F472389

General Info

Members Datasets Scaffolds Average Seq Length
648 290 1296 49

Family's Representative Sequence

Representative Sequence 3300041494|Ga0451837_1309814|Ga0451837_1309814_277_456
Length 59
Sequence MSGGREGETMLNVILVLLVLMWLAGMVTSYTLGGFLHLLLLLAVAVFLIRIIQGRNPVV

Samples

Sample ID Description Type Environment
1 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
194 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.49
Nodule 0
Rhizoplane 2.31
Rhizosphere 88.43
Stem 0
Stem Tuber 0
Unclassified 29.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451837_1309814 3300041494 Unclassified 508
2 rootH1_10350781 3300003323 Bacteria 1875
3 rootH1_10354200 3300003323 Bacteria 1569
4 Ga0058859_11424321 3300004798 Bacteria 609
5 Ga0065704_10563864 3300005289 Bacteria 627
6 Ga0065712_10114105 3300005290 Bacteria 1768
7 Ga0065712_10399039 3300005290 Viruses 733
8 Ga0065712_10666237 3300005290 Unclassified 561
9 Ga0065715_10351088 3300005293 Unclassified 951
10 Ga0065715_10380332 3300005293 Bacteria 908
11 Ga0065715_10452319 3300005293 Unclassified 825
12 Ga0065707_10334659 3300005295 Bacteria 943
13 Ga0065707_10341766 3300005295 Bacteria 863
14 Ga0065707_10452954 3300005295 Bacteria 798
15 Ga0070658_11979036 3300005327 Bacteria 503
16 Ga0070676_10965645 3300005328 Bacteria 638
17 Ga0070683_100677382 3300005329 Unclassified 987
18 Ga0070683_101233641 3300005329 Bacteria 719
19 Ga0070690_100197563 3300005330 Bacteria 1398
20 Ga0070690_100674969 3300005330 Bacteria 791
21 Ga0070690_101189098 3300005330 Bacteria 608
22 Ga0070670_101214897 3300005331 Unclassified 689
23 Ga0070670_102156924 3300005331 Unclassified 513
24 Ga0070677_10020951 3300005333 Bacteria 2391
25 Ga0070677_10059526 3300005333 Bacteria 1571
26 Ga0070677_10538259 3300005333 Unclassified 638
27 Ga0068869_100674657 3300005334 Unclassified 879
28 Ga0068869_101605913 3300005334 Bacteria 579
29 Ga0070666_10079998 3300005335 Bacteria 2233
30 Ga0070680_100074845 3300005336 Bacteria 2787
31 Ga0070680_101182707 3300005336 Unclassified 661
32 Ga0068868_100684486 3300005338 Bacteria 916
33 Ga0068868_101010580 3300005338 Bacteria 761
34 Ga0070660_100929214 3300005339 Unclassified 734
35 Ga0070689_100144063 3300005340 Bacteria 1918
36 Ga0070689_100561791 3300005340 Bacteria 984
37 Ga0070687_100093084 3300005343 Bacteria 1671
38 Ga0070661_101109599 3300005344 Bacteria 659
39 Ga0070668_100128071 3300005347 Bacteria 2035
40 Ga0070668_100528359 3300005347 Bacteria 1024
41 Ga0070668_101005209 3300005347 Bacteria 750
42 Ga0070669_100154970 3300005353 Bacteria 1776
43 Ga0070669_100603051 3300005353 Bacteria 920
44 Ga0070669_100725182 3300005353 Unclassified 841
45 Ga0070669_100790173 3300005353 Bacteria 806
46 Ga0070675_100041522 3300005354 Bacteria 3757
47 Ga0070675_100324606 3300005354 Bacteria 1360
48 Ga0070675_100344135 3300005354 Bacteria 1321
49 Ga0070675_100577662 3300005354 Unclassified 1018
50 Ga0070671_100003291 3300005355 Bacteria 12605
51 Ga0070674_100214548 3300005356 Bacteria 1494
52 Ga0070674_100996527 3300005356 Unclassified 735
53 Ga0070674_101515567 3300005356 Bacteria 603
54 Ga0070673_100139543 3300005364 Bacteria 2043
55 Ga0070673_101074330 3300005364 Unclassified 751
56 Ga0070673_101279947 3300005364 Bacteria 688
57 Ga0070673_101689206 3300005364 Bacteria 599
58 Ga0070673_102130813 3300005364 Unclassified 533
59 Ga0070688_100117923 3300005365 Bacteria 1774
60 Ga0070688_101128033 3300005365 Unclassified 628
61 Ga0070688_101531367 3300005365 Unclassified 543
62 Ga0070667_100180466 3300005367 Bacteria 1867
63 Ga0070667_101735030 3300005367 Unclassified 587
64 Ga0070667_101973953 3300005367 Unclassified 550
65 Ga0070709_10007194 3300005434 Bacteria 6097
66 Ga0070713_100027306 3300005436 Bacteria 4492
67 Ga0070713_100628861 3300005436 Unclassified 1021
68 Ga0070713_100982023 3300005436 Bacteria 814
69 Ga0070710_10941025 3300005437 Bacteria 626
70 Ga0070701_10160622 3300005438 Bacteria 1301
71 Ga0070701_10779403 3300005438 Bacteria 650
72 Ga0070711_100336029 3300005439 Bacteria 1211
73 Ga0070711_100758395 3300005439 Unclassified 820
74 Ga0070705_100704352 3300005440 Unclassified 793
75 Ga0070705_101114044 3300005440 Bacteria 646
76 Ga0070700_100192222 3300005441 Bacteria 1428
77 Ga0070694_100254454 3300005444 Bacteria 1330
78 Ga0070694_101653548 3300005444 Viruses 544
79 Ga0070708_100152498 3300005445 Unclassified 2150
80 Ga0070708_101332184 3300005445 Bacteria 670
81 Ga0070663_100029969 3300005455 Bacteria 3724
82 Ga0070663_100055371 3300005455 Unclassified 2839
83 Ga0070678_100348114 3300005456 Bacteria 1273
84 Ga0070678_100350840 3300005456 Bacteria 1269
85 Ga0070678_100365930 3300005456 Bacteria 1244
86 Ga0070678_101183354 3300005456 Bacteria 708
87 Ga0070678_101980056 3300005456 Unclassified 551
88 Ga0070662_100430852 3300005457 Unclassified 1092
89 Ga0070662_100758987 3300005457 Bacteria 823
90 Ga0070662_101878669 3300005457 Unclassified 517
91 Ga0068867_100431657 3300005459 Bacteria 1118
92 Ga0068867_101089205 3300005459 Unclassified 729
93 Ga0070685_10310697 3300005466 Bacteria 1065
94 Ga0070685_10379183 3300005466 Unclassified 974
95 Ga0070706_100036771 3300005467 Bacteria 4523
96 Ga0070706_100312094 3300005467 Unclassified 1467
97 Ga0070707_100288492 3300005468 Bacteria 1595
98 Ga0070699_101733415 3300005518 Unclassified 572
99 Ga0070699_101894664 3300005518 Unclassified 545
100 Ga0070684_100162445 3300005535 Bacteria 2027
101 Ga0070684_101809974 3300005535 Bacteria 576
102 Ga0068853_100518285 3300005539 Bacteria 1127
103 Ga0068853_101097572 3300005539 Unclassified 767
104 Ga0068853_101513023 3300005539 Bacteria 650
105 Ga0070672_100266319 3300005543 Bacteria 1446
106 Ga0070672_100511656 3300005543 Bacteria 1039
107 Ga0070672_101779325 3300005543 Unclassified 554
108 Ga0070686_100221383 3300005544 Bacteria 1368
109 Ga0070686_101908359 3300005544 Bacteria 507
110 Ga0070695_100101960 3300005545 Bacteria 1934
111 Ga0070695_100898209 3300005545 Bacteria 715
112 Ga0070695_100921381 3300005545 Unclassified 707
113 Ga0070695_101022544 3300005545 Unclassified 673
114 Ga0070695_101224957 3300005545 Unclassified 618
115 Ga0070696_100896114 3300005546 Unclassified 736
116 Ga0070693_101592502 3300005547 Unclassified 513
117 Ga0070665_100178148 3300005548 Bacteria 2127
118 Ga0070665_100223165 3300005548 Bacteria 1885
119 Ga0070704_100589227 3300005549 Bacteria 976
120 Ga0070704_100604231 3300005549 Unclassified 964
121 Ga0070704_100694201 3300005549 Unclassified 902
122 Ga0070664_100021322 3300005564 Bacteria 5338
123 Ga0070664_100508804 3300005564 Unclassified 1111
124 Ga0068854_100205075 3300005578 Bacteria 1552
125 Ga0068854_101051793 3300005578 Bacteria 723
126 Ga0070702_100050468 3300005615 Bacteria 2376
127 Ga0070702_100143611 3300005615 Bacteria 1523
128 Ga0070702_101370503 3300005615 Unclassified 577
129 Ga0068852_100213785 3300005616 Bacteria 1831
130 Ga0068852_100541284 3300005616 Unclassified 1164
131 Ga0068852_102479282 3300005616 Unclassified 539
132 Ga0068859_101886444 3300005617 Unclassified 660
133 Ga0068864_100050565 3300005618 Bacteria 3578
134 Ga0068864_101800916 3300005618 Bacteria 617
135 Ga0068866_10917579 3300005718 Unclassified 617
136 Ga0068861_100242827 3300005719 Bacteria 1533
137 Ga0068861_100442218 3300005719 Bacteria 1163
138 Ga0068851_10053827 3300005834 Bacteria 2050
139 Ga0068851_10193087 3300005834 Unclassified 1133
140 Ga0068870_10330359 3300005840 Unclassified 972
141 Ga0068870_10831173 3300005840 Unclassified 648
142 Ga0068863_100307382 3300005841 Unclassified 1538
143 Ga0068863_101048957 3300005841 Bacteria 819
144 Ga0068863_102215587 3300005841 Unclassified 559
145 Ga0068858_100353966 3300005842 Bacteria 1407
146 Ga0068858_101526187 3300005842 Bacteria 659
147 Ga0068858_101899155 3300005842 Unclassified 588
148 Ga0068860_100260485 3300005843 Unclassified 1690
149 Ga0068862_100217104 3300005844 Unclassified 1730
150 Ga0068862_101957816 3300005844 Viruses 596
151 Ga0081455_10104530 3300005937 Bacteria 2265
152 Ga0081455_10506699 3300005937 Bacteria 809
153 Ga0070717_10446493 3300006028 Bacteria 1165
154 Ga0075368_10051468 3300006042 Bacteria 1637
155 Ga0075368_10160638 3300006042 Bacteria 941
156 Ga0075363_100120804 3300006048 Unclassified 1463
157 Ga0075363_100574331 3300006048 Bacteria 674
158 Ga0075364_10032738 3300006051 Bacteria 3342
159 Ga0075364_10168707 3300006051 Bacteria 1479
160 Ga0075364_10396967 3300006051 Unclassified 941
161 Ga0070715_10691020 3300006163 Bacteria 608
162 Ga0070715_10907310 3300006163 Unclassified 543
163 Ga0070715_11030716 3300006163 Unclassified 514
164 Ga0070716_100657731 3300006173 Unclassified 795
165 Ga0070712_100316377 3300006175 Unclassified 1268
166 Ga0075362_10380486 3300006177 Unclassified 710
167 Ga0075362_10686599 3300006177 Unclassified 533
168 Ga0075362_10726644 3300006177 Bacteria 519
169 Ga0075367_10005524 3300006178 Bacteria 6292
170 Ga0075367_10026165 3300006178 Bacteria 3306
171 Ga0075367_10068212 3300006178 Bacteria 2133
172 Ga0075367_10073360 3300006178 Bacteria 2062
173 Ga0075427_10026084 3300006194 Bacteria 945
174 Ga0075366_10005089 3300006195 Bacteria 7111
175 Ga0075366_10049930 3300006195 Bacteria 2483
176 Ga0075366_10063106 3300006195 Bacteria 2202
177 Ga0075366_10091434 3300006195 Bacteria 1823
178 Ga0075366_10122957 3300006195 Bacteria 1564
179 Ga0075366_10240346 3300006195 Bacteria 1104
180 Ga0075366_10742489 3300006195 Bacteria 610
181 Ga0075366_10933515 3300006195 Bacteria 541
182 Ga0097621_100030736 3300006237 Bacteria 4255
183 Ga0075370_10009143 3300006353 Bacteria 5130
184 Ga0075370_10131691 3300006353 Unclassified 1459
185 Ga0075370_10450864 3300006353 Bacteria 774
186 Ga0075370_10519700 3300006353 Bacteria 719
187 Ga0068871_100142132 3300006358 Bacteria 2041
188 Ga0075428_100042691 3300006844 Bacteria 4986
189 Ga0075428_100173120 3300006844 Bacteria 2339
190 Ga0075428_101034966 3300006844 Bacteria 868
191 Ga0075428_101119017 3300006844 Unclassified 831
192 Ga0075428_101352524 3300006844 Unclassified 748
193 Ga0075428_101363155 3300006844 Bacteria 745
194 Ga0075428_102073007 3300006844 Unclassified 589
195 Ga0075430_100280613 3300006846 Bacteria 1378
196 Ga0075430_101646402 3300006846 Unclassified 527
197 Ga0075430_101752992 3300006846 Unclassified 509
198 Ga0075431_100020464 3300006847 Bacteria 6760
199 Ga0075431_100070948 3300006847 Bacteria 3593
200 Ga0075431_100405928 3300006847 Unclassified 1363
201 Ga0075431_100551885 3300006847 Bacteria 1139
202 Ga0075431_100631369 3300006847 Unclassified 1053
203 Ga0075431_100817475 3300006847 Bacteria 904
204 Ga0075431_101611539 3300006847 Bacteria 607
205 Ga0075431_101722208 3300006847 Bacteria 583
206 Ga0075431_102122325 3300006847 Unclassified 516
207 Ga0075433_10131399 3300006852 Unclassified 2224
208 Ga0075433_10444077 3300006852 Bacteria 1143
209 Ga0075433_11039399 3300006852 Bacteria 713
210 Ga0075434_100005220 3300006871 Bacteria 11800
211 Ga0075434_100219287 3300006871 Unclassified 1922
212 Ga0075434_100352986 3300006871 Bacteria 1492
213 Ga0075434_100371356 3300006871 Bacteria 1451
214 Ga0075434_100386025 3300006871 Unclassified 1421
215 Ga0075429_100342571 3300006880 Bacteria 1308
216 Ga0075429_100464800 3300006880 Bacteria 1108
217 Ga0075429_100865206 3300006880 Unclassified 791
218 Ga0075429_100931173 3300006880 Bacteria 760
219 Ga0068865_100126000 3300006881 Bacteria 1912
220 Ga0068865_100840386 3300006881 Unclassified 795
221 Ga0068865_101075714 3300006881 Bacteria 707
222 Ga0075436_100134884 3300006914 Bacteria 1733
223 Ga0075436_100592885 3300006914 Bacteria 816
224 Ga0097620_101886148 3300006931 Unclassified 660
225 Ga0075435_100238354 3300007076 Bacteria 1546
226 Ga0105244_10524346 3300009036 Bacteria 546
227 Ga0111539_10004195 3300009094 Bacteria 18909
228 Ga0111539_10245132 3300009094 Unclassified 2086
229 Ga0111539_10748069 3300009094 Bacteria 1138
230 Ga0111539_10807357 3300009094 Unclassified 1092
231 Ga0111539_10844733 3300009094 Bacteria 1065
232 Ga0111539_11101724 3300009094 Bacteria 923
233 Ga0111539_11548532 3300009094 Unclassified 769
234 Ga0111539_11563967 3300009094 Bacteria 765
235 Ga0111539_11830469 3300009094 Unclassified 704
236 Ga0105245_10426666 3300009098 Bacteria 1330
237 Ga0105245_11883102 3300009098 Bacteria 651
238 Ga0114129_10003069 3300009147 Bacteria 23429
239 Ga0114129_10005827 3300009147 Bacteria 17453
240 Ga0114129_10174166 3300009147 Bacteria 2931
241 Ga0114129_10314268 3300009147 Bacteria 2084
242 Ga0114129_10345159 3300009147 Bacteria 1973
243 Ga0114129_10446728 3300009147 Bacteria 1696
244 Ga0114129_12504327 3300009147 Unclassified 617
245 Ga0105243_10040040 3300009148 Bacteria 3657
246 Ga0105243_10261825 3300009148 Unclassified 1549
247 Ga0105241_10848475 3300009174 Unclassified 845
248 Ga0105242_10051559 3300009176 Bacteria 3354
249 Ga0105242_10095841 3300009176 Bacteria 2505
250 Ga0105242_10719784 3300009176 Unclassified 979
251 Ga0105242_10978434 3300009176 Bacteria 852
252 Ga0105242_11302961 3300009176 Bacteria 750
253 Ga0105242_12089094 3300009176 Bacteria 610
254 Ga0105248_10084482 3300009177 Bacteria 3571
255 Ga0105248_10408141 3300009177 Bacteria 1529
256 Ga0105248_10571181 3300009177 Bacteria 1276
257 Ga0105237_11587646 3300009545 Bacteria 661
258 Ga0105249_10055785 3300009553 Bacteria 3616
259 Ga0105249_10208808 3300009553 Bacteria 1915
260 Ga0105249_10727548 3300009553 Unclassified 1054
261 Ga0105249_12791683 3300009553 Unclassified 560
262 Ga0105239_11550787 3300010375 Unclassified 766
263 Ga0105246_10674662 3300011119 Bacteria 903
264 Ga0105246_10859407 3300011119 Bacteria 810
265 Ga0157374_10119175 3300013296 Bacteria 2546
266 Ga0157374_12135609 3300013296 Bacteria 587
267 Ga0157378_11291552 3300013297 Unclassified 771
268 Ga0163162_10767877 3300013306 Unclassified 1083
269 Ga0163162_11458523 3300013306 Unclassified 779
270 Ga0157375_10106210 3300013308 Bacteria 2899
271 Ga0157375_10693405 3300013308 Unclassified 1172
272 Ga0163163_10125514 3300014325 Bacteria 2604
273 Ga0163163_10371702 3300014325 Bacteria 1487
274 Ga0163163_11077672 3300014325 Unclassified 866
275 Ga0163163_11234100 3300014325 Unclassified 810
276 Ga0157380_10292536 3300014326 Bacteria 1496
277 Ga0157380_10542093 3300014326 Bacteria 1139
278 Ga0157380_10691588 3300014326 Bacteria 1023
279 Ga0157377_10106003 3300014745 Bacteria 1683
280 Ga0157377_10118024 3300014745 Bacteria 1604
281 Ga0157377_11302969 3300014745 Unclassified 568
282 Ga0157379_10096798 3300014968 Unclassified 2649
283 Ga0157379_10454383 3300014968 Bacteria 1183
284 Ga0157376_10081543 3300014969 Bacteria 2778
285 Ga0157376_10269809 3300014969 Bacteria 1598
286 Ga0157376_10285503 3300014969 Unclassified 1556
287 Ga0163161_10041612 3300017792 Bacteria 3302
288 Ga0163161_10137863 3300017792 Bacteria 1845
289 Ga0207697_10089575 3300025315 Bacteria 1303
290 Ga0207656_10315120 3300025321 Unclassified 776
291 Ga0207656_10413314 3300025321 Unclassified 679
292 Ga0207682_10116776 3300025893 Bacteria 1180
293 Ga0207642_10347342 3300025899 Bacteria 874
294 Ga0207680_10780112 3300025903 Bacteria 685
295 Ga0207647_10177934 3300025904 Unclassified 1237
296 Ga0207685_10263941 3300025905 Unclassified 838
297 Ga0207685_10612937 3300025905 Unclassified 585
298 Ga0207699_10079104 3300025906 Bacteria 2033
299 Ga0207645_10143377 3300025907 Bacteria 1557
300 Ga0207643_10324300 3300025908 Bacteria 962
301 Ga0207684_10088410 3300025910 Bacteria 2640
302 Ga0207684_10567339 3300025910 Unclassified 970
303 Ga0207654_10115167 3300025911 Unclassified 1679
304 Ga0207654_10904382 3300025911 Unclassified 640
305 Ga0207671_10954140 3300025914 Bacteria 677
306 Ga0207693_10229364 3300025915 Bacteria 1458
307 Ga0207663_10048601 3300025916 Bacteria 2627
308 Ga0207663_10772453 3300025916 Unclassified 764
309 Ga0207660_10047636 3300025917 Bacteria 3032
310 Ga0207662_10760282 3300025918 Bacteria 682
311 Ga0207649_10075004 3300025920 Bacteria 2172
312 Ga0207649_11468967 3300025920 Bacteria 540
313 Ga0207646_10359784 3300025922 Bacteria 1315
314 Ga0207650_10766742 3300025925 Bacteria 817
315 Ga0207650_11069892 3300025925 Bacteria 686
316 Ga0207659_10037613 3300025926 Bacteria 3361
317 Ga0207659_10079955 3300025926 Bacteria 2414
318 Ga0207659_10080740 3300025926 Unclassified 2403
319 Ga0207659_10294129 3300025926 Bacteria 1331
320 Ga0207659_10944802 3300025926 Bacteria 741
321 Ga0207687_11540623 3300025927 Unclassified 571
322 Ga0207700_10036097 3300025928 Bacteria 3567
323 Ga0207700_11635592 3300025928 Unclassified 569
324 Ga0207644_10043376 3300025931 Bacteria 3191
325 Ga0207706_11713835 3300025933 Unclassified 506
326 Ga0207686_10528601 3300025934 Bacteria 919
327 Ga0207686_10889104 3300025934 Bacteria 718
328 Ga0207709_10212747 3300025935 Unclassified 1389
329 Ga0207709_10357275 3300025935 Bacteria 1105
330 Ga0207670_10735992 3300025936 Unclassified 818
331 Ga0207670_11286190 3300025936 Bacteria 620
332 Ga0207669_10325607 3300025937 Bacteria 1178
333 Ga0207704_10033609 3300025938 Unclassified 2918
334 Ga0207704_10850813 3300025938 Unclassified 764
335 Ga0207704_10908782 3300025938 Bacteria 741
336 Ga0207704_11330189 3300025938 Bacteria 615
337 Ga0207691_10205842 3300025940 Unclassified 1711
338 Ga0207691_10313324 3300025940 Bacteria 1346
339 Ga0207691_10523710 3300025940 Bacteria 1006
340 Ga0207691_10530523 3300025940 Bacteria 999
341 Ga0207711_10030376 3300025941 Bacteria 4557
342 Ga0207711_10417783 3300025941 Bacteria 1247
343 Ga0207711_10662605 3300025941 Unclassified 973
344 Ga0207661_10366063 3300025944 Bacteria 1303
345 Ga0207679_10024152 3300025945 Bacteria 4165
346 Ga0207679_10284350 3300025945 Unclassified 1420
347 Ga0207679_10743859 3300025945 Unclassified 892
348 Ga0207651_10073450 3300025960 Bacteria 2432
349 Ga0207651_10585567 3300025960 Bacteria 974
350 Ga0207668_10107154 3300025972 Bacteria 2089
351 Ga0207640_11264258 3300025981 Bacteria 658
352 Ga0207658_10612454 3300025986 Bacteria 979
353 Ga0207677_12039418 3300026023 Bacteria 533
354 Ga0207677_12259328 3300026023 Bacteria 506
355 Ga0207639_10298239 3300026041 Bacteria 1424
356 Ga0207639_10526886 3300026041 Bacteria 1082
357 Ga0207639_11722260 3300026041 Unclassified 587
358 Ga0207678_10038422 3300026067 Bacteria 4159
359 Ga0207678_10122554 3300026067 Bacteria 2218
360 Ga0207708_10036092 3300026075 Bacteria 3762
361 Ga0207708_10335466 3300026075 Bacteria 1237
362 Ga0207641_10019776 3300026088 Bacteria 5528
363 Ga0207641_10143955 3300026088 Bacteria 2154
364 Ga0207648_10424267 3300026089 Unclassified 1208
365 Ga0207648_10935550 3300026089 Bacteria 810
366 Ga0207676_10079028 3300026095 Bacteria 2666
367 Ga0207676_11820906 3300026095 Unclassified 607
368 Ga0207675_100284958 3300026118 Unclassified 1606
369 Ga0207675_100588600 3300026118 Bacteria 1115
370 Ga0207675_101648748 3300026118 Bacteria 661
371 Ga0207675_102424301 3300026118 Bacteria 537
372 Ga0207683_10030651 3300026121 Bacteria 4662
373 Ga0207683_10388993 3300026121 Bacteria 1282
374 Ga0207698_10180809 3300026142 Bacteria 1868
375 Ga0209813_10111520 3300027866 Unclassified 943
376 Ga0209813_10285644 3300027866 Bacteria 637
377 Ga0209813_10462743 3300027866 Bacteria 521
378 Ga0207428_10122799 3300027907 Bacteria 1990
379 Ga0268266_10058497 3300028379 Bacteria 3319
380 Ga0268266_10080048 3300028379 Bacteria 2846
381 Ga0268265_11233310 3300028380 Bacteria 746
382 Ga0268265_11660730 3300028380 Bacteria 644
383 Ga0265336_10030436 3300028666 Bacteria 1681
384 Ga0265327_10008248 3300031251 Bacteria 7805
385 Ga0307408_100437938 3300031548 Bacteria 1131
386 Ga0307406_10946798 3300031901 Bacteria 736
387 Ga0307409_102428276 3300031995 Bacteria 553
388 Ga0307416_100599786 3300032002 Bacteria 1181
389 Ga0307416_101717012 3300032002 Bacteria 732
390 Ga0307416_101747440 3300032002 Bacteria 726
391 Ga0307416_103561872 3300032002 Bacteria 521
392 Ga0373926_0137260 3300035083 Unclassified 928
393 Ga0373923_0507656 3300035111 Unclassified 588
394 Ga0373936_0269043 3300035113 Unclassified 764
395 Ga0373953_0171148 3300035117 Unclassified 935
396 Ga0373956_0142991 3300035119 Bacteria 1124
397 Ga0373956_0213883 3300035119 Bacteria 915
398 Ga0373957_0074313 3300035120 Unclassified 1334
399 Ga0373957_0365488 3300035120 Unclassified 618
400 Ga0373943_0049060 3300035170 Bacteria 2071
401 Ga0373943_0089998 3300035170 Bacteria 1588
402 Ga0373943_0442208 3300035170 Unclassified 755
403 Ga0373943_0565310 3300035170 Bacteria 668
404 Ga0373946_0002780 3300035171 Bacteria 6195
405 Ga0373946_0012456 3300035171 Unclassified 3184
406 Ga0373946_0286794 3300035171 Bacteria 811
407 Ga0373955_0126340 3300035172 Bacteria 1490
408 Ga0373955_0149715 3300035172 Bacteria 1373
409 Ga0373955_0302416 3300035172 Unclassified 965
410 Ga0373955_1035895 3300035172 Unclassified 505
411 Ga0373924_0003510 3300035410 Bacteria 5404
412 Ga0373931_0983458 3300035691 Unclassified 570
413 Ga0373935_0308444 3300035692 Bacteria 1120
414 Ga0373935_0716917 3300035692 Unclassified 736
415 Ga0373933_0293918 3300035724 Bacteria 1051
416 Ga0373947_0002311 3300035725 Bacteria 11517
417 Ga0373947_0038900 3300035725 Unclassified 2829
418 Ga0373937_0656107 3300036401 Bacteria 995
419 Ga0373937_1653451 3300036401 Unclassified 587
420 Ga0373925_0004127 3300037068 Bacteria 11019
421 Ga0373925_0033458 3300037068 Bacteria 3788
422 Ga0373925_1726608 3300037068 Unclassified 511
423 Ga0451807_1350585 3300041486 Unclassified 1104
424 Ga0451853_1844582 3300041512 Bacteria 1312
425 Ga0450920_017999 3300042122 Bacteria 1352
426 Ga0450896_006906 3300042133 Unclassified 1562
427 Ga0450898_038454 3300042134 Unclassified 898
428 Ga0439446_0279144 3300042156 Bacteria 582
429 Ga0439464_0090549 3300042439 Bacteria 922
430 Ga0439460_0182375 3300042461 Unclassified 710
431 Ga0439460_0227279 3300042461 Bacteria 641
432 Ga0451577_1919247 3300042876 Unclassified 518
433 Ga0451576_0000110 3300045051 Bacteria 210334
434 Ga0451576_0171742 3300045051 Bacteria 2263
435 Ga0495592_0096735 3300046454 Unclassified 2110
436 Ga0495592_0916606 3300046454 Bacteria 514
437 Ga0495580_0871384 3300046472 Unclassified 580
438 Ga0495608_0209737 3300046511 Bacteria 1225
439 Ga0495608_0225157 3300046511 Unclassified 1175
440 Ga0495628_0406714 3300046516 Unclassified 993
441 Ga0495630_0019982 3300046517 Unclassified 4931
442 Ga0495652_0699429 3300046529 Unclassified 682
443 Ga0495665_0328325 3300046531 Unclassified 781
444 Ga0495586_0157250 3300046535 Bacteria 1281
445 Ga0495634_0584768 3300046642 Unclassified 649
446 Ga0495635_0110927 3300046663 Bacteria 1874
447 Ga0495635_0566975 3300046663 Bacteria 743
448 Ga0495657_0447947 3300046675 Bacteria 756
449 Ga0495599_0335093 3300046678 Bacteria 909
450 Ga0495647_0303583 3300046681 Bacteria 720
451 Ga0495658_0122350 3300046683 Bacteria 1575
452 Ga0495658_0464883 3300046683 Bacteria 808
453 Ga0495658_0480362 3300046683 Unclassified 794
454 Ga0495669_0004485 3300046684 Bacteria 5768
455 Ga0495613_0065067 3300046689 Bacteria 2665
456 Ga0495613_0764846 3300046689 Unclassified 632
457 Ga0495600_0252159 3300046809 Bacteria 1122
458 Ga0495600_0877558 3300046809 Unclassified 530
459 Ga0495604_0053808 3300047317 Bacteria 3109
460 Ga0495674_0119614 3300047319 Bacteria 2226
461 Ga0495674_0394256 3300047319 Unclassified 1118
462 Ga0495684_0000120 3300047471 Bacteria 57458
463 Ga0495593_0437059 3300047673 Unclassified 655
464 Ga0495602_0760575 3300048088 Unclassified 653
465 Ga0496100_1452880 3300048903 Unclassified 541
466 Ga0496101_0195541 3300048904 Bacteria 1562
467 Ga0496102_0452735 3300048905 Unclassified 1204
468 Ga0496104_0201469 3300048907 Unclassified 1902
469 Ga0496105_0059544 3300048908 Bacteria 3151
470 Ga0496105_0589006 3300048908 Bacteria 864
471 Ga0496105_1210687 3300048908 Bacteria 555
472 Ga0496106_0907645 3300048909 Bacteria 695
473 Ga0496109_0488762 3300048912 Bacteria 1162
474 Ga0496110_0115454 3300048913 Bacteria 2417
475 Ga0496111_0378559 3300048914 Unclassified 1047
476 Ga0496114_0019012 3300048917 Bacteria 5565
477 Ga0496114_0099492 3300048917 Bacteria 2480
478 Ga0496115_0443632 3300048918 Unclassified 1049
479 Ga0501031_0003834 3300049568 Bacteria 9673
480 Ga0501031_0023534 3300049568 Bacteria 4015
481 Ga0501031_0045228 3300049568 Bacteria 2872
482 Ga0501031_0307142 3300049568 Bacteria 1028
483 Ga0501032_0036893 3300049569 Bacteria 3335
484 Ga0501032_0066980 3300049569 Bacteria 2399
485 Ga0501032_0140462 3300049569 Bacteria 1590
486 Ga0501033_0002656 3300049570 Bacteria 15022
487 Ga0501033_0032808 3300049570 Bacteria 3899
488 Ga0501033_0034976 3300049570 Bacteria 3765
489 Ga0501034_0015515 3300049571 Bacteria 7826
490 Ga0501034_0109328 3300049571 Bacteria 2755
491 Ga0501034_0151015 3300049571 Bacteria 2298
492 Ga0501036_0000736 3300049572 Bacteria 24203
493 Ga0501036_0034073 3300049572 Bacteria 4306
494 Ga0501036_0069266 3300049572 Bacteria 2984
495 Ga0501036_0076780 3300049572 Bacteria 2826
496 Ga0501037_0001691 3300049573 Bacteria 16037
497 Ga0501037_0017021 3300049573 Bacteria 5348
498 Ga0501037_0105364 3300049573 Bacteria 2032
499 Ga0501038_0056964 3300049574 Bacteria 3356
500 Ga0501038_0057808 3300049574 Bacteria 3328
501 Ga0501038_0179355 3300049574 Bacteria 1710
502 Ga0501038_0505524 3300049574 Bacteria 923
503 Ga0501039_0004068 3300049575 Bacteria 10996
504 Ga0501039_0021503 3300049575 Bacteria 4948
505 Ga0501039_0228788 3300049575 Bacteria 1462
506 Ga0501040_0150656 3300049576 Bacteria 1641
507 Ga0501040_0280169 3300049576 Bacteria 1191
508 Ga0501042_0019253 3300049578 Bacteria 4737
509 Ga0501042_0041318 3300049578 Bacteria 3279
510 Ga0501042_0358366 3300049578 Bacteria 1055
511 Ga0501043_0010240 3300049579 Bacteria 7349
512 Ga0501043_0032928 3300049579 Bacteria 4076
513 Ga0501043_0088440 3300049579 Bacteria 2434
514 Ga0501046_0005980 3300049580 Bacteria 10830
515 Ga0501046_0008645 3300049580 Bacteria 8853
516 Ga0501046_0095669 3300049580 Bacteria 2281
517 Ga0501047_0007619 3300049581 Bacteria 10190
518 Ga0501047_0179348 3300049581 Bacteria 1984
519 Ga0501047_0818792 3300049581 Bacteria 745
520 Ga0501048_0001747 3300049582 Bacteria 16531
521 Ga0501048_0050038 3300049582 Bacteria 2976
522 Ga0501048_0098754 3300049582 Bacteria 2059
523 Ga0501048_0170965 3300049582 Bacteria 1539
524 Ga0501048_0774100 3300049582 Bacteria 689
525 Ga0501067_0000667 3300049583 Bacteria 18455
526 Ga0501067_0066401 3300049583 Bacteria 1996
527 Ga0501068_0002566 3300049584 Bacteria 9636
528 Ga0501068_0013785 3300049584 Bacteria 4605
529 Ga0501068_0033414 3300049584 Bacteria 3063
530 Ga0501068_0216701 3300049584 Bacteria 1216
531 Ga0501069_0000864 3300049585 Bacteria 14389
532 Ga0501069_0004495 3300049585 Bacteria 7206
533 Ga0501069_0006759 3300049585 Bacteria 6005
534 Ga0501070_0008605 3300049586 Bacteria 8629
535 Ga0501070_0008973 3300049586 Bacteria 8457
536 Ga0501070_0347843 3300049586 Bacteria 1203
537 Ga0501071_0049041 3300049587 Bacteria 3038
538 Ga0501071_0059868 3300049587 Bacteria 2756
539 Ga0501072_0060664 3300049588 Bacteria 2982
540 Ga0501072_0065545 3300049588 Bacteria 2864
541 Ga0501073_0008385 3300049589 Bacteria 7666
542 Ga0501073_0009371 3300049589 Bacteria 7226
543 Ga0501073_0015623 3300049589 Bacteria 5508
544 Ga0501074_0000197 3300049590 Bacteria 32785
545 Ga0501074_0017863 3300049590 Bacteria 5153
546 Ga0501074_0039684 3300049590 Bacteria 3409
547 Ga0501075_0045462 3300049591 Bacteria 3296
548 Ga0501076_0034538 3300049592 Bacteria 3953
549 Ga0501076_0121583 3300049592 Bacteria 2114
550 Ga0501206_051837 3300049653 Unclassified 655
551 Ga0501079_0002309 3300049741 Bacteria 13805
552 Ga0501079_0053754 3300049741 Bacteria 3106
553 Ga0501080_0027704 3300049742 Bacteria 5268
554 Ga0501080_0053819 3300049742 Bacteria 3748
555 Ga0501080_1681762 3300049742 Bacteria 536
556 Ga0501081_0215595 3300049743 Bacteria 1395
557 Ga0501081_0247317 3300049743 Unclassified 1301
558 Ga0501081_0404983 3300049743 Bacteria 1010
559 Ga0501083_0001645 3300049744 Bacteria 15248
560 Ga0501083_0095344 3300049744 Bacteria 1963
561 Ga0501035_0006399 3300049822 Bacteria 11071
562 Ga0501035_0255897 3300049822 Unclassified 1485
563 Ga0501035_0965930 3300049822 Bacteria 671
564 Ga0501044_0007809 3300049823 Bacteria 11760
565 Ga0501044_0064105 3300049823 Bacteria 3752
566 Ga0501045_0008748 3300049824 Bacteria 7062
567 Ga0501045_0022869 3300049824 Bacteria 4478
568 Ga0501045_0647537 3300049824 Bacteria 781
569 nmdc:mga03683_269709_c1 3300050489 Unclassified 793
570 nmdc:mga03n38_507915_c1 3300050490 Bacteria 677
571 nmdc:mga03n38_97453_c1 3300050490 Unclassified 1412
572 nmdc:mga00v17_348617_c1 3300050491 Bacteria 963
573 nmdc:mga00v17_438032_c1 3300050491 Unclassified 849
574 nmdc:mga00v17_63157_c1 3300050491 Bacteria 2280
575 nmdc:mga0yw44_1104444_c1 3300050492 Bacteria 536
576 nmdc:mga0yw44_120560_c1 3300050492 Bacteria 1689
577 nmdc:mga0k408_10150_c1 3300050493 Bacteria 5090
578 nmdc:mga0k408_16619_c1 3300050493 Bacteria 4086
579 nmdc:mga0k408_236347_c1 3300050493 Bacteria 1091
580 nmdc:mga0k408_688243_c1 3300050493 Unclassified 600
581 nmdc:mga0k408_73332_c1 3300050493 Bacteria 1999
582 nmdc:mga06z11_17292_c1 3300050494 Bacteria 3270
583 nmdc:mga06z11_212984_c1 3300050494 Bacteria 1126
584 nmdc:mga06z11_8842_c1 3300050494 Bacteria 4219
585 nmdc:mga06z11_975763_c1 3300050494 Bacteria 516
586 nmdc:mga04h51_14386_c1 3300050495 Bacteria 2261
587 nmdc:mga04h51_25141_c1 3300050495 Unclassified 1830
588 nmdc:mga04h51_29158_c2 3300050495 Unclassified 1297
589 nmdc:mga07m45_165359_c1 3300050496 Bacteria 1285
590 nmdc:mga07m45_248201_c1 3300050496 Bacteria 1036
591 nmdc:mga07m45_2950_c2 3300050496 Bacteria 5129
592 nmdc:mga07m45_440279_c1 3300050496 Bacteria 756
593 nmdc:mga05p37_14463_c1 3300050507 Bacteria 9475
594 nmdc:mga05p37_166415_c1 3300050507 Bacteria 2691
595 nmdc:mga05p37_2207045_c1 3300050507 Unclassified 511
596 nmdc:mga05p37_259932_c1 3300050507 Bacteria 2078
597 nmdc:mga05p37_449013_c1 3300050507 Bacteria 1493
598 nmdc:mga05p37_467086_c1 3300050507 Bacteria 1457
599 nmdc:mga05p37_5063_c1 3300050507 Bacteria 15451
600 nmdc:mga05p37_6868_c1 3300050507 Bacteria 13415
601 nmdc:mga05p37_700086_c1 3300050507 Unclassified 1126
602 nmdc:mga0qj67_449059_c1 3300050509 Bacteria 1038
603 nmdc:mga0qj67_755257_c1 3300050509 Unclassified 771
604 nmdc:mga06r32_1032369_c1 3300050510 Unclassified 774
605 nmdc:mga06r32_1328944_c1 3300050510 Bacteria 662
606 nmdc:mga06r32_1436626_c1 3300050510 Unclassified 631
607 nmdc:mga06r32_1478763_c1 3300050510 Unclassified 620
608 nmdc:mga06r32_15160_c1 3300050510 Bacteria 6999
609 nmdc:mga06r32_625632_c1 3300050510 Unclassified 1046
610 nmdc:mga06r32_80767_c1 3300050510 Unclassified 3165
611 nmdc:mga06r32_854729_c1 3300050510 Unclassified 868
612 nmdc:mga08y16_1282771_c1 3300050511 Unclassified 700
613 nmdc:mga08y16_1789057_c1 3300050511 Unclassified 568
614 nmdc:mga08y16_2065626_c1 3300050511 Bacteria 518
615 nmdc:mga08y16_3330_c1 3300050511 Bacteria 16639
616 nmdc:mga08y16_44989_c1 3300050511 Bacteria 4625
617 nmdc:mga08y16_732139_c1 3300050511 Bacteria 986
618 nmdc:mga08y16_993158_c1 3300050511 Unclassified 820
619 nmdc:mga0n895_1303690_c1 3300050512 Unclassified 697
620 nmdc:mga0n895_176170_c1 3300050512 Bacteria 2169
621 nmdc:mga0n895_1920335_c1 3300050512 Unclassified 551
622 nmdc:mga0n895_562916_c1 3300050512 Unclassified 1145
623 nmdc:mga0n895_693371_c1 3300050512 Bacteria 1015
624 nmdc:mga0rr50_158060_c1 3300050513 Bacteria 1837
625 nmdc:mga0rr50_1757547_c1 3300050513 Unclassified 522
626 nmdc:mga0rr50_236340_c1 3300050513 Bacteria 1513
627 nmdc:mga08x19_528711_c1 3300050514 Bacteria 834
628 nmdc:mga08x19_980685_c1 3300050514 Bacteria 600
629 nmdc:mga0a205_1132474_c1 3300050515 Unclassified 630
630 nmdc:mga0a205_186627_c1 3300050515 Bacteria 1966
631 nmdc:mga0sz30_219815_c1 3300050516 Bacteria 844
632 Ga0495601_0004587 3300053077 Bacteria 7993
633 Ga0495601_0034667 3300053077 Bacteria 3149
634 Ga0495601_0106965 3300053077 Unclassified 1809
635 Ga0495595_0006352 3300053084 Bacteria 4815
636 Ga0495595_0017906 3300053084 Bacteria 3053
637 Ga0495619_0002332 3300053085 Bacteria 12498
638 Ga0495619_0068098 3300053085 Bacteria 2377
639 Ga0500628_264258 3300053129 Unclassified 508
640 Ga0501084_0009481 3300054114 Bacteria 8054
641 Ga0501084_0145110 3300054114 Bacteria 1999
642 Ga0501084_0147438 3300054114 Bacteria 1982
643 Ga0587082_170619 3300059504 Unclassified 527
644 Ga0501082_0002482 3300060353 Bacteria 16165
645 Ga0501082_0049538 3300060353 Bacteria 3622
646 Ga0501082_0096710 3300060353 Bacteria 2552
647 Ga0530510_0041064 3300061734 Bacteria 3340
648 Ga0530510_0176444 3300061734 Bacteria 1584
649 Ga0451837_1309814
650 rootH1_10350781
651 rootH1_10354200
652 Ga0058859_11424321
653 Ga0065704_10563864
654 Ga0065712_10114105
655 Ga0065712_10399039
656 Ga0065712_10666237
657 Ga0065715_10351088
658 Ga0065715_10380332
659 Ga0065715_10452319
660 Ga0065707_10334659
661 Ga0065707_10341766
662 Ga0065707_10452954
663 Ga0070658_11979036
664 Ga0070676_10965645
665 Ga0070683_100677382
666 Ga0070683_101233641
667 Ga0070690_100197563
668 Ga0070690_100674969
669 Ga0070690_101189098
670 Ga0070670_101214897
671 Ga0070670_102156924
672 Ga0070677_10020951
673 Ga0070677_10059526
674 Ga0070677_10538259
675 Ga0068869_100674657
676 Ga0068869_101605913
677 Ga0070666_10079998
678 Ga0070680_100074845
679 Ga0070680_101182707
680 Ga0068868_100684486
681 Ga0068868_101010580
682 Ga0070660_100929214
683 Ga0070689_100144063
684 Ga0070689_100561791
685 Ga0070687_100093084
686 Ga0070661_101109599
687 Ga0070668_100128071
688 Ga0070668_100528359
689 Ga0070668_101005209
690 Ga0070669_100154970
691 Ga0070669_100603051
692 Ga0070669_100725182
693 Ga0070669_100790173
694 Ga0070675_100041522
695 Ga0070675_100324606
696 Ga0070675_100344135
697 Ga0070675_100577662
698 Ga0070671_100003291
699 Ga0070674_100214548
700 Ga0070674_100996527
701 Ga0070674_101515567
702 Ga0070673_100139543
703 Ga0070673_101074330
704 Ga0070673_101279947
705 Ga0070673_101689206
706 Ga0070673_102130813
707 Ga0070688_100117923
708 Ga0070688_101128033
709 Ga0070688_101531367
710 Ga0070667_100180466
711 Ga0070667_101735030
712 Ga0070667_101973953
713 Ga0070709_10007194
714 Ga0070713_100027306
715 Ga0070713_100628861
716 Ga0070713_100982023
717 Ga0070710_10941025
718 Ga0070701_10160622
719 Ga0070701_10779403
720 Ga0070711_100336029
721 Ga0070711_100758395
722 Ga0070705_100704352
723 Ga0070705_101114044
724 Ga0070700_100192222
725 Ga0070694_100254454
726 Ga0070694_101653548
727 Ga0070708_100152498
728 Ga0070708_101332184
729 Ga0070663_100029969
730 Ga0070663_100055371
731 Ga0070678_100348114
732 Ga0070678_100350840
733 Ga0070678_100365930
734 Ga0070678_101183354
735 Ga0070678_101980056
736 Ga0070662_100430852
737 Ga0070662_100758987
738 Ga0070662_101878669
739 Ga0068867_100431657
740 Ga0068867_101089205
741 Ga0070685_10310697
742 Ga0070685_10379183
743 Ga0070706_100036771
744 Ga0070706_100312094
745 Ga0070707_100288492
746 Ga0070699_101733415
747 Ga0070699_101894664
748 Ga0070684_100162445
749 Ga0070684_101809974
750 Ga0068853_100518285
751 Ga0068853_101097572
752 Ga0068853_101513023
753 Ga0070672_100266319
754 Ga0070672_100511656
755 Ga0070672_101779325
756 Ga0070686_100221383
757 Ga0070686_101908359
758 Ga0070695_100101960
759 Ga0070695_100898209
760 Ga0070695_100921381
761 Ga0070695_101022544
762 Ga0070695_101224957
763 Ga0070696_100896114
764 Ga0070693_101592502
765 Ga0070665_100178148
766 Ga0070665_100223165
767 Ga0070704_100589227
768 Ga0070704_100604231
769 Ga0070704_100694201
770 Ga0070664_100021322
771 Ga0070664_100508804
772 Ga0068854_100205075
773 Ga0068854_101051793
774 Ga0070702_100050468
775 Ga0070702_100143611
776 Ga0070702_101370503
777 Ga0068852_100213785
778 Ga0068852_100541284
779 Ga0068852_102479282
780 Ga0068859_101886444
781 Ga0068864_100050565
782 Ga0068864_101800916
783 Ga0068866_10917579
784 Ga0068861_100242827
785 Ga0068861_100442218
786 Ga0068851_10053827
787 Ga0068851_10193087
788 Ga0068870_10330359
789 Ga0068870_10831173
790 Ga0068863_100307382
791 Ga0068863_101048957
792 Ga0068863_102215587
793 Ga0068858_100353966
794 Ga0068858_101526187
795 Ga0068858_101899155
796 Ga0068860_100260485
797 Ga0068862_100217104
798 Ga0068862_101957816
799 Ga0081455_10104530
800 Ga0081455_10506699
801 Ga0070717_10446493
802 Ga0075368_10051468
803 Ga0075368_10160638
804 Ga0075363_100120804
805 Ga0075363_100574331
806 Ga0075364_10032738
807 Ga0075364_10168707
808 Ga0075364_10396967
809 Ga0070715_10691020
810 Ga0070715_10907310
811 Ga0070715_11030716
812 Ga0070716_100657731
813 Ga0070712_100316377
814 Ga0075362_10380486
815 Ga0075362_10686599
816 Ga0075362_10726644
817 Ga0075367_10005524
818 Ga0075367_10026165
819 Ga0075367_10068212
820 Ga0075367_10073360
821 Ga0075427_10026084
822 Ga0075366_10005089
823 Ga0075366_10049930
824 Ga0075366_10063106
825 Ga0075366_10091434
826 Ga0075366_10122957
827 Ga0075366_10240346
828 Ga0075366_10742489
829 Ga0075366_10933515
830 Ga0097621_100030736
831 Ga0075370_10009143
832 Ga0075370_10131691
833 Ga0075370_10450864
834 Ga0075370_10519700
835 Ga0068871_100142132
836 Ga0075428_100042691
837 Ga0075428_100173120
838 Ga0075428_101034966
839 Ga0075428_101119017
840 Ga0075428_101352524
841 Ga0075428_101363155
842 Ga0075428_102073007
843 Ga0075430_100280613
844 Ga0075430_101646402
845 Ga0075430_101752992
846 Ga0075431_100020464
847 Ga0075431_100070948
848 Ga0075431_100405928
849 Ga0075431_100551885
850 Ga0075431_100631369
851 Ga0075431_100817475
852 Ga0075431_101611539
853 Ga0075431_101722208
854 Ga0075431_102122325
855 Ga0075433_10131399
856 Ga0075433_10444077
857 Ga0075433_11039399
858 Ga0075434_100005220
859 Ga0075434_100219287
860 Ga0075434_100352986
861 Ga0075434_100371356
862 Ga0075434_100386025
863 Ga0075429_100342571
864 Ga0075429_100464800
865 Ga0075429_100865206
866 Ga0075429_100931173
867 Ga0068865_100126000
868 Ga0068865_100840386
869 Ga0068865_101075714
870 Ga0075436_100134884
871 Ga0075436_100592885
872 Ga0097620_101886148
873 Ga0075435_100238354
874 Ga0105244_10524346
875 Ga0111539_10004195
876 Ga0111539_10245132
877 Ga0111539_10748069
878 Ga0111539_10807357
879 Ga0111539_10844733
880 Ga0111539_11101724
881 Ga0111539_11548532
882 Ga0111539_11563967
883 Ga0111539_11830469
884 Ga0105245_10426666
885 Ga0105245_11883102
886 Ga0114129_10003069
887 Ga0114129_10005827
888 Ga0114129_10174166
889 Ga0114129_10314268
890 Ga0114129_10345159
891 Ga0114129_10446728
892 Ga0114129_12504327
893 Ga0105243_10040040
894 Ga0105243_10261825
895 Ga0105241_10848475
896 Ga0105242_10051559
897 Ga0105242_10095841
898 Ga0105242_10719784
899 Ga0105242_10978434
900 Ga0105242_11302961
901 Ga0105242_12089094
902 Ga0105248_10084482
903 Ga0105248_10408141
904 Ga0105248_10571181
905 Ga0105237_11587646
906 Ga0105249_10055785
907 Ga0105249_10208808
908 Ga0105249_10727548
909 Ga0105249_12791683
910 Ga0105239_11550787
911 Ga0105246_10674662
912 Ga0105246_10859407
913 Ga0157374_10119175
914 Ga0157374_12135609
915 Ga0157378_11291552
916 Ga0163162_10767877
917 Ga0163162_11458523
918 Ga0157375_10106210
919 Ga0157375_10693405
920 Ga0163163_10125514
921 Ga0163163_10371702
922 Ga0163163_11077672
923 Ga0163163_11234100
924 Ga0157380_10292536
925 Ga0157380_10542093
926 Ga0157380_10691588
927 Ga0157377_10106003
928 Ga0157377_10118024
929 Ga0157377_11302969
930 Ga0157379_10096798
931 Ga0157379_10454383
932 Ga0157376_10081543
933 Ga0157376_10269809
934 Ga0157376_10285503
935 Ga0163161_10041612
936 Ga0163161_10137863
937 Ga0207697_10089575
938 Ga0207656_10315120
939 Ga0207656_10413314
940 Ga0207682_10116776
941 Ga0207642_10347342
942 Ga0207680_10780112
943 Ga0207647_10177934
944 Ga0207685_10263941
945 Ga0207685_10612937
946 Ga0207699_10079104
947 Ga0207645_10143377
948 Ga0207643_10324300
949 Ga0207684_10088410
950 Ga0207684_10567339
951 Ga0207654_10115167
952 Ga0207654_10904382
953 Ga0207671_10954140
954 Ga0207693_10229364
955 Ga0207663_10048601
956 Ga0207663_10772453
957 Ga0207660_10047636
958 Ga0207662_10760282
959 Ga0207649_10075004
960 Ga0207649_11468967
961 Ga0207646_10359784
962 Ga0207650_10766742
963 Ga0207650_11069892
964 Ga0207659_10037613
965 Ga0207659_10079955
966 Ga0207659_10080740
967 Ga0207659_10294129
968 Ga0207659_10944802
969 Ga0207687_11540623
970 Ga0207700_10036097
971 Ga0207700_11635592
972 Ga0207644_10043376
973 Ga0207706_11713835
974 Ga0207686_10528601
975 Ga0207686_10889104
976 Ga0207709_10212747
977 Ga0207709_10357275
978 Ga0207670_10735992
979 Ga0207670_11286190
980 Ga0207669_10325607
981 Ga0207704_10033609
982 Ga0207704_10850813
983 Ga0207704_10908782
984 Ga0207704_11330189
985 Ga0207691_10205842
986 Ga0207691_10313324
987 Ga0207691_10523710
988 Ga0207691_10530523
989 Ga0207711_10030376
990 Ga0207711_10417783
991 Ga0207711_10662605
992 Ga0207661_10366063
993 Ga0207679_10024152
994 Ga0207679_10284350
995 Ga0207679_10743859
996 Ga0207651_10073450
997 Ga0207651_10585567
998 Ga0207668_10107154
999 Ga0207640_11264258
1000 Ga0207658_10612454
1001 Ga0207677_12039418
1002 Ga0207677_12259328
1003 Ga0207639_10298239
1004 Ga0207639_10526886
1005 Ga0207639_11722260
1006 Ga0207678_10038422
1007 Ga0207678_10122554
1008 Ga0207708_10036092
1009 Ga0207708_10335466
1010 Ga0207641_10019776
1011 Ga0207641_10143955
1012 Ga0207648_10424267
1013 Ga0207648_10935550
1014 Ga0207676_10079028
1015 Ga0207676_11820906
1016 Ga0207675_100284958
1017 Ga0207675_100588600
1018 Ga0207675_101648748
1019 Ga0207675_102424301
1020 Ga0207683_10030651
1021 Ga0207683_10388993
1022 Ga0207698_10180809
1023 Ga0209813_10111520
1024 Ga0209813_10285644
1025 Ga0209813_10462743
1026 Ga0207428_10122799
1027 Ga0268266_10058497
1028 Ga0268266_10080048
1029 Ga0268265_11233310
1030 Ga0268265_11660730
1031 Ga0265336_10030436
1032 Ga0265327_10008248
1033 Ga0307408_100437938
1034 Ga0307406_10946798
1035 Ga0307409_102428276
1036 Ga0307416_100599786
1037 Ga0307416_101717012
1038 Ga0307416_101747440
1039 Ga0307416_103561872
1040 Ga0373926_0137260
1041 Ga0373923_0507656
1042 Ga0373936_0269043
1043 Ga0373953_0171148
1044 Ga0373956_0142991
1045 Ga0373956_0213883
1046 Ga0373957_0074313
1047 Ga0373957_0365488
1048 Ga0373943_0049060
1049 Ga0373943_0089998
1050 Ga0373943_0442208
1051 Ga0373943_0565310
1052 Ga0373946_0002780
1053 Ga0373946_0012456
1054 Ga0373946_0286794
1055 Ga0373955_0126340
1056 Ga0373955_0149715
1057 Ga0373955_0302416
1058 Ga0373955_1035895
1059 Ga0373924_0003510
1060 Ga0373931_0983458
1061 Ga0373935_0308444
1062 Ga0373935_0716917
1063 Ga0373933_0293918
1064 Ga0373947_0002311
1065 Ga0373947_0038900
1066 Ga0373937_0656107
1067 Ga0373937_1653451
1068 Ga0373925_0004127
1069 Ga0373925_0033458
1070 Ga0373925_1726608
1071 Ga0451807_1350585
1072 Ga0451853_1844582
1073 Ga0450920_017999
1074 Ga0450896_006906
1075 Ga0450898_038454
1076 Ga0439446_0279144
1077 Ga0439464_0090549
1078 Ga0439460_0182375
1079 Ga0439460_0227279
1080 Ga0451577_1919247
1081 Ga0451576_0000110
1082 Ga0451576_0171742
1083 Ga0495592_0096735
1084 Ga0495592_0916606
1085 Ga0495580_0871384
1086 Ga0495608_0209737
1087 Ga0495608_0225157
1088 Ga0495628_0406714
1089 Ga0495630_0019982
1090 Ga0495652_0699429
1091 Ga0495665_0328325
1092 Ga0495586_0157250
1093 Ga0495634_0584768
1094 Ga0495635_0110927
1095 Ga0495635_0566975
1096 Ga0495657_0447947
1097 Ga0495599_0335093
1098 Ga0495647_0303583
1099 Ga0495658_0122350
1100 Ga0495658_0464883
1101 Ga0495658_0480362
1102 Ga0495669_0004485
1103 Ga0495613_0065067
1104 Ga0495613_0764846
1105 Ga0495600_0252159
1106 Ga0495600_0877558
1107 Ga0495604_0053808
1108 Ga0495674_0119614
1109 Ga0495674_0394256
1110 Ga0495684_0000120
1111 Ga0495593_0437059
1112 Ga0495602_0760575
1113 Ga0496100_1452880
1114 Ga0496101_0195541
1115 Ga0496102_0452735
1116 Ga0496104_0201469
1117 Ga0496105_0059544
1118 Ga0496105_0589006
1119 Ga0496105_1210687
1120 Ga0496106_0907645
1121 Ga0496109_0488762
1122 Ga0496110_0115454
1123 Ga0496111_0378559
1124 Ga0496114_0019012
1125 Ga0496114_0099492
1126 Ga0496115_0443632
1127 Ga0501031_0003834
1128 Ga0501031_0023534
1129 Ga0501031_0045228
1130 Ga0501031_0307142
1131 Ga0501032_0036893
1132 Ga0501032_0066980
1133 Ga0501032_0140462
1134 Ga0501033_0002656
1135 Ga0501033_0032808
1136 Ga0501033_0034976
1137 Ga0501034_0015515
1138 Ga0501034_0109328
1139 Ga0501034_0151015
1140 Ga0501036_0000736
1141 Ga0501036_0034073
1142 Ga0501036_0069266
1143 Ga0501036_0076780
1144 Ga0501037_0001691
1145 Ga0501037_0017021
1146 Ga0501037_0105364
1147 Ga0501038_0056964
1148 Ga0501038_0057808
1149 Ga0501038_0179355
1150 Ga0501038_0505524
1151 Ga0501039_0004068
1152 Ga0501039_0021503
1153 Ga0501039_0228788
1154 Ga0501040_0150656
1155 Ga0501040_0280169
1156 Ga0501042_0019253
1157 Ga0501042_0041318
1158 Ga0501042_0358366
1159 Ga0501043_0010240
1160 Ga0501043_0032928
1161 Ga0501043_0088440
1162 Ga0501046_0005980
1163 Ga0501046_0008645
1164 Ga0501046_0095669
1165 Ga0501047_0007619
1166 Ga0501047_0179348
1167 Ga0501047_0818792
1168 Ga0501048_0001747
1169 Ga0501048_0050038
1170 Ga0501048_0098754
1171 Ga0501048_0170965
1172 Ga0501048_0774100
1173 Ga0501067_0000667
1174 Ga0501067_0066401
1175 Ga0501068_0002566
1176 Ga0501068_0013785
1177 Ga0501068_0033414
1178 Ga0501068_0216701
1179 Ga0501069_0000864
1180 Ga0501069_0004495
1181 Ga0501069_0006759
1182 Ga0501070_0008605
1183 Ga0501070_0008973
1184 Ga0501070_0347843
1185 Ga0501071_0049041
1186 Ga0501071_0059868
1187 Ga0501072_0060664
1188 Ga0501072_0065545
1189 Ga0501073_0008385
1190 Ga0501073_0009371
1191 Ga0501073_0015623
1192 Ga0501074_0000197
1193 Ga0501074_0017863
1194 Ga0501074_0039684
1195 Ga0501075_0045462
1196 Ga0501076_0034538
1197 Ga0501076_0121583
1198 Ga0501206_051837
1199 Ga0501079_0002309
1200 Ga0501079_0053754
1201 Ga0501080_0027704
1202 Ga0501080_0053819
1203 Ga0501080_1681762
1204 Ga0501081_0215595
1205 Ga0501081_0247317
1206 Ga0501081_0404983
1207 Ga0501083_0001645
1208 Ga0501083_0095344
1209 Ga0501035_0006399
1210 Ga0501035_0255897
1211 Ga0501035_0965930
1212 Ga0501044_0007809
1213 Ga0501044_0064105
1214 Ga0501045_0008748
1215 Ga0501045_0022869
1216 Ga0501045_0647537
1217 nmdc:mga03683_269709_c1
1218 nmdc:mga03n38_507915_c1
1219 nmdc:mga03n38_97453_c1
1220 nmdc:mga00v17_348617_c1
1221 nmdc:mga00v17_438032_c1
1222 nmdc:mga00v17_63157_c1
1223 nmdc:mga0yw44_1104444_c1
1224 nmdc:mga0yw44_120560_c1
1225 nmdc:mga0k408_10150_c1
1226 nmdc:mga0k408_16619_c1
1227 nmdc:mga0k408_236347_c1
1228 nmdc:mga0k408_688243_c1
1229 nmdc:mga0k408_73332_c1
1230 nmdc:mga06z11_17292_c1
1231 nmdc:mga06z11_212984_c1
1232 nmdc:mga06z11_8842_c1
1233 nmdc:mga06z11_975763_c1
1234 nmdc:mga04h51_14386_c1
1235 nmdc:mga04h51_25141_c1
1236 nmdc:mga04h51_29158_c2
1237 nmdc:mga07m45_165359_c1
1238 nmdc:mga07m45_248201_c1
1239 nmdc:mga07m45_2950_c2
1240 nmdc:mga07m45_440279_c1
1241 nmdc:mga05p37_14463_c1
1242 nmdc:mga05p37_166415_c1
1243 nmdc:mga05p37_2207045_c1
1244 nmdc:mga05p37_259932_c1
1245 nmdc:mga05p37_449013_c1
1246 nmdc:mga05p37_467086_c1
1247 nmdc:mga05p37_5063_c1
1248 nmdc:mga05p37_6868_c1
1249 nmdc:mga05p37_700086_c1
1250 nmdc:mga0qj67_449059_c1
1251 nmdc:mga0qj67_755257_c1
1252 nmdc:mga06r32_1032369_c1
1253 nmdc:mga06r32_1328944_c1
1254 nmdc:mga06r32_1436626_c1
1255 nmdc:mga06r32_1478763_c1
1256 nmdc:mga06r32_15160_c1
1257 nmdc:mga06r32_625632_c1
1258 nmdc:mga06r32_80767_c1
1259 nmdc:mga06r32_854729_c1
1260 nmdc:mga08y16_1282771_c1
1261 nmdc:mga08y16_1789057_c1
1262 nmdc:mga08y16_2065626_c1
1263 nmdc:mga08y16_3330_c1
1264 nmdc:mga08y16_44989_c1
1265 nmdc:mga08y16_732139_c1
1266 nmdc:mga08y16_993158_c1
1267 nmdc:mga0n895_1303690_c1
1268 nmdc:mga0n895_176170_c1
1269 nmdc:mga0n895_1920335_c1
1270 nmdc:mga0n895_562916_c1
1271 nmdc:mga0n895_693371_c1
1272 nmdc:mga0rr50_158060_c1
1273 nmdc:mga0rr50_1757547_c1
1274 nmdc:mga0rr50_236340_c1
1275 nmdc:mga08x19_528711_c1
1276 nmdc:mga08x19_980685_c1
1277 nmdc:mga0a205_1132474_c1
1278 nmdc:mga0a205_186627_c1
1279 nmdc:mga0sz30_219815_c1
1280 Ga0495601_0004587
1281 Ga0495601_0034667
1282 Ga0495601_0106965
1283 Ga0495595_0006352
1284 Ga0495595_0017906
1285 Ga0495619_0002332
1286 Ga0495619_0068098
1287 Ga0500628_264258
1288 Ga0501084_0009481
1289 Ga0501084_0145110
1290 Ga0501084_0147438
1291 Ga0587082_170619
1292 Ga0501082_0002482
1293 Ga0501082_0049538
1294 Ga0501082_0096710
1295 Ga0530510_0041064
1296 Ga0530510_0176444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18919

DUF5670

Family of unknown function (DUF5670)

10

53

0.96

Map