0013353 | 3300049743 | Bacteria | 5402 |
| 597 | Ga0501081_0036531 | 3300049743 | Bacteria | 3350 |
| 598 | Ga0501081_0060978 | 3300049743 | Bacteria | 2615 |
| 599 | Ga0501081_0075406 | 3300049743 | Bacteria | 2355 |
| 600 | Ga0501083_0020428 | 3300049744 | Bacteria | 4608 |
| 601 | Ga0501083_0031766 | 3300049744 | Bacteria | 3624 |
| 602 | Ga0501083_0080967 | 3300049744 | Bacteria | 2153 |
| 603 | Ga0501035_0003049 | 3300049822 | Bacteria | 16067 |
| 604 | Ga0501035_0037680 | 3300049822 | Bacteria | 4377 |
| 605 | Ga0501035_0084283 | 3300049822 | Bacteria | 2803 |
| 606 | Ga0501035_0113032 | 3300049822 | Bacteria | 2379 |
| 607 | Ga0501045_0001189 | 3300049824 | Bacteria | 17314 |
| 608 | Ga0501045_0032651 | 3300049824 | Bacteria | 3773 |
| 609 | Ga0501045_0054380 | 3300049824 | Bacteria | 2926 |
| 610 | Ga0501045_0085852 | 3300049824 | Bacteria | 2323 |
| 611 | nmdc:mga05p37_1145_c1 | 3300050507 | Bacteria | 30507 |
| 612 | nmdc:mga09592_138071_c1 | 3300050508 | Bacteria | 2100 |
| 613 | nmdc:mga09592_3989_c1 | 3300050508 | Bacteria | 11894 |
| 614 | nmdc:mga0qj67_114022_c1 | 3300050509 | Bacteria | 2183 |
| 615 | nmdc:mga0qj67_83310_c1 | 3300050509 | Bacteria | 2564 |
| 616 | nmdc:mga06r32_2704_c1 | 3300050510 | Bacteria | 15862 |
| 617 | nmdc:mga06r32_6144_c1 | 3300050510 | Bacteria | 10785 |
| 618 | nmdc:mga06r32_67680_c1 | 3300050510 | Bacteria | 3448 |
| 619 | nmdc:mga06r32_9158_c1 | 3300050510 | Bacteria | 8923 |
| 620 | nmdc:mga08y16_12463_c1 | 3300050511 | Bacteria | 8944 |
| 621 | nmdc:mga08y16_173259_c1 | 3300050511 | Bacteria | 2241 |
| 622 | nmdc:mga08y16_1919_c1 | 3300050511 | Bacteria | 20743 |
| 623 | nmdc:mga0n895_274257_c1 | 3300050512 | Bacteria | 1711 |
| 624 | nmdc:mga0n895_578485_c1 | 3300050512 | Bacteria | 1127 |
| 625 | nmdc:mga0rr50_119064_c1 | 3300050513 | Bacteria | 2099 |
| 626 | nmdc:mga0a205_3522_c1 | 3300050515 | Bacteria | 13991 |
| 627 | Ga0495619_0118817 | 3300053085 | Bacteria | 1812 |
| 628 | Ga0500583_0189242 | 3300053092 | Bacteria | 1024 |
| 629 | Ga0500556_0000121 | 3300053104 | Bacteria | 67560 |
| 630 | Ga0500588_0021762 | 3300053146 | Bacteria | 1736 |
| 631 | Ga0500616_0000074 | 3300053153 | Bacteria | 222910 |
| 632 | Ga0500616_0092118 | 3300053153 | Unclassified | 1499 |
| 633 | Ga0500622_0010251 | 3300053156 | Bacteria | 5150 |
| 634 | Ga0501084_0001791 | 3300054114 | Bacteria | 17108 |
| 635 | Ga0501084_0015047 | 3300054114 | Bacteria | 6415 |
| 636 | Ga0501084_0306571 | 3300054114 | Bacteria | 1341 |
| 637 | Ga0501082_0004462 | 3300060353 | Bacteria | 12220 |
| 638 | Ga0501082_0057629 | 3300060353 | Bacteria | 3346 |
| 639 | Ga0501082_0060030 | 3300060353 | Bacteria | 3276 |
| 640 | Ga0501082_0139361 | 3300060353 | Bacteria | 2105 |
| 641 | Ga0466962_0040607 | 3300061719 | Bacteria | 2226 |
| 642 | Ga0530510_0002658 | 3300061734 | Bacteria | 12282 |
| 643 | Ga0530510_0024362 | 3300061734 | Bacteria | 4318 |
| 644 | Ga0530510_0039342 | 3300061734 | Bacteria | 3413 |
| 645 | 2643796997 | 2643221556 | Bacteria | 7251154 |
| 646 | 2644469899 | 2643221684 | Bacteria | 7145183 |
| 647 | 2809147309 | 2808606418 | Bacteria | 6724496 |
| 648 | 8047676739 | 8047673197 | Bacteria | 7395230 |
| 649 | Ga0500622_0004686 | |||
| 650 | SwRhRL2b_contig_1927969 | |||
| 651 | SwRhRL2b_contig_38418 | |||
| 652 | Ga0065165_1001411 | |||
| 653 | Ga0065704_10073332 | |||
| 654 | Ga0065712_10075276 | |||
| 655 | Ga0065715_10212272 | |||
| 656 | Ga0065715_10224058 | |||
| 657 | Ga0070690_100003324 | |||
| 658 | Ga0070670_100005970 | |||
| 659 | Ga0070670_100170949 | |||
| 660 | Ga0070670_100284241 | |||
| 661 | Ga0070677_10005189 | |||
| 662 | Ga0068869_100079676 | |||
| 663 | Ga0068869_100251148 | |||
| 664 | Ga0068869_100312570 | |||
| 665 | Ga0070689_100000518 | |||
| 666 | Ga0070689_100142597 | |||
| 667 | Ga0070687_100045706 | |||
| 668 | Ga0070661_100004943 | |||
| 669 | Ga0070668_100002230 | |||
| 670 | Ga0070669_100090500 | |||
| 671 | Ga0070669_100201868 | |||
| 672 | Ga0070675_100106635 | |||
| 673 | Ga0070675_100154374 | |||
| 674 | Ga0070671_100037309 | |||
| 675 | Ga0070674_100050435 | |||
| 676 | Ga0070673_100052696 | |||
| 677 | Ga0070673_100137870 | |||
| 678 | Ga0070659_100359226 | |||
| 679 | Ga0070667_100052602 | |||
| 680 | Ga0070705_100002762 | |||
| 681 | Ga0070678_100037982 | |||
| 682 | Ga0070662_100002859 | |||
| 683 | Ga0070662_100313558 | |||
| 684 | Ga0068867_100006399 | |||
| 685 | Ga0068867_100151374 | |||
| 686 | Ga0070685_10016714 | |||
| 687 | Ga0070679_100056795 | |||
| 688 | Ga0070684_100000535 | |||
| 689 | Ga0070672_100046176 | |||
| 690 | Ga0070672_100150723 | |||
| 691 | Ga0070686_100460882 | |||
| 692 | Ga0070695_100097401 | |||
| 693 | Ga0070665_100008198 | |||
| 694 | Ga0070704_100334504 | |||
| 695 | Ga0070664_100006562 | |||
| 696 | Ga0068857_100073574 | |||
| 697 | Ga0068857_100451728 | |||
| 698 | Ga0070702_100011993 | |||
| 699 | Ga0068859_100000800 | |||
| 700 | Ga0068859_100191177 | |||
| 701 | Ga0068864_100003622 | |||
| 702 | Ga0068861_100003141 | |||
| 703 | Ga0068861_100069973 | |||
| 704 | Ga0068861_100176819 | |||
| 705 | Ga0068861_100182096 | |||
| 706 | Ga0068863_100000641 | |||
| 707 | Ga0068858_100016716 | |||
| 708 | Ga0068860_100008543 | |||
| 709 | Ga0068862_100006284 | |||
| 710 | Ga0068862_100009495 | |||
| 711 | Ga0068862_100057279 | |||
| 712 | Ga0070716_100079196 | |||
| 713 | Ga0068871_100503914 | |||
| 714 | Ga0075428_100011470 | |||
| 715 | Ga0075428_100027952 | |||
| 716 | Ga0075428_100082925 | |||
| 717 | Ga0075430_100017829 | |||
| 718 | Ga0075430_100301414 | |||
| 719 | Ga0075431_100010551 | |||
| 720 | Ga0075431_100026041 | |||
| 721 | Ga0075431_100174283 | |||
| 722 | Ga0075431_100240387 | |||
| 723 | Ga0075433_10002252 | |||
| 724 | Ga0075434_100000822 | |||
| 725 | Ga0075434_100324572 | |||
| 726 | Ga0075429_100002254 | |||
| 727 | Ga0075429_100074277 | |||
| 728 | Ga0068865_100049949 | |||
| 729 | Ga0097620_100000800 | |||
| 730 | Ga0097620_100191170 | |||
| 731 | Ga0075435_100029490 | |||
| 732 | Ga0111539_10014678 | |||
| 733 | Ga0111539_10040565 | |||
| 734 | Ga0111539_10058623 | |||
| 735 | Ga0111539_10073831 | |||
| 736 | Ga0111539_10308552 | |||
| 737 | Ga0105247_10084290 | |||
| 738 | Ga0114129_10002637 | |||
| 739 | Ga0114129_10012563 | |||
| 740 | Ga0114129_10052221 | |||
| 741 | Ga0105243_10023263 | |||
| 742 | Ga0105243_10050933 | |||
| 743 | Ga0105242_10381456 | |||
| 744 | Ga0105248_10000895 | |||
| 745 | Ga0105249_10020639 | |||
| 746 | Ga0105249_10022662 | |||
| 747 | Ga0157378_10288501 | |||
| 748 | Ga0157372_10319779 | |||
| 749 | Ga0157375_10027071 | |||
| 750 | Ga0157375_10512477 | |||
| 751 | Ga0157514_132735 | |||
| 752 | Ga0163163_10003361 | |||
| 753 | Ga0163163_10063722 | |||
| 754 | Ga0163163_10197026 | |||
| 755 | Ga0163163_10564295 | |||
| 756 | Ga0157380_10140281 | |||
| 757 | Ga0157380_10304133 | |||
| 758 | Ga0157377_10001449 | |||
| 759 | Ga0157379_10070040 | |||
| 760 | Ga0209563_100022 | |||
| 761 | Ga0209677_110628 | |||
| 762 | Ga0207697_10038466 | |||
| 763 | Ga0207682_10018244 | |||
| 764 | Ga0207682_10045950 | |||
| 765 | Ga0207642_10045384 | |||
| 766 | Ga0207688_10080977 | |||
| 767 | Ga0207645_10058030 | |||
| 768 | Ga0207643_10017292 | |||
| 769 | Ga0207660_10195433 | |||
| 770 | Ga0207662_10002920 | |||
| 771 | Ga0207657_10015055 | |||
| 772 | Ga0207649_10050897 | |||
| 773 | Ga0207650_10019103 | |||
| 774 | Ga0207659_10004777 | |||
| 775 | Ga0207659_10030982 | |||
| 776 | Ga0207659_10447045 | |||
| 777 | Ga0207644_10103904 | |||
| 778 | Ga0207706_10005686 | |||
| 779 | Ga0207686_10219726 | |||
| 780 | Ga0207709_10045067 | |||
| 781 | Ga0207670_10011922 | |||
| 782 | Ga0207670_10266156 | |||
| 783 | Ga0207669_10031133 | |||
| 784 | Ga0207704_10017981 | |||
| 785 | Ga0207665_10091048 | |||
| 786 | Ga0207691_10009188 | |||
| 787 | Ga0207691_10014816 | |||
| 788 | Ga0207691_10054902 | |||
| 789 | Ga0207711_10090776 | |||
| 790 | Ga0207689_10016166 | |||
| 791 | Ga0207689_10018683 | |||
| 792 | Ga0207689_10020364 | |||
| 793 | Ga0207679_10003697 | |||
| 794 | Ga0207679_10183586 | |||
| 795 | Ga0207651_10012849 | |||
| 796 | Ga0207651_10136885 | |||
| 797 | Ga0207712_10009525 | |||
| 798 | Ga0207712_10037028 | |||
| 799 | Ga0207668_10002493 | |||
| 800 | Ga0207668_10178882 | |||
| 801 | Ga0207658_10046714 | |||
| 802 | Ga0207703_10049246 | |||
| 803 | Ga0207641_10006163 | |||
| 804 | Ga0207641_10357170 | |||
| 805 | Ga0207641_10593663 | |||
| 806 | Ga0207648_10004869 | |||
| 807 | Ga0207676_10003107 | |||
| 808 | Ga0207674_10105386 | |||
| 809 | Ga0207674_10306261 | |||
| 810 | Ga0207675_100002949 | |||
| 811 | Ga0207675_100011263 | |||
| 812 | Ga0207675_100044693 | |||
| 813 | Ga0207683_10014654 | |||
| 814 | Ga0207683_10056349 | |||
| 815 | Ga0207683_10081214 | |||
| 816 | Ga0209971_1025878 | |||
| 817 | Ga0207428_10008110 | |||
| 818 | Ga0207428_10041811 | |||
| 819 | Ga0207428_10072783 | |||
| 820 | Ga0207428_10092787 | |||
| 821 | Ga0207428_10123457 | |||
| 822 | Ga0268266_10066423 | |||
| 823 | Ga0268266_10120731 | |||
| 824 | Ga0268265_10002021 | |||
| 825 | Ga0268265_10114121 | |||
| 826 | Ga0268264_10044676 | |||
| 827 | Ga0265338_10238581 | |||
| 828 | Ga0265770_1000304 | |||
| 829 | Ga0265760_10001385 | |||
| 830 | Ga0307408_100019871 | |||
| 831 | Ga0307408_100280192 | |||
| 832 | Ga0316575_10001493 | |||
| 833 | Ga0316575_10025914 | |||
| 834 | Ga0316578_10026778 | |||
| 835 | Ga0307413_10040649 | |||
| 836 | Ga0307410_10057114 | |||
| 837 | Ga0307406_10085626 | |||
| 838 | Ga0307407_10026773 | |||
| 839 | Ga0307412_10011602 | |||
| 840 | Ga0307412_10074927 | |||
| 841 | Ga0307409_100019806 | |||
| 842 | Ga0307409_100151799 | |||
| 843 | Ga0307416_100006976 | |||
| 844 | Ga0307416_100037042 | |||
| 845 | Ga0307416_100596844 | |||
| 846 | Ga0307411_10017072 | |||
| 847 | Ga0307411_10070186 | |||
| 848 | Ga0307411_10204188 | |||
| 849 | Ga0307415_100076242 | |||
| 850 | Ga0307415_100391619 | |||
| 851 | Ga0316580_10009313 | |||
| 852 | Ga0373930_0005720 | |||
| 853 | Ga0316574_0032274 | |||
| 854 | Ga0316574_0239445 | |||
| 855 | Ga0316582_0025599 | |||
| 856 | Ga0316584_0027053 | |||
| 857 | Ga0395899_0006928 | |||
| 858 | Ga0395899_0093337 | |||
| 859 | Ga0395900_0000992 | |||
| 860 | Ga0395900_0036534 | |||
| 861 | Ga0395900_0059863 | |||
| 862 | Ga0395900_0420405 | |||
| 863 | Ga0395898_0327665 | |||
| 864 | Ga0395905_0027921 | |||
| 865 | Ga0395905_0074984 | |||
| 866 | Ga0395905_0244196 | |||
| 867 | Ga0439453_0021112 | |||
| 868 | Ga0450919_009018 | |||
| 869 | Ga0450920_000423 | |||
| 870 | Ga0450923_000265 | |||
| 871 | Ga0450894_002255 | |||
| 872 | Ga0450896_000010 | |||
| 873 | Ga0450896_011154 | |||
| 874 | Ga0450907_002324 | |||
| 875 | Ga0439446_0004492 | |||
| 876 | Ga0450908_000545 | |||
| 877 | Ga0450908_003723 | |||
| 878 | Ga0451577_0058939 | |||
| 879 | Ga0451577_0124546 | |||
| 880 | Ga0466969_0075168 | |||
| 881 | Ga0466972_0004758 | |||
| 882 | Ga0466972_0064867 | |||
| 883 | Ga0466965_0044311 | |||
| 884 | Ga0466966_0033025 | |||
| 885 | Ga0466964_0002589 | |||
| 886 | Ga0453684_0081953 | |||
| 887 | Ga0453684_0317192 | |||
| 888 | Ga0466968_0003632 | |||
| 889 | Ga0466970_0172693 | |||
| 890 | Ga0466957_0012682 | |||
| 891 | Ga0466957_0208127 | |||
| 892 | Ga0466957_0314903 | |||
| 893 | Ga0466959_0012399 | |||
| 894 | Ga0451576_0006856 | |||
| 895 | Ga0451576_0113928 | |||
| 896 | Ga0451576_0363178 | |||
| 897 | Ga0466967_0041804 | |||
| 898 | Ga0495617_000104 | |||
| 899 | Ga0495617_049847 | |||
| 900 | Ga0495627_001021 | |||
| 901 | Ga0495603_0003286 | |||
| 902 | Ga0495590_0000179 | |||
| 903 | Ga0495590_0001207 | |||
| 904 | Ga0495590_0002723 | |||
| 905 | Ga0495591_000127 | |||
| 906 | Ga0495591_008318 | |||
| 907 | Ga0495653_0024831 | |||
| 908 | Ga0495653_0052113 | |||
| 909 | Ga0495650_0000458 | |||
| 910 | Ga0495650_0021617 | |||
| 911 | Ga0495650_0046597 | |||
| 912 | Ga0495582_0002269 | |||
| 913 | Ga0495605_0000039 | |||
| 914 | Ga0495605_0000445 | |||
| 915 | Ga0495605_0006494 | |||
| 916 | Ga0495605_0020041 | |||
| 917 | Ga0495605_0022905 | |||
| 918 | Ga0495605_0029613 | |||
| 919 | Ga0495584_0000611 | |||
| 920 | Ga0495584_0000923 | |||
| 921 | Ga0495584_0001206 | |||
| 922 | Ga0495584_0001621 | |||
| 923 | Ga0495584_0002947 | |||
| 924 | Ga0495584_0007947 | |||
| 925 | Ga0495584_0035086 | |||
| 926 | Ga0495584_0057806 | |||
| 927 | Ga0495585_0002267 | |||
| 928 | Ga0495585_0003173 | |||
| 929 | Ga0495585_0004115 | |||
| 930 | Ga0495585_0009756 | |||
| 931 | Ga0495585_0010382 | |||
| 932 | Ga0495585_0014103 | |||
| 933 | Ga0495585_0015922 | |||
| 934 | Ga0495585_0016058 | |||
| 935 | Ga0495585_0030995 | |||
| 936 | Ga0495585_0031225 | |||
| 937 | Ga0495585_0051771 | |||
| 938 | Ga0495585_0195208 | |||
| 939 | Ga0495594_0023427 | |||
| 940 | Ga0495594_0039972 | |||
| 941 | Ga0495596_0000693 | |||
| 942 | Ga0495596_0006700 | |||
| 943 | Ga0495596_0018120 | |||
| 944 | Ga0495596_0020594 | |||
| 945 | Ga0495596_0037631 | |||
| 946 | Ga0495596_0038440 | |||
| 947 | Ga0495607_0001269 | |||
| 948 | Ga0495607_0002439 | |||
| 949 | Ga0495607_0006218 | |||
| 950 | Ga0495607_0017431 | |||
| 951 | Ga0495607_0018737 | |||
| 952 | Ga0495607_0033717 | |||
| 953 | Ga0495583_0000116 | |||
| 954 | Ga0495583_0000881 | |||
| 955 | Ga0495583_0004966 | |||
| 956 | Ga0495583_0014374 | |||
| 957 | Ga0495583_0024832 | |||
| 958 | Ga0495583_0033790 | |||
| 959 | Ga0495583_0041449 | |||
| 960 | Ga0495606_0010194 | |||
| 961 | Ga0495606_0010670 | |||
| 962 | Ga0495606_0012517 | |||
| 963 | Ga0495606_0089164 | |||
| 964 | Ga0495610_0000452 | |||
| 965 | Ga0495616_0001143 | |||
| 966 | Ga0495616_0002215 | |||
| 967 | Ga0495616_0004692 | |||
| 968 | Ga0495616_0020722 | |||
| 969 | Ga0495616_0027545 | |||
| 970 | Ga0495616_0062458 | |||
| 971 | Ga0495620_0004231 | |||
| 972 | Ga0495631_0000480 | |||
| 973 | Ga0495631_0002440 | |||
| 974 | Ga0495631_0004833 | |||
| 975 | Ga0495631_0012560 | |||
| 976 | Ga0495631_0020346 | |||
| 977 | Ga0495631_0034589 | |||
| 978 | Ga0495631_0044541 | |||
| 979 | Ga0495632_0000103 | |||
| 980 | Ga0495632_0000430 | |||
| 981 | Ga0495632_0001860 | |||
| 982 | Ga0495632_0009344 | |||
| 983 | Ga0495632_0011598 | |||
| 984 | Ga0495632_0012757 | |||
| 985 | Ga0495632_0024594 | |||
| 986 | Ga0495637_0000029 | |||
| 987 | Ga0495637_0005839 | |||
| 988 | Ga0495637_0006019 | |||
| 989 | Ga0495643_0002233 | |||
| 990 | Ga0495643_0003666 | |||
| 991 | Ga0495643_0007173 | |||
| 992 | Ga0495643_0047184 | |||
| 993 | Ga0495644_0032399 | |||
| 994 | Ga0495648_0000795 | |||
| 995 | Ga0495648_0009583 | |||
| 996 | Ga0495648_0013788 | |||
| 997 | Ga0495648_0020208 | |||
| 998 | Ga0495648_0031075 | |||
| 999 | Ga0495648_0088102 | |||
| 1000 | Ga0495648_0150122 | |||
| 1001 | Ga0495663_0001068 | |||
| 1002 | Ga0495663_0061055 | |||
| 1003 | Ga0495666_0000504 | |||
| 1004 | Ga0495642_0000469 | |||
| 1005 | Ga0495642_0002531 | |||
| 1006 | Ga0495642_0003257 | |||
| 1007 | Ga0495642_0008030 | |||
| 1008 | Ga0495642_0021116 | |||
| 1009 | Ga0495642_0122650 | |||
| 1010 | Ga0495652_0030667 | |||
| 1011 | Ga0495654_0033497 | |||
| 1012 | Ga0495654_0058421 | |||
| 1013 | Ga0495654_0058749 | |||
| 1014 | Ga0495654_0072991 | |||
| 1015 | Ga0495654_0073682 | |||
| 1016 | Ga0495665_0009102 | |||
| 1017 | Ga0495665_0009467 | |||
| 1018 | Ga0495665_0082504 | |||
| 1019 | Ga0495586_0028584 | |||
| 1020 | Ga0495586_0054079 | |||
| 1021 | Ga0495609_0008158 | |||
| 1022 | Ga0495609_0010397 | |||
| 1023 | Ga0495609_0014122 | |||
| 1024 | Ga0495609_0014754 | |||
| 1025 | Ga0495609_0137183 | |||
| 1026 | Ga0495597_0000975 | |||
| 1027 | Ga0495597_0001582 | |||
| 1028 | Ga0495597_0003431 | |||
| 1029 | Ga0495597_0003997 | |||
| 1030 | Ga0495597_0005815 | |||
| 1031 | Ga0495633_0006535 | |||
| 1032 | Ga0495633_0117069 | |||
| 1033 | Ga0495668_0002707 | |||
| 1034 | Ga0495668_0003785 | |||
| 1035 | Ga0495668_0003845 | |||
| 1036 | Ga0495668_0018825 | |||
| 1037 | Ga0495668_0021434 | |||
| 1038 | Ga0495611_0000701 | |||
| 1039 | Ga0495611_0011941 | |||
| 1040 | Ga0495611_0015461 | |||
| 1041 | Ga0495611_0020830 | |||
| 1042 | Ga0495611_0051398 | |||
| 1043 | Ga0495635_0012232 | |||
| 1044 | Ga0495661_0001196 | |||
| 1045 | Ga0495661_0001409 | |||
| 1046 | Ga0495661_0001667 | |||
| 1047 | Ga0495661_0001962 | |||
| 1048 | Ga0495661_0019662 | |||
| 1049 | Ga0495661_0020800 | |||
| 1050 | Ga0495661_0026283 | |||
| 1051 | Ga0495661_0027605 | |||
| 1052 | Ga0495661_0028911 | |||
| 1053 | Ga0495661_0049860 | |||
| 1054 | Ga0495661_0061333 | |||
| 1055 | Ga0495588_0000059 | |||
| 1056 | Ga0495588_0001562 | |||
| 1057 | Ga0495588_0004011 | |||
| 1058 | Ga0495588_0127656 | |||
| 1059 | Ga0495623_0002959 | |||
| 1060 | Ga0495669_0000781 | |||
| 1061 | Ga0495669_0003090 | |||
| 1062 | Ga0495669_0077351 | |||
| 1063 | Ga0495613_0287028 | |||
| 1064 | Ga0495670_0001638 | |||
| 1065 | Ga0495670_0002386 | |||
| 1066 | Ga0495670_0015246 | |||
| 1067 | Ga0495670_0018789 | |||
| 1068 | Ga0495670_0037706 | |||
| 1069 | Ga0495671_0001145 | |||
| 1070 | Ga0495671_0001936 | |||
| 1071 | Ga0495671_0006810 | |||
| 1072 | Ga0495671_0010211 | |||
| 1073 | Ga0495649_0001435 | |||
| 1074 | Ga0495649_0001621 | |||
| 1075 | Ga0495649_0040553 | |||
| 1076 | Ga0495649_0082829 | |||
| 1077 | Ga0495589_0000047 | |||
| 1078 | Ga0495589_0000752 | |||
| 1079 | Ga0495589_0002437 | |||
| 1080 | Ga0495589_0119664 | |||
| 1081 | Ga0495600_0026151 | |||
| 1082 | Ga0495660_0000135 | |||
| 1083 | Ga0495660_0006314 | |||
| 1084 | Ga0495660_0015921 | |||
| 1085 | Ga0495660_0041442 | |||
| 1086 | Ga0495660_0047736 | |||
| 1087 | Ga0495660_0122677 | |||
| 1088 | Ga0495604_0038720 | |||
| 1089 | Ga0495604_0142603 | |||
| 1090 | Ga0495674_0031550 | |||
| 1091 | Ga0495672_0000175 | |||
| 1092 | Ga0495672_0001994 | |||
| 1093 | Ga0495672_0008748 | |||
| 1094 | Ga0495672_0015357 | |||
| 1095 | Ga0495672_0146808 | |||
| 1096 | Ga0495676_0000249 | |||
| 1097 | Ga0495680_0021322 | |||
| 1098 | Ga0495680_0165041 | |||
| 1099 | Ga0495683_0000224 | |||
| 1100 | Ga0495683_0000379 | |||
| 1101 | Ga0495683_0030313 | |||
| 1102 | Ga0495683_0085767 | |||
| 1103 | Ga0495687_000145 | |||
| 1104 | Ga0495687_000146 | |||
| 1105 | Ga0495687_000431 | |||
| 1106 | Ga0495687_000987 | |||
| 1107 | Ga0495687_128686 | |||
| 1108 | Ga0495675_0005786 | |||
| 1109 | Ga0495675_0009434 | |||
| 1110 | Ga0495675_0050420 | |||
| 1111 | Ga0495675_0193596 | |||
| 1112 | Ga0495677_0001206 | |||
| 1113 | Ga0495677_0001850 | |||
| 1114 | Ga0495677_0002504 | |||
| 1115 | Ga0495677_0007827 | |||
| 1116 | Ga0495677_0036217 | |||
| 1117 | Ga0495679_001114 | |||
| 1118 | Ga0495679_014147 | |||
| 1119 | Ga0495679_016473 | |||
| 1120 | Ga0495685_005512 | |||
| 1121 | Ga0495685_010208 | |||
| 1122 | Ga0495681_0001400 | |||
| 1123 | Ga0495681_0003608 | |||
| 1124 | Ga0495681_0008588 | |||
| 1125 | Ga0495681_0009217 | |||
| 1126 | Ga0495681_0016830 | |||
| 1127 | Ga0495681_0053176 | |||
| 1128 | Ga0495686_0000240 | |||
| 1129 | Ga0495686_0002491 | |||
| 1130 | Ga0495686_0078497 | |||
| 1131 | Ga0495602_0071712 | |||
| 1132 | Ga0495626_0000047 | |||
| 1133 | Ga0495626_0000141 | |||
| 1134 | Ga0495626_0011869 | |||
| 1135 | Ga0495626_0013727 | |||
| 1136 | Ga0495626_0020501 | |||
| 1137 | Ga0495626_0022439 | |||
| 1138 | Ga0495626_0035611 | |||
| 1139 | Ga0495626_0039031 | |||
| 1140 | Ga0496100_0028287 | |||
| 1141 | Ga0496102_0000202 | |||
| 1142 | Ga0496102_0000582 | |||
| 1143 | Ga0496102_0142426 | |||
| 1144 | Ga0496102_0185238 | |||
| 1145 | Ga0496103_0004610 | |||
| 1146 | Ga0496103_0009233 | |||
| 1147 | Ga0496104_0090589 | |||
| 1148 | Ga0496105_0217293 | |||
| 1149 | Ga0496106_0035375 | |||
| 1150 | Ga0496106_0072129 | |||
| 1151 | Ga0496107_0208637 | |||
| 1152 | Ga0496108_0106417 | |||
| 1153 | Ga0496108_0127577 | |||
| 1154 | Ga0496109_0206027 | |||
| 1155 | Ga0496110_0000454 | |||
| 1156 | Ga0496110_0039283 | |||
| 1157 | Ga0496113_0029859 | |||
| 1158 | Ga0496113_0065748 | |||
| 1159 | Ga0496113_0441934 | |||
| 1160 | Ga0496114_0001018 | |||
| 1161 | Ga0496115_0516594 | |||
| 1162 | Ga0496122_0004661 | |||
| 1163 | Ga0496122_0004891 | |||
| 1164 | Ga0496122_0028804 | |||
| 1165 | Ga0496122_0164218 | |||
| 1166 | Ga0496123_0001430 | |||
| 1167 | Ga0496123_0002318 | |||
| 1168 | Ga0496123_0039144 | |||
| 1169 | Ga0496124_0032515 | |||
| 1170 | Ga0496124_0078281 | |||
| 1171 | Ga0496125_0016060 | |||
| 1172 | Ga0496125_0049443 | |||
| 1173 | Ga0495678_000544 | |||
| 1174 | Ga0495678_000698 | |||
| 1175 | Ga0495678_001457 | |||
| 1176 | Ga0495678_006706 | |||
| 1177 | Ga0495682_0001112 | |||
| 1178 | Ga0495682_0047074 | |||
| 1179 | Ga0501298_020675 | |||
| 1180 | Ga0501034_0208146 | |||
| 1181 | Ga0501036_0002154 | |||
| 1182 | Ga0501036_0098694 | |||
| 1183 | Ga0501036_0408505 | |||
| 1184 | Ga0501037_0111761 | |||
| 1185 | Ga0501038_0036998 | |||
| 1186 | Ga0501038_0251052 | |||
| 1187 | Ga0501039_0005578 | |||
| 1188 | Ga0501039_0025869 | |||
| 1189 | Ga0501039_0050091 | |||
| 1190 | Ga0501039_0060846 | |||
| 1191 | Ga0501040_0000895 | |||
| 1192 | Ga0501040_0102178 | |||
| 1193 | Ga0501041_0002499 | |||
| 1194 | Ga0501041_0006167 | |||
| 1195 | Ga0501041_0046079 | |||
| 1196 | Ga0501041_0090457 | |||
| 1197 | Ga0501041_0277671 | |||
| 1198 | Ga0501042_0002392 | |||
| 1199 | Ga0501042_0009373 | |||
| 1200 | Ga0501042_0130800 | |||
| 1201 | Ga0501043_0055127 | |||
| 1202 | Ga0501046_0011525 | |||
| 1203 | Ga0501046_0083137 | |||
| 1204 | Ga0501046_0104215 | |||
| 1205 | Ga0501048_0001609 | |||
| 1206 | Ga0501048_0002534 | |||
| 1207 | Ga0501067_0004163 | |||
| 1208 | Ga0501068_0020792 | |||
| 1209 | Ga0501068_0080282 | |||
| 1210 | Ga0501069_0111909 | |||
| 1211 | Ga0501071_0000576 | |||
| 1212 | Ga0501071_0037011 | |||
| 1213 | Ga0501071_0131770 | |||
| 1214 | Ga0501072_0002515 | |||
| 1215 | Ga0501072_0005266 | |||
| 1216 | Ga0501072_0302939 | |||
| 1217 | Ga0501073_0012208 | |||
| 1218 | Ga0501073_0060039 | |||
| 1219 | Ga0501073_0393100 | |||
| 1220 | Ga0501074_0074650 | |||
| 1221 | Ga0501075_0000831 | |||
| 1222 | Ga0501075_0013889 | |||
| 1223 | Ga0501075_0032595 | |||
| 1224 | Ga0501075_0062382 | |||
| 1225 | Ga0501076_0000169 | |||
| 1226 | Ga0501076_0045240 | |||
| 1227 | Ga0501076_0070380 | |||
| 1228 | Ga0501076_0086585 | |||
| 1229 | Ga0501076_0126290 | |||
| 1230 | Ga0501076_0154253 | |||
| 1231 | Ga0501077_0017765 | |||
| 1232 | Ga0501077_0080443 | |||
| 1233 | Ga0501079_0000300 | |||
| 1234 | Ga0501079_0063328 | |||
| 1235 | Ga0501080_0003284 | |||
| 1236 | Ga0501080_0040835 | |||
| 1237 | Ga0501080_0054724 | |||
| 1238 | Ga0501080_0117001 | |||
| 1239 | Ga0501080_0145167 | |||
| 1240 | Ga0501080_0226957 | |||
| 1241 | Ga0501081_0000559 | |||
| 1242 | Ga0501081_0006064 | |||
| 1243 | Ga0501081_0012069 | |||
| 1244 | Ga0501081_0013353 | |||
| 1245 | Ga0501081_0036531 | |||
| 1246 | Ga0501081_0060978 | |||
| 1247 | Ga0501081_0075406 | |||
| 1248 | Ga0501083_0020428 | |||
| 1249 | Ga0501083_0031766 | |||
| 1250 | Ga0501083_0080967 | |||
| 1251 | Ga0501035_0003049 | |||
| 1252 | Ga0501035_0037680 | |||
| 1253 | Ga0501035_0084283 | |||
| 1254 | Ga0501035_0113032 | |||
| 1255 | Ga0501045_0001189 | |||
| 1256 | Ga0501045_0032651 | |||
| 1257 | Ga0501045_0054380 | |||
| 1258 | Ga0501045_0085852 | |||
| 1259 | nmdc:mga05p37_1145_c1 | |||
| 1260 | nmdc:mga09592_138071_c1 | |||
| 1261 | nmdc:mga09592_3989_c1 | |||
| 1262 | nmdc:mga0qj67_114022_c1 | |||
| 1263 | nmdc:mga0qj67_83310_c1 | |||
| 1264 | nmdc:mga06r32_2704_c1 | |||
| 1265 | nmdc:mga06r32_6144_c1 | |||
| 1266 | nmdc:mga06r32_67680_c1 | |||
| 1267 | nmdc:mga06r32_9158_c1 | |||
| 1268 | nmdc:mga08y16_12463_c1 | |||
| 1269 | nmdc:mga08y16_173259_c1 | |||
| 1270 | nmdc:mga08y16_1919_c1 | |||
| 1271 | nmdc:mga0n895_274257_c1 | |||
| 1272 | nmdc:mga0n895_578485_c1 | |||
| 1273 | nmdc:mga0rr50_119064_c1 | |||
| 1274 | nmdc:mga0a205_3522_c1 | |||
| 1275 | Ga0495619_0118817 | |||
| 1276 | Ga0500583_0189242 | |||
| 1277 | Ga0500556_0000121 | |||
| 1278 | Ga0500588_0021762 | |||
| 1279 | Ga0500616_0000074 | |||
| 1280 | Ga0500616_0092118 | |||
| 1281 | Ga0500622_0010251 | |||
| 1282 | Ga0501084_0001791 | |||
| 1283 | Ga0501084_0015047 | |||
| 1284 | Ga0501084_0306571 | |||
| 1285 | Ga0501082_0004462 | |||
| 1286 | Ga0501082_0057629 | |||
| 1287 | Ga0501082_0060030 | |||
| 1288 | Ga0501082_0139361 | |||
| 1289 | Ga0466962_0040607 | |||
| 1290 | Ga0530510_0002658 | |||
| 1291 | Ga0530510_0024362 | |||
| 1292 | Ga0530510_0039342 | |||
| 1293 | 2643796997 | |||
| 1294 | 2644469899 | |||
| 1295 | 2809147309 | |||
| 1296 | 8047676739 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4od4-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8746 | 36 | 297 |
| 4od4-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8337 | 36 | 297 |
| 7bpu-assembly1.cif.gz_A | structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes | 0.7695 | 20 | 301 |
| 7bpu-assembly1.cif.gz_A | structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes | 0.7625 | 20 | 301 |
| 8djm-assembly1.cif.gz_B | hmgcr-ubiad1 complex state 1 | 0.7207 | 18 | 297 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AGK1_170_289_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.9826 | 181 | 298 | 1.20.120.1780 |
| af_P0AGK1_23_169_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9776 | 35 | 178 | 1.10.357.140 |
| af_P0AGK1_170_289_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.9586 | 181 | 298 | 1.20.120.1780 |
| af_P0AGK1_23_169_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9516 | 35 | 178 | 1.10.357.140 |
| af_Q8I7J4_224_349_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.9412 | 181 | 299 | 1.20.120.1780 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521WIX1-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) | 0.991 | 21 | 301 |
GO:0005886
GO:0006744 GO:0008412 |
| AF-A0A2H9U6P2-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) | 0.9909 | 20 | 297 |
GO:0005886
GO:0006744 GO:0008412 |
| AF-A0A829Y5B9-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) | 0.9904 | 20 | 301 |
GO:0005886
GO:0006744 GO:0008412 |
| AF-A0A6N8XIL8-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase | 0.9903 | 153 | 300 |
GO:0005886
GO:0006744 GO:0008412 |
| AF-A0A382VXH5-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase | 0.9893 | 141 | 298 |
GO:0005886
GO:0006744 GO:0008412 |