F472325

General Info

Members Datasets Scaffolds Average Seq Length
647 279 1294 128

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_177917_c1|nmdc:mga08y16_177917_c1_1720_2157
Length 145
Sequence VDEHREDGLMATETKLKPETGAELPPLSVTPDKYLPHRYAGASGDFNPIHIDPEFAKAVGLPGNILHGLYTMAQVARAAEVAGGDDPRCLKRLAVQFRGMGQPEKEINVTGSVKSAGDGRVVVDVVAEQDGNQIIRNAEAEIQLS

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
92 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
93 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
179 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
182 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
211 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
274 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 9.58
Rhizosphere 87.64
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_177917_c1 3300050511 Unclassified 2209
2 JGI25407J50210_10000233 3300003373 Bacteria 9644
3 JGI25407J50210_10008696 3300003373 Bacteria 2562
4 JGI25407J50210_10072377 3300003373 Bacteria 860
5 JGI25407J50210_10078679 3300003373 Bacteria 820
6 JGI25404J52841_10026289 3300003659 Bacteria 1253
7 JGI25405J52794_10056828 3300003911 Unclassified 843
8 Ga0070658_10198559 3300005327 Bacteria 1692
9 Ga0070658_10602733 3300005327 Bacteria 952
10 Ga0070683_100033929 3300005329 Bacteria 4658
11 Ga0070683_101644373 3300005329 Bacteria 617
12 Ga0068869_100013146 3300005334 Bacteria 5497
13 Ga0070666_11386935 3300005335 Bacteria 525
14 Ga0070680_100002551 3300005336 Bacteria 13470
15 Ga0070682_100007296 3300005337 Bacteria 6232
16 Ga0070682_100953012 3300005337 Bacteria 709
17 Ga0068868_100003404 3300005338 Bacteria 11065
18 Ga0068868_100217665 3300005338 Bacteria 1598
19 Ga0068868_101228988 3300005338 Bacteria 694
20 Ga0070660_100035020 3300005339 Bacteria 3798
21 Ga0070660_100056844 3300005339 Bacteria 3028
22 Ga0070660_100207267 3300005339 Bacteria 1591
23 Ga0070660_100424072 3300005339 Bacteria 1102
24 Ga0070689_100116020 3300005340 Bacteria 2135
25 Ga0070691_10149389 3300005341 Bacteria 1197
26 Ga0070691_10288032 3300005341 Bacteria 893
27 Ga0070691_10500857 3300005341 Bacteria 702
28 Ga0070687_100214912 3300005343 Bacteria 1174
29 Ga0070687_100982509 3300005343 Bacteria 611
30 Ga0070661_100032307 3300005344 Bacteria 3789
31 Ga0070661_100108087 3300005344 Bacteria 2075
32 Ga0070661_100965307 3300005344 Bacteria 706
33 Ga0070668_100832029 3300005347 Bacteria 822
34 Ga0070668_101515956 3300005347 Bacteria 613
35 Ga0070675_100042230 3300005354 Bacteria 3726
36 Ga0070671_100933677 3300005355 Bacteria 759
37 Ga0070674_100612754 3300005356 Unclassified 921
38 Ga0070674_101397108 3300005356 Bacteria 627
39 Ga0070688_100655426 3300005365 Bacteria 809
40 Ga0070659_100011747 3300005366 Bacteria 6481
41 Ga0070659_100405214 3300005366 Bacteria 1152
42 Ga0070659_100983742 3300005366 Bacteria 740
43 Ga0070659_101740295 3300005366 Bacteria 558
44 Ga0070667_100586898 3300005367 Bacteria 1026
45 Ga0070714_100151260 3300005435 Bacteria 2092
46 Ga0070714_100356850 3300005435 Bacteria 1374
47 Ga0070713_100048553 3300005436 Bacteria 3495
48 Ga0070701_10206875 3300005438 Bacteria 1163
49 Ga0070711_100627337 3300005439 Bacteria 899
50 Ga0070700_100004105 3300005441 Bacteria 7584
51 Ga0070700_100241953 3300005441 Bacteria 1290
52 Ga0070694_100311625 3300005444 Bacteria 1209
53 Ga0070694_101494113 3300005444 Bacteria 572
54 Ga0070663_100300381 3300005455 Bacteria 1285
55 Ga0070678_101075162 3300005456 Bacteria 742
56 Ga0070681_10004341 3300005458 Bacteria 13480
57 Ga0070685_10005220 3300005466 Bacteria 6586
58 Ga0070685_10373109 3300005466 Bacteria 981
59 Ga0070707_101055516 3300005468 Bacteria 778
60 Ga0070698_100715536 3300005471 Bacteria 944
61 Ga0070699_101162738 3300005518 Bacteria 708
62 Ga0070679_100040324 3300005530 Bacteria 4646
63 Ga0070679_100082316 3300005530 Bacteria 3208
64 Ga0070679_100086479 3300005530 Bacteria 3122
65 Ga0070684_100014096 3300005535 Bacteria 6464
66 Ga0070684_100046482 3300005535 Bacteria 3761
67 Ga0070684_100233231 3300005535 Bacteria 1680
68 Ga0070684_101398088 3300005535 Bacteria 659
69 Ga0068853_101611192 3300005539 Bacteria 629
70 Ga0068853_102144177 3300005539 Bacteria 542
71 Ga0070686_100877283 3300005544 Unclassified 728
72 Ga0070695_100159808 3300005545 Bacteria 1581
73 Ga0070695_101304416 3300005545 Bacteria 600
74 Ga0070696_100297604 3300005546 Bacteria 1235
75 Ga0070696_100793340 3300005546 Bacteria 779
76 Ga0070693_100228091 3300005547 Bacteria 1224
77 Ga0070665_100060079 3300005548 Bacteria 3811
78 Ga0070665_100109022 3300005548 Bacteria 2771
79 Ga0070704_100093827 3300005549 Bacteria 2244
80 Ga0070704_101256095 3300005549 Bacteria 677
81 Ga0070704_101269853 3300005549 Bacteria 673
82 Ga0070664_100015448 3300005564 Bacteria 6246
83 Ga0070664_100576894 3300005564 Bacteria 1042
84 Ga0068857_101079473 3300005577 Bacteria 775
85 Ga0068854_100035271 3300005578 Bacteria 3500
86 Ga0068854_100112094 3300005578 Bacteria 2059
87 Ga0068856_100051603 3300005614 Bacteria 4055
88 Ga0068856_100193389 3300005614 Bacteria 2048
89 Ga0068856_100329343 3300005614 Bacteria 1545
90 Ga0068856_100713769 3300005614 Bacteria 1023
91 Ga0068852_100091045 3300005616 Bacteria 2729
92 Ga0068852_101468978 3300005616 Bacteria 704
93 Ga0068864_100014305 3300005618 Bacteria 6592
94 Ga0068866_10223747 3300005718 Bacteria 1137
95 Ga0068866_10486314 3300005718 Bacteria 814
96 Ga0068861_100086614 3300005719 Bacteria 2463
97 Ga0068861_101251004 3300005719 Bacteria 720
98 Ga0068861_101759740 3300005719 Bacteria 614
99 Ga0068851_10319106 3300005834 Bacteria 897
100 Ga0068858_100547674 3300005842 Bacteria 1120
101 Ga0068858_102242074 3300005842 Bacteria 540
102 Ga0068862_100665057 3300005844 Bacteria 1006
103 Ga0081455_10013066 3300005937 Bacteria 8230
104 Ga0081455_10107938 3300005937 Bacteria 2218
105 Ga0081455_10172814 3300005937 Bacteria 1644
106 Ga0081455_10207736 3300005937 Bacteria 1461
107 Ga0081455_10309044 3300005937 Bacteria 1131
108 Ga0081455_10351431 3300005937 Bacteria 1040
109 Ga0081455_10436305 3300005937 Bacteria 899
110 Ga0081455_10716306 3300005937 Unclassified 636
111 Ga0081538_10000009 3300005981 Bacteria 172017
112 Ga0081538_10000010 3300005981 Bacteria 164857
113 Ga0081538_10000228 3300005981 Bacteria 63185
114 Ga0081538_10000360 3300005981 Bacteria 51870
115 Ga0081538_10000752 3300005981 Bacteria 35370
116 Ga0081538_10000910 3300005981 Bacteria 31938
117 Ga0081538_10001757 3300005981 Bacteria 21975
118 Ga0081538_10002867 3300005981 Bacteria 16478
119 Ga0081538_10012620 3300005981 Bacteria 6762
120 Ga0081538_10019366 3300005981 Bacteria 5061
121 Ga0081538_10020023 3300005981 Bacteria 4945
122 Ga0081538_10026473 3300005981 Bacteria 4055
123 Ga0081538_10030168 3300005981 Bacteria 3687
124 Ga0081538_10035837 3300005981 Bacteria 3252
125 Ga0081538_10097576 3300005981 Bacteria 1493
126 Ga0081538_10198868 3300005981 Bacteria 827
127 Ga0081540_1001048 3300005983 Bacteria 24669
128 Ga0081540_1001533 3300005983 Bacteria 19840
129 Ga0081540_1017907 3300005983 Bacteria 4367
130 Ga0081540_1058329 3300005983 Bacteria 1860
131 Ga0081539_10010836 3300005985 Bacteria 7329
132 Ga0081539_10015454 3300005985 Bacteria 5546
133 Ga0081539_10059272 3300005985 Bacteria 2108
134 Ga0070717_10006633 3300006028 Bacteria 8529
135 Ga0070717_10072573 3300006028 Bacteria 2874
136 Ga0070717_10883978 3300006028 Bacteria 813
137 Ga0075365_10634805 3300006038 Bacteria 755
138 Ga0075365_10738758 3300006038 Bacteria 695
139 Ga0075363_100122194 3300006048 Bacteria 1455
140 Ga0075363_100243697 3300006048 Bacteria 1034
141 Ga0075364_10225732 3300006051 Bacteria 1272
142 Ga0075364_10325955 3300006051 Bacteria 1046
143 Ga0070712_100032888 3300006175 Bacteria 3505
144 Ga0070712_100541713 3300006175 Bacteria 980
145 Ga0075367_10771950 3300006178 Bacteria 612
146 Ga0075367_10804428 3300006178 Bacteria 599
147 Ga0097621_100907257 3300006237 Bacteria 821
148 Ga0075428_100003452 3300006844 Bacteria 17294
149 Ga0075428_100039617 3300006844 Bacteria 5186
150 Ga0075428_100206564 3300006844 Bacteria 2122
151 Ga0075428_100210261 3300006844 Bacteria 2102
152 Ga0075428_100316697 3300006844 Bacteria 1676
153 Ga0075428_101195055 3300006844 Bacteria 802
154 Ga0075430_100005704 3300006846 Bacteria 10503
155 Ga0075430_100027132 3300006846 Bacteria 4868
156 Ga0075430_100087923 3300006846 Bacteria 2600
157 Ga0075431_100010602 3300006847 Bacteria 9268
158 Ga0075431_100023043 3300006847 Bacteria 6365
159 Ga0075431_100093709 3300006847 Bacteria 3099
160 Ga0075431_100129629 3300006847 Bacteria 2602
161 Ga0075433_10352888 3300006852 Unclassified 1300
162 Ga0075433_10362317 3300006852 Bacteria 1281
163 Ga0075434_100015206 3300006871 Bacteria 7373
164 Ga0075434_100111980 3300006871 Bacteria 2740
165 Ga0075434_100120629 3300006871 Bacteria 2637
166 Ga0075429_100006996 3300006880 Bacteria 9803
167 Ga0075429_100028107 3300006880 Bacteria 4882
168 Ga0075429_100059479 3300006880 Bacteria 3328
169 Ga0068865_100097829 3300006881 Bacteria 2143
170 Ga0075436_100079954 3300006914 Bacteria 2265
171 Ga0075435_100062118 3300007076 Bacteria 3031
172 Ga0105251_10403779 3300009011 Bacteria 628
173 Ga0105240_10029508 3300009093 Bacteria 7145
174 Ga0105240_10128741 3300009093 Bacteria 3039
175 Ga0111539_10023517 3300009094 Bacteria 7571
176 Ga0111539_10167702 3300009094 Bacteria 2566
177 Ga0111539_10252768 3300009094 Bacteria 2052
178 Ga0111539_10859412 3300009094 Bacteria 1055
179 Ga0111539_10925253 3300009094 Bacteria 1014
180 Ga0111539_10953713 3300009094 Bacteria 997
181 Ga0105245_10016315 3300009098 Bacteria 6477
182 Ga0105245_10318459 3300009098 Bacteria 1531
183 Ga0105245_11114769 3300009098 Bacteria 836
184 Ga0105245_11583854 3300009098 Unclassified 707
185 Ga0105247_10850032 3300009101 Bacteria 700
186 Ga0114129_10003288 3300009147 Bacteria 22696
187 Ga0114129_10009532 3300009147 Bacteria 13852
188 Ga0114129_10098645 3300009147 Bacteria 4043
189 Ga0114129_10142678 3300009147 Bacteria 3282
190 Ga0114129_10335741 3300009147 Bacteria 2006
191 Ga0114129_10505142 3300009147 Bacteria 1578
192 Ga0114129_10527730 3300009147 Bacteria 1538
193 Ga0114129_10948439 3300009147 Bacteria 1087
194 Ga0114129_11755985 3300009147 Bacteria 756
195 Ga0105243_10050797 3300009148 Bacteria 3277
196 Ga0105243_10083041 3300009148 Bacteria 2620
197 Ga0105243_10822604 3300009148 Bacteria 917
198 Ga0105242_10739586 3300009176 Bacteria 967
199 Ga0105242_10981916 3300009176 Bacteria 851
200 Ga0105248_10314080 3300009177 Bacteria 1765
201 Ga0105237_10206985 3300009545 Bacteria 1962
202 Ga0105237_11399986 3300009545 Bacteria 706
203 Ga0105237_11593447 3300009545 Bacteria 660
204 Ga0105238_10008518 3300009551 Bacteria 10263
205 Ga0105238_10251930 3300009551 Bacteria 1744
206 Ga0105238_11736943 3300009551 Bacteria 655
207 Ga0105249_10078438 3300009553 Bacteria 3065
208 Ga0105249_10100559 3300009553 Bacteria 2719
209 Ga0105249_10649195 3300009553 Bacteria 1113
210 Ga0105239_10012239 3300010375 Bacteria 9558
211 Ga0105239_10360157 3300010375 Bacteria 1643
212 Ga0105246_10561185 3300011119 Bacteria 980
213 Ga0157344_1013122 3300012476 Bacteria 631
214 Ga0157323_1030659 3300012495 Bacteria 569
215 Ga0157342_1069332 3300012507 Bacteria 533
216 Ga0157371_10123547 3300013102 Bacteria 1841
217 Ga0157370_10008497 3300013104 Bacteria 11074
218 Ga0157369_10011453 3300013105 Bacteria 10070
219 Ga0157369_10406882 3300013105 Bacteria 1411
220 Ga0157369_11012531 3300013105 Bacteria 850
221 Ga0157369_11605316 3300013105 Bacteria 661
222 Ga0157374_10092227 3300013296 Bacteria 2890
223 Ga0157378_10196559 3300013297 Bacteria 1905
224 Ga0163162_10757406 3300013306 Bacteria 1090
225 Ga0157372_10035038 3300013307 Bacteria 5523
226 Ga0157372_10037334 3300013307 Bacteria 5358
227 Ga0157372_10515983 3300013307 Bacteria 1393
228 Ga0157372_10731769 3300013307 Bacteria 1150
229 Ga0157372_10793855 3300013307 Bacteria 1100
230 Ga0157372_11156924 3300013307 Bacteria 894
231 Ga0157372_11734689 3300013307 Bacteria 718
232 Ga0157372_12903255 3300013307 Bacteria 549
233 Ga0157375_10053153 3300013308 Bacteria 3984
234 Ga0157375_11496175 3300013308 Bacteria 797
235 Ga0157375_12131912 3300013308 Bacteria 667
236 Ga0163163_10030001 3300014325 Bacteria 5235
237 Ga0157380_10151440 3300014326 Bacteria 2006
238 Ga0157380_10481400 3300014326 Bacteria 1200
239 Ga0157380_10689670 3300014326 Bacteria 1025
240 Ga0157380_10702114 3300014326 Bacteria 1017
241 Ga0157380_11669799 3300014326 Bacteria 694
242 Ga0157377_10005303 3300014745 Bacteria 6045
243 Ga0157376_10278778 3300014969 Bacteria 1574
244 Ga0163161_10467764 3300017792 Bacteria 1022
245 Ga0163161_11739205 3300017792 Bacteria 553
246 Ga0163161_11740863 3300017792 Bacteria 553
247 Ga0206356_11804550 3300020070 Bacteria 1857
248 Ga0206354_10273292 3300020081 Bacteria 667
249 Ga0206354_10279687 3300020081 Bacteria 2091
250 Ga0206353_10724033 3300020082 Bacteria 9929
251 Ga0206353_11283328 3300020082 Bacteria 1926
252 Ga0206353_11909835 3300020082 Bacteria 1062
253 Ga0207642_10534273 3300025899 Bacteria 722
254 Ga0207710_10438505 3300025900 Bacteria 673
255 Ga0207680_11197342 3300025903 Bacteria 542
256 Ga0207645_10824355 3300025907 Bacteria 631
257 Ga0207705_10303599 3300025909 Bacteria 1225
258 Ga0207705_10380074 3300025909 Bacteria 1091
259 Ga0207705_10566413 3300025909 Bacteria 883
260 Ga0207707_10003941 3300025912 Bacteria 13182
261 Ga0207695_10029397 3300025913 Bacteria 6074
262 Ga0207695_10947614 3300025913 Bacteria 740
263 Ga0207671_11118888 3300025914 Bacteria 618
264 Ga0207671_11196841 3300025914 Bacteria 594
265 Ga0207693_10011266 3300025915 Bacteria 7238
266 Ga0207663_10911867 3300025916 Bacteria 703
267 Ga0207660_10054829 3300025917 Bacteria 2846
268 Ga0207660_10694483 3300025917 Bacteria 830
269 Ga0207660_10979628 3300025917 Bacteria 690
270 Ga0207662_10076199 3300025918 Bacteria 2038
271 Ga0207662_10107747 3300025918 Bacteria 1734
272 Ga0207662_10452211 3300025918 Unclassified 878
273 Ga0207657_10018085 3300025919 Bacteria 6744
274 Ga0207657_10058527 3300025919 Bacteria 3315
275 Ga0207657_10384021 3300025919 Bacteria 1106
276 Ga0207657_10849175 3300025919 Bacteria 704
277 Ga0207652_10005827 3300025921 Bacteria 9992
278 Ga0207652_10133794 3300025921 Bacteria 2213
279 Ga0207652_10182652 3300025921 Bacteria 1885
280 Ga0207646_11385375 3300025922 Bacteria 612
281 Ga0207681_10187564 3300025923 Bacteria 1580
282 Ga0207694_10197055 3300025924 Bacteria 1638
283 Ga0207659_11066605 3300025926 Bacteria 695
284 Ga0207687_10609898 3300025927 Bacteria 920
285 Ga0207700_10278771 3300025928 Bacteria 1437
286 Ga0207664_10222767 3300025929 Bacteria 1637
287 Ga0207690_10036988 3300025932 Bacteria 3166
288 Ga0207690_10283954 3300025932 Bacteria 1290
289 Ga0207690_10799042 3300025932 Bacteria 780
290 Ga0207690_11620282 3300025932 Bacteria 541
291 Ga0207706_10733765 3300025933 Bacteria 842
292 Ga0207686_10723363 3300025934 Bacteria 793
293 Ga0207709_10485400 3300025935 Bacteria 961
294 Ga0207711_10029288 3300025941 Bacteria 4642
295 Ga0207689_10016960 3300025942 Bacteria 6162
296 Ga0207661_10035411 3300025944 Bacteria 3890
297 Ga0207661_10068848 3300025944 Bacteria 2883
298 Ga0207661_10079920 3300025944 Bacteria 2696
299 Ga0207661_11813030 3300025944 Bacteria 556
300 Ga0207679_10056058 3300025945 Bacteria 2908
301 Ga0207679_10152172 3300025945 Bacteria 1884
302 Ga0207679_10270492 3300025945 Bacteria 1453
303 Ga0207651_10038604 3300025960 Bacteria 3141
304 Ga0207668_10051212 3300025972 Bacteria 2851
305 Ga0207668_10675621 3300025972 Bacteria 906
306 Ga0207668_10939653 3300025972 Bacteria 771
307 Ga0207668_11246593 3300025972 Bacteria 669
308 Ga0207668_11347172 3300025972 Bacteria 643
309 Ga0207640_10040890 3300025981 Bacteria 2945
310 Ga0207640_11006590 3300025981 Bacteria 733
311 Ga0207640_11278940 3300025981 Bacteria 654
312 Ga0207640_11378166 3300025981 Bacteria 631
313 Ga0207677_10026989 3300026023 Bacteria 3609
314 Ga0207677_10045739 3300026023 Bacteria 2925
315 Ga0207703_11094714 3300026035 Bacteria 765
316 Ga0207639_10051735 3300026041 Bacteria 3126
317 Ga0207639_11672421 3300026041 Bacteria 597
318 Ga0207678_10049925 3300026067 Bacteria 3615
319 Ga0207678_10172451 3300026067 Bacteria 1847
320 Ga0207678_10744127 3300026067 Bacteria 864
321 Ga0207708_10001856 3300026075 Bacteria 15567
322 Ga0207702_10007262 3300026078 Bacteria 9474
323 Ga0207702_10046566 3300026078 Bacteria 3651
324 Ga0207702_10089985 3300026078 Unclassified 2685
325 Ga0207702_10121401 3300026078 Bacteria 2339
326 Ga0207702_10228258 3300026078 Bacteria 1738
327 Ga0207702_10375373 3300026078 Bacteria 1366
328 Ga0207702_11383451 3300026078 Bacteria 698
329 Ga0207648_10845287 3300026089 Bacteria 853
330 Ga0207648_11113979 3300026089 Bacteria 740
331 Ga0207648_11850467 3300026089 Bacteria 565
332 Ga0207676_10167624 3300026095 Bacteria 1910
333 Ga0207674_10088851 3300026116 Bacteria 3083
334 Ga0207674_10106903 3300026116 Bacteria 2775
335 Ga0207675_100126783 3300026118 Bacteria 2418
336 Ga0207675_102008710 3300026118 Bacteria 596
337 Ga0207683_10198612 3300026121 Bacteria 1822
338 Ga0207683_10268025 3300026121 Bacteria 1560
339 Ga0207698_10435644 3300026142 Bacteria 1262
340 Ga0207698_11046023 3300026142 Bacteria 828
341 Ga0207428_10254944 3300027907 Bacteria 1307
342 Ga0268266_10088815 3300028379 Bacteria 2705
343 Ga0268266_10389292 3300028379 Bacteria 1316
344 Ga0268265_10537944 3300028380 Bacteria 1107
345 Ga0268264_10186472 3300028381 Bacteria 1888
346 Ga0268264_11004415 3300028381 Bacteria 841
347 Ga0268264_11576391 3300028381 Bacteria 667
348 Ga0265327_10256955 3300031251 Bacteria 777
349 Ga0307408_100135615 3300031548 Bacteria 1926
350 Ga0307408_100362629 3300031548 Bacteria 1233
351 Ga0307405_10025576 3300031731 Bacteria 3391
352 Ga0307405_10293928 3300031731 Bacteria 1229
353 Ga0307413_10434594 3300031824 Bacteria 1037
354 Ga0307410_10045448 3300031852 Bacteria 2924
355 Ga0307410_10047243 3300031852 Bacteria 2876
356 Ga0307410_10648397 3300031852 Bacteria 885
357 Ga0307406_10399519 3300031901 Bacteria 1089
358 Ga0307407_10042379 3300031903 Bacteria 2552
359 Ga0307407_11426498 3300031903 Bacteria 546
360 Ga0307412_10294594 3300031911 Bacteria 1280
361 Ga0307412_11528935 3300031911 Unclassified 607
362 Ga0307412_12172956 3300031911 Bacteria 516
363 Ga0307409_100007519 3300031995 Bacteria 6527
364 Ga0307409_100414305 3300031995 Bacteria 1291
365 Ga0307409_100704317 3300031995 Bacteria 1009
366 Ga0307409_101466064 3300031995 Bacteria 709
367 Ga0307409_101487470 3300031995 Bacteria 704
368 Ga0307416_100071371 3300032002 Bacteria 2885
369 Ga0307416_100496939 3300032002 Bacteria 1283
370 Ga0307416_101044150 3300032002 Bacteria 921
371 Ga0307416_101078959 3300032002 Bacteria 907
372 Ga0307416_101584690 3300032002 Bacteria 760
373 Ga0307416_101939617 3300032002 Bacteria 692
374 Ga0307414_10205658 3300032004 Bacteria 1605
375 Ga0307411_11523967 3300032005 Bacteria 615
376 Ga0307415_100061484 3300032126 Bacteria 2600
377 Ga0307415_100120822 3300032126 Bacteria 1964
378 Ga0307415_100230592 3300032126 Bacteria 1491
379 Ga0307415_100516393 3300032126 Bacteria 1047
380 Ga0316574_0075593 3300035398 Bacteria 2133
381 Ga0316574_0116249 3300035398 Bacteria 1716
382 Ga0316582_0060041 3300036647 Bacteria 2437
383 Ga0316584_0053521 3300036712 Bacteria 3021
384 Ga0316584_0246799 3300036712 Bacteria 1305
385 Ga0395898_0104149 3300037466 Bacteria 2722
386 Ga0395898_0326363 3300037466 Bacteria 1464
387 Ga0395898_0457173 3300037466 Bacteria 1216
388 Ga0395898_0573255 3300037466 Bacteria 1071
389 Ga0395898_1483961 3300037466 Bacteria 604
390 Ga0395905_0227198 3300037471 Bacteria 1746
391 Ga0395905_1868159 3300037471 Bacteria 507
392 Ga0395901_0087112 3300038443 Bacteria 3265
393 Ga0395901_0307306 3300038443 Bacteria 1643
394 Ga0395901_0328271 3300038443 Bacteria 1582
395 Ga0395901_0845443 3300038443 Bacteria 901
396 Ga0395901_0935786 3300038443 Bacteria 846
397 Ga0395901_1310014 3300038443 Bacteria 686
398 Ga0436365_1001997 3300039437 Bacteria 586
399 Ga0451833_0387014 3300041491 Bacteria 514
400 Ga0451847_0807953 3300041503 Bacteria 666
401 Ga0451853_2801483 3300041512 Bacteria 1236
402 Ga0439444_0142874 3300042437 Bacteria 573
403 Ga0439459_0176778 3300042438 Bacteria 571
404 Ga0466972_0223047 3300044658 Bacteria 882
405 Ga0466965_0155278 3300044683 Bacteria 1198
406 Ga0466963_0114624 3300044694 Bacteria 1852
407 Ga0466963_0723344 3300044694 Bacteria 702
408 Ga0466970_0308518 3300044765 Bacteria 893
409 Ga0466957_0071353 3300044842 Bacteria 2148
410 Ga0466960_0028941 3300044901 Bacteria 2539
411 Ga0466960_0168462 3300044901 Bacteria 1181
412 Ga0466967_0287837 3300045976 Bacteria 1578
413 Ga0466967_0301158 3300045976 Bacteria 1542
414 Ga0466967_1115268 3300045976 Unclassified 786
415 Ga0466967_1280837 3300045976 Bacteria 730
416 Ga0495641_0018791 3300046461 Bacteria 3557
417 Ga0495605_0113680 3300046474 Bacteria 1233
418 Ga0495584_0030716 3300046491 Bacteria 2721
419 Ga0495584_0271384 3300046491 Bacteria 862
420 Ga0495585_0213455 3300046492 Bacteria 977
421 Ga0495596_0415848 3300046500 Bacteria 524
422 Ga0495628_0233366 3300046516 Bacteria 1378
423 Ga0495643_0156437 3300046522 Bacteria 1125
424 Ga0495643_0477476 3300046522 Bacteria 539
425 Ga0495663_0154533 3300046525 Bacteria 785
426 Ga0495666_0318849 3300046526 Bacteria 702
427 Ga0495654_0312525 3300046530 Bacteria 639
428 Ga0495587_0036035 3300046536 Bacteria 2978
429 Ga0495597_0094774 3300046542 Bacteria 1264
430 Ga0495668_0330500 3300046616 Bacteria 836
431 Ga0495668_0840931 3300046616 Bacteria 509
432 Ga0495659_0391069 3300046664 Bacteria 599
433 Ga0495661_0410739 3300046665 Bacteria 657
434 Ga0495588_0202401 3300046674 Bacteria 1049
435 Ga0495646_0362200 3300046680 Bacteria 758
436 Ga0495658_0086242 3300046683 Bacteria 1852
437 Ga0495589_0050669 3300046794 Bacteria 2053
438 Ga0495604_0000057 3300047317 Bacteria 98770
439 Ga0495604_0729081 3300047317 Bacteria 628
440 Ga0495679_103062 3300047446 Bacteria 791
441 Ga0495685_207238 3300047447 Bacteria 628
442 Ga0495684_0384339 3300047471 Bacteria 989
443 Ga0496100_0001820 3300048903 Bacteria 10658
444 Ga0496100_0099331 3300048903 Bacteria 2003
445 Ga0496100_0125902 3300048903 Bacteria 1798
446 Ga0496100_0409378 3300048903 Bacteria 1034
447 Ga0496101_0080507 3300048904 Bacteria 2406
448 Ga0496101_0127526 3300048904 Bacteria 1929
449 Ga0496101_0220930 3300048904 Bacteria 1470
450 Ga0496101_0249756 3300048904 Bacteria 1382
451 Ga0496101_0603414 3300048904 Bacteria 868
452 Ga0496101_0690387 3300048904 Bacteria 806
453 Ga0496101_1535629 3300048904 Bacteria 518
454 Ga0496102_0020424 3300048905 Bacteria 5853
455 Ga0496102_0091798 3300048905 Bacteria 2811
456 Ga0496102_0094421 3300048905 Bacteria 2771
457 Ga0496102_0314339 3300048905 Bacteria 1476
458 Ga0496102_0435365 3300048905 Bacteria 1231
459 Ga0496102_1625515 3300048905 Bacteria 564
460 Ga0496103_0187894 3300048906 Bacteria 1328
461 Ga0496103_0553153 3300048906 Bacteria 734
462 Ga0496104_0003622 3300048907 Bacteria 13344
463 Ga0496104_0025736 3300048907 Bacteria 5426
464 Ga0496104_0265924 3300048907 Bacteria 1627
465 Ga0496104_0376600 3300048907 Bacteria 1332
466 Ga0496105_0067836 3300048908 Bacteria 2945
467 Ga0496105_0072661 3300048908 Bacteria 2842
468 Ga0496106_0009540 3300048909 Bacteria 7170
469 Ga0496106_0029003 3300048909 Bacteria 4123
470 Ga0496106_0646199 3300048909 Bacteria 845
471 Ga0496107_0005455 3300048910 Bacteria 8704
472 Ga0496107_0018732 3300048910 Bacteria 4878
473 Ga0496107_0023819 3300048910 Bacteria 4327
474 Ga0496107_0140048 3300048910 Bacteria 1788
475 Ga0496107_0502896 3300048910 Bacteria 899
476 Ga0496108_0000407 3300048911 Bacteria 35282
477 Ga0496108_0040624 3300048911 Bacteria 3879
478 Ga0496108_0065853 3300048911 Bacteria 3054
479 Ga0496109_0013268 3300048912 Bacteria 7137
480 Ga0496109_0016546 3300048912 Bacteria 6449
481 Ga0496109_0107687 3300048912 Bacteria 2589
482 Ga0496109_0416764 3300048912 Bacteria 1269
483 Ga0496109_0521815 3300048912 Bacteria 1121
484 Ga0496110_0000936 3300048913 Bacteria 20525
485 Ga0496110_0020514 3300048913 Bacteria 5580
486 Ga0496110_0642468 3300048913 Bacteria 961
487 Ga0496110_1254456 3300048913 Bacteria 650
488 Ga0496111_0058420 3300048914 Bacteria 2793
489 Ga0496111_1322624 3300048914 Bacteria 507
490 Ga0496112_0021021 3300048915 Bacteria 6199
491 Ga0496112_0034156 3300048915 Bacteria 4948
492 Ga0496112_0353162 3300048915 Bacteria 1412
493 Ga0496113_0003853 3300048916 Bacteria 9082
494 Ga0496113_0255475 3300048916 Bacteria 1400
495 Ga0496113_0402131 3300048916 Bacteria 1099
496 Ga0496114_0135925 3300048917 Bacteria 2126
497 Ga0496114_0184888 3300048917 Bacteria 1821
498 Ga0496114_0231617 3300048917 Bacteria 1623
499 Ga0496114_0250688 3300048917 Bacteria 1558
500 Ga0496115_0000023 3300048918 Bacteria 163267
501 Ga0496115_0009041 3300048918 Bacteria 7391
502 Ga0496115_0197145 3300048918 Bacteria 1664
503 Ga0496115_0558281 3300048918 Bacteria 914
504 Ga0496115_0897909 3300048918 Bacteria 683
505 Ga0501031_0110954 3300049568 Bacteria 1791
506 Ga0501031_0655882 3300049568 Bacteria 674
507 Ga0501032_1003982 3300049569 Bacteria 524
508 Ga0501033_0009920 3300049570 Bacteria 7312
509 Ga0501033_0762137 3300049570 Bacteria 656
510 Ga0501033_0904512 3300049570 Bacteria 593
511 Ga0501034_0229654 3300049571 Bacteria 1805
512 Ga0501036_0068343 3300049572 Bacteria 3007
513 Ga0501036_0167580 3300049572 Bacteria 1851
514 Ga0501036_0651903 3300049572 Bacteria 871
515 Ga0501037_0065949 3300049573 Bacteria 2637
516 Ga0501037_0446980 3300049573 Bacteria 882
517 Ga0501038_0055667 3300049574 Bacteria 3397
518 Ga0501038_0267115 3300049574 Bacteria 1350
519 Ga0501039_0072241 3300049575 Bacteria 2681
520 Ga0501039_0107166 3300049575 Bacteria 2183
521 Ga0501039_0182548 3300049575 Bacteria 1650
522 Ga0501040_0020812 3300049576 Bacteria 4374
523 Ga0501040_0156416 3300049576 Bacteria 1610
524 Ga0501040_0266787 3300049576 Bacteria 1222
525 Ga0501041_0281318 3300049577 Bacteria 1047
526 Ga0501041_0310569 3300049577 Bacteria 994
527 Ga0501041_0436960 3300049577 Bacteria 830
528 Ga0501042_0041308 3300049578 Bacteria 3279
529 Ga0501042_0202824 3300049578 Bacteria 1430
530 Ga0501042_0402440 3300049578 Bacteria 992
531 Ga0501042_0971413 3300049578 Bacteria 619
532 Ga0501042_1000090 3300049578 Bacteria 609
533 Ga0501043_0055352 3300049579 Bacteria 3116
534 Ga0501046_0019635 3300049580 Bacteria 5602
535 Ga0501046_0483662 3300049580 Bacteria 888
536 Ga0501048_0043609 3300049582 Bacteria 3210
537 Ga0501048_0081046 3300049582 Bacteria 2290
538 Ga0501048_0445958 3300049582 Bacteria 927
539 Ga0501067_0060054 3300049583 Bacteria 2104
540 Ga0501067_0109516 3300049583 Bacteria 1536
541 Ga0501067_0255268 3300049583 Bacteria 976
542 Ga0501068_0048435 3300049584 Bacteria 2566
543 Ga0501068_0302157 3300049584 Bacteria 1025
544 Ga0501068_0385826 3300049584 Bacteria 902
545 Ga0501068_0434137 3300049584 Bacteria 849
546 Ga0501068_0634439 3300049584 Bacteria 697
547 Ga0501069_0027529 3300049585 Bacteria 3114
548 Ga0501069_0063732 3300049585 Bacteria 2059
549 Ga0501069_0247614 3300049585 Bacteria 1039
550 Ga0501070_0035205 3300049586 Bacteria 4184
551 Ga0501070_0074840 3300049586 Bacteria 2803
552 Ga0501070_0149165 3300049586 Bacteria 1929
553 Ga0501070_1380128 3300049586 Bacteria 536
554 Ga0501071_0060962 3300049587 Bacteria 2732
555 Ga0501071_0115887 3300049587 Bacteria 1983
556 Ga0501071_0127919 3300049587 Bacteria 1886
557 Ga0501071_0332977 3300049587 Bacteria 1154
558 Ga0501071_0348734 3300049587 Bacteria 1126
559 Ga0501071_0801653 3300049587 Bacteria 726
560 Ga0501071_1406749 3300049587 Bacteria 539
561 Ga0501072_0063941 3300049588 Bacteria 2902
562 Ga0501072_0147142 3300049588 Bacteria 1878
563 Ga0501072_0158471 3300049588 Bacteria 1805
564 Ga0501073_0036767 3300049589 Bacteria 3478
565 Ga0501073_0383828 3300049589 Bacteria 970
566 Ga0501074_0024186 3300049590 Bacteria 4415
567 Ga0501074_0084049 3300049590 Bacteria 2282
568 Ga0501074_0094983 3300049590 Bacteria 2135
569 Ga0501074_0667161 3300049590 Bacteria 734
570 Ga0501075_0343921 3300049591 Bacteria 1137
571 Ga0501075_0535159 3300049591 Bacteria 894
572 Ga0501076_0273402 3300049592 Bacteria 1383
573 Ga0501076_1155654 3300049592 Bacteria 637
574 Ga0501077_0886134 3300049593 Bacteria 574
575 Ga0501255_060300 3300049684 Bacteria 601
576 Ga0501079_0024654 3300049741 Bacteria 4616
577 Ga0501079_0183302 3300049741 Bacteria 1634
578 Ga0501079_0322253 3300049741 Bacteria 1210
579 Ga0501080_0048663 3300049742 Bacteria 3945
580 Ga0501080_0123891 3300049742 Bacteria 2394
581 Ga0501081_0094449 3300049743 Bacteria 2107
582 Ga0501083_0035587 3300049744 Bacteria 3400
583 Ga0501083_0072213 3300049744 Bacteria 2294
584 Ga0501083_0558665 3300049744 Bacteria 745
585 Ga0501035_0039791 3300049822 Bacteria 4253
586 Ga0501044_0595077 3300049823 Bacteria 999
587 Ga0501045_0211640 3300049824 Bacteria 1444
588 Ga0501045_0336331 3300049824 Bacteria 1124
589 Ga0501045_0479563 3300049824 Bacteria 924
590 Ga0501045_1184657 3300049824 Bacteria 558
591 nmdc:mga03n38_243634_c1 3300050490 Bacteria 947
592 nmdc:mga03n38_546332_c1 3300050490 Bacteria 655
593 nmdc:mga0yw44_115058_c1 3300050492 Bacteria 1727
594 nmdc:mga0yw44_383186_c1 3300050492 Bacteria 949
595 nmdc:mga05p37_1079601_c1 3300050507 Bacteria 843
596 nmdc:mga05p37_1120001_c1 3300050507 Bacteria 822
597 nmdc:mga05p37_152059_c1 3300050507 Bacteria 2830
598 nmdc:mga05p37_170452_c1 3300050507 Bacteria 2654
599 nmdc:mga05p37_178956_c1 3300050507 Bacteria 2581
600 nmdc:mga05p37_2878_c1 3300050507 Bacteria 19978
601 nmdc:mga05p37_863963_c1 3300050507 Bacteria 980
602 nmdc:mga09592_1205371_c1 3300050508 Bacteria 625
603 nmdc:mga09592_86116_c1 3300050508 Bacteria 2681
604 nmdc:mga0qj67_240564_c1 3300050509 Bacteria 1468
605 nmdc:mga0qj67_50540_c1 3300050509 Bacteria 3288
606 nmdc:mga0qj67_577360_c1 3300050509 Bacteria 900
607 nmdc:mga0qj67_60593_c1 3300050509 Bacteria 3004
608 nmdc:mga06r32_104623_c1 3300050510 Bacteria 2780
609 nmdc:mga06r32_118364_c1 3300050510 Bacteria 2611
610 nmdc:mga06r32_1270098_c1 3300050510 Bacteria 681
611 nmdc:mga06r32_1635022_c1 3300050510 Bacteria 582
612 nmdc:mga06r32_199685_c1 3300050510 Bacteria 1988
613 nmdc:mga06r32_209275_c1 3300050510 Bacteria 1938
614 nmdc:mga06r32_5304_c1 3300050510 Bacteria 11603
615 nmdc:mga06r32_95035_c1 3300050510 Bacteria 2917
616 nmdc:mga08y16_1073738_c1 3300050511 Bacteria 781
617 nmdc:mga08y16_1420643_c1 3300050511 Bacteria 656
618 nmdc:mga08y16_1618280_c1 3300050511 Bacteria 605
619 nmdc:mga08y16_47110_c1 3300050511 Bacteria 4513
620 nmdc:mga0n895_103543_c1 3300050512 Bacteria 2858
621 nmdc:mga0n895_129760_c1 3300050512 Bacteria 2545
622 nmdc:mga0n895_185896_c1 3300050512 Bacteria 2109
623 nmdc:mga0n895_25172_c1 3300050512 Bacteria 5620
624 nmdc:mga0rr50_238120_c1 3300050513 Bacteria 1508
625 nmdc:mga0rr50_277538_c1 3300050513 Bacteria 1398
626 nmdc:mga0a205_1481580_c1 3300050515 Unclassified 527
627 nmdc:mga0a205_495672_c1 3300050515 Bacteria 1079
628 Ga0495601_0014828 3300053077 Bacteria 4704
629 Ga0495612_0492971 3300053078 Unclassified 562
630 Ga0495655_0293794 3300053083 Bacteria 557
631 Ga0500556_0001306 3300053104 Bacteria 11203
632 Ga0500616_0119293 3300053153 Bacteria 1262
633 Ga0501084_0246817 3300054114 Bacteria 1507
634 Ga0501084_0574185 3300054114 Bacteria 953
635 Ga0501084_0761928 3300054114 Bacteria 815
636 Ga0501084_1466413 3300054114 Bacteria 571
637 Ga0590071_059204 3300059421 Bacteria 935
638 Ga0501082_0031129 3300060353 Bacteria 4599
639 Ga0501082_0176712 3300060353 Bacteria 1856
640 Ga0501082_0432184 3300060353 Bacteria 1150
641 Ga0501082_0800139 3300060353 Bacteria 825
642 Ga0501082_1306688 3300060353 Bacteria 634
643 Ga0530510_0014145 3300061734 Bacteria 5626
644 Ga0530510_0245488 3300061734 Bacteria 1334
645 Ga0530510_0330610 3300061734 Bacteria 1143
646 Ga0530510_0954145 3300061734 Bacteria 656
647 Ga0530510_1378103 3300061734 Bacteria 541
648 nmdc:mga08y16_177917_c1
649 JGI25407J50210_10000233
650 JGI25407J50210_10008696
651 JGI25407J50210_10072377
652 JGI25407J50210_10078679
653 JGI25404J52841_10026289
654 JGI25405J52794_10056828
655 Ga0070658_10198559
656 Ga0070658_10602733
657 Ga0070683_100033929
658 Ga0070683_101644373
659 Ga0068869_100013146
660 Ga0070666_11386935
661 Ga0070680_100002551
662 Ga0070682_100007296
663 Ga0070682_100953012
664 Ga0068868_100003404
665 Ga0068868_100217665
666 Ga0068868_101228988
667 Ga0070660_100035020
668 Ga0070660_100056844
669 Ga0070660_100207267
670 Ga0070660_100424072
671 Ga0070689_100116020
672 Ga0070691_10149389
673 Ga0070691_10288032
674 Ga0070691_10500857
675 Ga0070687_100214912
676 Ga0070687_100982509
677 Ga0070661_100032307
678 Ga0070661_100108087
679 Ga0070661_100965307
680 Ga0070668_100832029
681 Ga0070668_101515956
682 Ga0070675_100042230
683 Ga0070671_100933677
684 Ga0070674_100612754
685 Ga0070674_101397108
686 Ga0070688_100655426
687 Ga0070659_100011747
688 Ga0070659_100405214
689 Ga0070659_100983742
690 Ga0070659_101740295
691 Ga0070667_100586898
692 Ga0070714_100151260
693 Ga0070714_100356850
694 Ga0070713_100048553
695 Ga0070701_10206875
696 Ga0070711_100627337
697 Ga0070700_100004105
698 Ga0070700_100241953
699 Ga0070694_100311625
700 Ga0070694_101494113
701 Ga0070663_100300381
702 Ga0070678_101075162
703 Ga0070681_10004341
704 Ga0070685_10005220
705 Ga0070685_10373109
706 Ga0070707_101055516
707 Ga0070698_100715536
708 Ga0070699_101162738
709 Ga0070679_100040324
710 Ga0070679_100082316
711 Ga0070679_100086479
712 Ga0070684_100014096
713 Ga0070684_100046482
714 Ga0070684_100233231
715 Ga0070684_101398088
716 Ga0068853_101611192
717 Ga0068853_102144177
718 Ga0070686_100877283
719 Ga0070695_100159808
720 Ga0070695_101304416
721 Ga0070696_100297604
722 Ga0070696_100793340
723 Ga0070693_100228091
724 Ga0070665_100060079
725 Ga0070665_100109022
726 Ga0070704_100093827
727 Ga0070704_101256095
728 Ga0070704_101269853
729 Ga0070664_100015448
730 Ga0070664_100576894
731 Ga0068857_101079473
732 Ga0068854_100035271
733 Ga0068854_100112094
734 Ga0068856_100051603
735 Ga0068856_100193389
736 Ga0068856_100329343
737 Ga0068856_100713769
738 Ga0068852_100091045
739 Ga0068852_101468978
740 Ga0068864_100014305
741 Ga0068866_10223747
742 Ga0068866_10486314
743 Ga0068861_100086614
744 Ga0068861_101251004
745 Ga0068861_101759740
746 Ga0068851_10319106
747 Ga0068858_100547674
748 Ga0068858_102242074
749 Ga0068862_100665057
750 Ga0081455_10013066
751 Ga0081455_10107938
752 Ga0081455_10172814
753 Ga0081455_10207736
754 Ga0081455_10309044
755 Ga0081455_10351431
756 Ga0081455_10436305
757 Ga0081455_10716306
758 Ga0081538_10000009
759 Ga0081538_10000010
760 Ga0081538_10000228
761 Ga0081538_10000360
762 Ga0081538_10000752
763 Ga0081538_10000910
764 Ga0081538_10001757
765 Ga0081538_10002867
766 Ga0081538_10012620
767 Ga0081538_10019366
768 Ga0081538_10020023
769 Ga0081538_10026473
770 Ga0081538_10030168
771 Ga0081538_10035837
772 Ga0081538_10097576
773 Ga0081538_10198868
774 Ga0081540_1001048
775 Ga0081540_1001533
776 Ga0081540_1017907
777 Ga0081540_1058329
778 Ga0081539_10010836
779 Ga0081539_10015454
780 Ga0081539_10059272
781 Ga0070717_10006633
782 Ga0070717_10072573
783 Ga0070717_10883978
784 Ga0075365_10634805
785 Ga0075365_10738758
786 Ga0075363_100122194
787 Ga0075363_100243697
788 Ga0075364_10225732
789 Ga0075364_10325955
790 Ga0070712_100032888
791 Ga0070712_100541713
792 Ga0075367_10771950
793 Ga0075367_10804428
794 Ga0097621_100907257
795 Ga0075428_100003452
796 Ga0075428_100039617
797 Ga0075428_100206564
798 Ga0075428_100210261
799 Ga0075428_100316697
800 Ga0075428_101195055
801 Ga0075430_100005704
802 Ga0075430_100027132
803 Ga0075430_100087923
804 Ga0075431_100010602
805 Ga0075431_100023043
806 Ga0075431_100093709
807 Ga0075431_100129629
808 Ga0075433_10352888
809 Ga0075433_10362317
810 Ga0075434_100015206
811 Ga0075434_100111980
812 Ga0075434_100120629
813 Ga0075429_100006996
814 Ga0075429_100028107
815 Ga0075429_100059479
816 Ga0068865_100097829
817 Ga0075436_100079954
818 Ga0075435_100062118
819 Ga0105251_10403779
820 Ga0105240_10029508
821 Ga0105240_10128741
822 Ga0111539_10023517
823 Ga0111539_10167702
824 Ga0111539_10252768
825 Ga0111539_10859412
826 Ga0111539_10925253
827 Ga0111539_10953713
828 Ga0105245_10016315
829 Ga0105245_10318459
830 Ga0105245_11114769
831 Ga0105245_11583854
832 Ga0105247_10850032
833 Ga0114129_10003288
834 Ga0114129_10009532
835 Ga0114129_10098645
836 Ga0114129_10142678
837 Ga0114129_10335741
838 Ga0114129_10505142
839 Ga0114129_10527730
840 Ga0114129_10948439
841 Ga0114129_11755985
842 Ga0105243_10050797
843 Ga0105243_10083041
844 Ga0105243_10822604
845 Ga0105242_10739586
846 Ga0105242_10981916
847 Ga0105248_10314080
848 Ga0105237_10206985
849 Ga0105237_11399986
850 Ga0105237_11593447
851 Ga0105238_10008518
852 Ga0105238_10251930
853 Ga0105238_11736943
854 Ga0105249_10078438
855 Ga0105249_10100559
856 Ga0105249_10649195
857 Ga0105239_10012239
858 Ga0105239_10360157
859 Ga0105246_10561185
860 Ga0157344_1013122
861 Ga0157323_1030659
862 Ga0157342_1069332
863 Ga0157371_10123547
864 Ga0157370_10008497
865 Ga0157369_10011453
866 Ga0157369_10406882
867 Ga0157369_11012531
868 Ga0157369_11605316
869 Ga0157374_10092227
870 Ga0157378_10196559
871 Ga0163162_10757406
872 Ga0157372_10035038
873 Ga0157372_10037334
874 Ga0157372_10515983
875 Ga0157372_10731769
876 Ga0157372_10793855
877 Ga0157372_11156924
878 Ga0157372_11734689
879 Ga0157372_12903255
880 Ga0157375_10053153
881 Ga0157375_11496175
882 Ga0157375_12131912
883 Ga0163163_10030001
884 Ga0157380_10151440
885 Ga0157380_10481400
886 Ga0157380_10689670
887 Ga0157380_10702114
888 Ga0157380_11669799
889 Ga0157377_10005303
890 Ga0157376_10278778
891 Ga0163161_10467764
892 Ga0163161_11739205
893 Ga0163161_11740863
894 Ga0206356_11804550
895 Ga0206354_10273292
896 Ga0206354_10279687
897 Ga0206353_10724033
898 Ga0206353_11283328
899 Ga0206353_11909835
900 Ga0207642_10534273
901 Ga0207710_10438505
902 Ga0207680_11197342
903 Ga0207645_10824355
904 Ga0207705_10303599
905 Ga0207705_10380074
906 Ga0207705_10566413
907 Ga0207707_10003941
908 Ga0207695_10029397
909 Ga0207695_10947614
910 Ga0207671_11118888
911 Ga0207671_11196841
912 Ga0207693_10011266
913 Ga0207663_10911867
914 Ga0207660_10054829
915 Ga0207660_10694483
916 Ga0207660_10979628
917 Ga0207662_10076199
918 Ga0207662_10107747
919 Ga0207662_10452211
920 Ga0207657_10018085
921 Ga0207657_10058527
922 Ga0207657_10384021
923 Ga0207657_10849175
924 Ga0207652_10005827
925 Ga0207652_10133794
926 Ga0207652_10182652
927 Ga0207646_11385375
928 Ga0207681_10187564
929 Ga0207694_10197055
930 Ga0207659_11066605
931 Ga0207687_10609898
932 Ga0207700_10278771
933 Ga0207664_10222767
934 Ga0207690_10036988
935 Ga0207690_10283954
936 Ga0207690_10799042
937 Ga0207690_11620282
938 Ga0207706_10733765
939 Ga0207686_10723363
940 Ga0207709_10485400
941 Ga0207711_10029288
942 Ga0207689_10016960
943 Ga0207661_10035411
944 Ga0207661_10068848
945 Ga0207661_10079920
946 Ga0207661_11813030
947 Ga0207679_10056058
948 Ga0207679_10152172
949 Ga0207679_10270492
950 Ga0207651_10038604
951 Ga0207668_10051212
952 Ga0207668_10675621
953 Ga0207668_10939653
954 Ga0207668_11246593
955 Ga0207668_11347172
956 Ga0207640_10040890
957 Ga0207640_11006590
958 Ga0207640_11278940
959 Ga0207640_11378166
960 Ga0207677_10026989
961 Ga0207677_10045739
962 Ga0207703_11094714
963 Ga0207639_10051735
964 Ga0207639_11672421
965 Ga0207678_10049925
966 Ga0207678_10172451
967 Ga0207678_10744127
968 Ga0207708_10001856
969 Ga0207702_10007262
970 Ga0207702_10046566
971 Ga0207702_10089985
972 Ga0207702_10121401
973 Ga0207702_10228258
974 Ga0207702_10375373
975 Ga0207702_11383451
976 Ga0207648_10845287
977 Ga0207648_11113979
978 Ga0207648_11850467
979 Ga0207676_10167624
980 Ga0207674_10088851
981 Ga0207674_10106903
982 Ga0207675_100126783
983 Ga0207675_102008710
984 Ga0207683_10198612
985 Ga0207683_10268025
986 Ga0207698_10435644
987 Ga0207698_11046023
988 Ga0207428_10254944
989 Ga0268266_10088815
990 Ga0268266_10389292
991 Ga0268265_10537944
992 Ga0268264_10186472
993 Ga0268264_11004415
994 Ga0268264_11576391
995 Ga0265327_10256955
996 Ga0307408_100135615
997 Ga0307408_100362629
998 Ga0307405_10025576
999 Ga0307405_10293928
1000 Ga0307413_10434594
1001 Ga0307410_10045448
1002 Ga0307410_10047243
1003 Ga0307410_10648397
1004 Ga0307406_10399519
1005 Ga0307407_10042379
1006 Ga0307407_11426498
1007 Ga0307412_10294594
1008 Ga0307412_11528935
1009 Ga0307412_12172956
1010 Ga0307409_100007519
1011 Ga0307409_100414305
1012 Ga0307409_100704317
1013 Ga0307409_101466064
1014 Ga0307409_101487470
1015 Ga0307416_100071371
1016 Ga0307416_100496939
1017 Ga0307416_101044150
1018 Ga0307416_101078959
1019 Ga0307416_101584690
1020 Ga0307416_101939617
1021 Ga0307414_10205658
1022 Ga0307411_11523967
1023 Ga0307415_100061484
1024 Ga0307415_100120822
1025 Ga0307415_100230592
1026 Ga0307415_100516393
1027 Ga0316574_0075593
1028 Ga0316574_0116249
1029 Ga0316582_0060041
1030 Ga0316584_0053521
1031 Ga0316584_0246799
1032 Ga0395898_0104149
1033 Ga0395898_0326363
1034 Ga0395898_0457173
1035 Ga0395898_0573255
1036 Ga0395898_1483961
1037 Ga0395905_0227198
1038 Ga0395905_1868159
1039 Ga0395901_0087112
1040 Ga0395901_0307306
1041 Ga0395901_0328271
1042 Ga0395901_0845443
1043 Ga0395901_0935786
1044 Ga0395901_1310014
1045 Ga0436365_1001997
1046 Ga0451833_0387014
1047 Ga0451847_0807953
1048 Ga0451853_2801483
1049 Ga0439444_0142874
1050 Ga0439459_0176778
1051 Ga0466972_0223047
1052 Ga0466965_0155278
1053 Ga0466963_0114624
1054 Ga0466963_0723344
1055 Ga0466970_0308518
1056 Ga0466957_0071353
1057 Ga0466960_0028941
1058 Ga0466960_0168462
1059 Ga0466967_0287837
1060 Ga0466967_0301158
1061 Ga0466967_1115268
1062 Ga0466967_1280837
1063 Ga0495641_0018791
1064 Ga0495605_0113680
1065 Ga0495584_0030716
1066 Ga0495584_0271384
1067 Ga0495585_0213455
1068 Ga0495596_0415848
1069 Ga0495628_0233366
1070 Ga0495643_0156437
1071 Ga0495643_0477476
1072 Ga0495663_0154533
1073 Ga0495666_0318849
1074 Ga0495654_0312525
1075 Ga0495587_0036035
1076 Ga0495597_0094774
1077 Ga0495668_0330500
1078 Ga0495668_0840931
1079 Ga0495659_0391069
1080 Ga0495661_0410739
1081 Ga0495588_0202401
1082 Ga0495646_0362200
1083 Ga0495658_0086242
1084 Ga0495589_0050669
1085 Ga0495604_0000057
1086 Ga0495604_0729081
1087 Ga0495679_103062
1088 Ga0495685_207238
1089 Ga0495684_0384339
1090 Ga0496100_0001820
1091 Ga0496100_0099331
1092 Ga0496100_0125902
1093 Ga0496100_0409378
1094 Ga0496101_0080507
1095 Ga0496101_0127526
1096 Ga0496101_0220930
1097 Ga0496101_0249756
1098 Ga0496101_0603414
1099 Ga0496101_0690387
1100 Ga0496101_1535629
1101 Ga0496102_0020424
1102 Ga0496102_0091798
1103 Ga0496102_0094421
1104 Ga0496102_0314339
1105 Ga0496102_0435365
1106 Ga0496102_1625515
1107 Ga0496103_0187894
1108 Ga0496103_0553153
1109 Ga0496104_0003622
1110 Ga0496104_0025736
1111 Ga0496104_0265924
1112 Ga0496104_0376600
1113 Ga0496105_0067836
1114 Ga0496105_0072661
1115 Ga0496106_0009540
1116 Ga0496106_0029003
1117 Ga0496106_0646199
1118 Ga0496107_0005455
1119 Ga0496107_0018732
1120 Ga0496107_0023819
1121 Ga0496107_0140048
1122 Ga0496107_0502896
1123 Ga0496108_0000407
1124 Ga0496108_0040624
1125 Ga0496108_0065853
1126 Ga0496109_0013268
1127 Ga0496109_0016546
1128 Ga0496109_0107687
1129 Ga0496109_0416764
1130 Ga0496109_0521815
1131 Ga0496110_0000936
1132 Ga0496110_0020514
1133 Ga0496110_0642468
1134 Ga0496110_1254456
1135 Ga0496111_0058420
1136 Ga0496111_1322624
1137 Ga0496112_0021021
1138 Ga0496112_0034156
1139 Ga0496112_0353162
1140 Ga0496113_0003853
1141 Ga0496113_0255475
1142 Ga0496113_0402131
1143 Ga0496114_0135925
1144 Ga0496114_0184888
1145 Ga0496114_0231617
1146 Ga0496114_0250688
1147 Ga0496115_0000023
1148 Ga0496115_0009041
1149 Ga0496115_0197145
1150 Ga0496115_0558281
1151 Ga0496115_0897909
1152 Ga0501031_0110954
1153 Ga0501031_0655882
1154 Ga0501032_1003982
1155 Ga0501033_0009920
1156 Ga0501033_0762137
1157 Ga0501033_0904512
1158 Ga0501034_0229654
1159 Ga0501036_0068343
1160 Ga0501036_0167580
1161 Ga0501036_0651903
1162 Ga0501037_0065949
1163 Ga0501037_0446980
1164 Ga0501038_0055667
1165 Ga0501038_0267115
1166 Ga0501039_0072241
1167 Ga0501039_0107166
1168 Ga0501039_0182548
1169 Ga0501040_0020812
1170 Ga0501040_0156416
1171 Ga0501040_0266787
1172 Ga0501041_0281318
1173 Ga0501041_0310569
1174 Ga0501041_0436960
1175 Ga0501042_0041308
1176 Ga0501042_0202824
1177 Ga0501042_0402440
1178 Ga0501042_0971413
1179 Ga0501042_1000090
1180 Ga0501043_0055352
1181 Ga0501046_0019635
1182 Ga0501046_0483662
1183 Ga0501048_0043609
1184 Ga0501048_0081046
1185 Ga0501048_0445958
1186 Ga0501067_0060054
1187 Ga0501067_0109516
1188 Ga0501067_0255268
1189 Ga0501068_0048435
1190 Ga0501068_0302157
1191 Ga0501068_0385826
1192 Ga0501068_0434137
1193 Ga0501068_0634439
1194 Ga0501069_0027529
1195 Ga0501069_0063732
1196 Ga0501069_0247614
1197 Ga0501070_0035205
1198 Ga0501070_0074840
1199 Ga0501070_0149165
1200 Ga0501070_1380128
1201 Ga0501071_0060962
1202 Ga0501071_0115887
1203 Ga0501071_0127919
1204 Ga0501071_0332977
1205 Ga0501071_0348734
1206 Ga0501071_0801653
1207 Ga0501071_1406749
1208 Ga0501072_0063941
1209 Ga0501072_0147142
1210 Ga0501072_0158471
1211 Ga0501073_0036767
1212 Ga0501073_0383828
1213 Ga0501074_0024186
1214 Ga0501074_0084049
1215 Ga0501074_0094983
1216 Ga0501074_0667161
1217 Ga0501075_0343921
1218 Ga0501075_0535159
1219 Ga0501076_0273402
1220 Ga0501076_1155654
1221 Ga0501077_0886134
1222 Ga0501255_060300
1223 Ga0501079_0024654
1224 Ga0501079_0183302
1225 Ga0501079_0322253
1226 Ga0501080_0048663
1227 Ga0501080_0123891
1228 Ga0501081_0094449
1229 Ga0501083_0035587
1230 Ga0501083_0072213
1231 Ga0501083_0558665
1232 Ga0501035_0039791
1233 Ga0501044_0595077
1234 Ga0501045_0211640
1235 Ga0501045_0336331
1236 Ga0501045_0479563
1237 Ga0501045_1184657
1238 nmdc:mga03n38_243634_c1
1239 nmdc:mga03n38_546332_c1
1240 nmdc:mga0yw44_115058_c1
1241 nmdc:mga0yw44_383186_c1
1242 nmdc:mga05p37_1079601_c1
1243 nmdc:mga05p37_1120001_c1
1244 nmdc:mga05p37_152059_c1
1245 nmdc:mga05p37_170452_c1
1246 nmdc:mga05p37_178956_c1
1247 nmdc:mga05p37_2878_c1
1248 nmdc:mga05p37_863963_c1
1249 nmdc:mga09592_1205371_c1
1250 nmdc:mga09592_86116_c1
1251 nmdc:mga0qj67_240564_c1
1252 nmdc:mga0qj67_50540_c1
1253 nmdc:mga0qj67_577360_c1
1254 nmdc:mga0qj67_60593_c1
1255 nmdc:mga06r32_104623_c1
1256 nmdc:mga06r32_118364_c1
1257 nmdc:mga06r32_1270098_c1
1258 nmdc:mga06r32_1635022_c1
1259 nmdc:mga06r32_199685_c1
1260 nmdc:mga06r32_209275_c1
1261 nmdc:mga06r32_5304_c1
1262 nmdc:mga06r32_95035_c1
1263 nmdc:mga08y16_1073738_c1
1264 nmdc:mga08y16_1420643_c1
1265 nmdc:mga08y16_1618280_c1
1266 nmdc:mga08y16_47110_c1
1267 nmdc:mga0n895_103543_c1
1268 nmdc:mga0n895_129760_c1
1269 nmdc:mga0n895_185896_c1
1270 nmdc:mga0n895_25172_c1
1271 nmdc:mga0rr50_238120_c1
1272 nmdc:mga0rr50_277538_c1
1273 nmdc:mga0a205_1481580_c1
1274 nmdc:mga0a205_495672_c1
1275 Ga0495601_0014828
1276 Ga0495612_0492971
1277 Ga0495655_0293794
1278 Ga0500556_0001306
1279 Ga0500616_0119293
1280 Ga0501084_0246817
1281 Ga0501084_0574185
1282 Ga0501084_0761928
1283 Ga0501084_1466413
1284 Ga0590071_059204
1285 Ga0501082_0031129
1286 Ga0501082_0176712
1287 Ga0501082_0432184
1288 Ga0501082_0800139
1289 Ga0501082_1306688
1290 Ga0530510_0014145
1291 Ga0530510_0245488
1292 Ga0530510_0330610
1293 Ga0530510_0954145
1294 Ga0530510_1378103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

13

133

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.9296 1 124
4rv2-assembly1.cif.gz_B-2 crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis 0.9291 1 122
4v12-assembly1.cif.gz_A-2 crystal structure of the msmeg_6754 dehydratase from mycobacterium smegmatis 0.9189 1 124
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9118 1 123
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.9017 1 124
ID Description Score Start End Superfamily
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9111 1 123 3.10.129.10
3bbjB00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9016 73 124 2.40.160.210
af_Q9Y814_176_279_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9004 6 90 3.10.129.10
3omlA03 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8932 6 122 3.10.129.10
af_A4HT66_2_132_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8907 1 109 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2W6BRC4-F1-model_v4 MaoC-like domain-containing protein 0.9857 24 123
AF-A0A6J7HZP2-F1-model_v4 Unannotated protein 0.9778 4 125 GO:0004312
GO:0005835
GO:0006633
AF-A0A833LGD2-F1-model_v4 MaoC-like domain-containing protein 0.9742 1 124 GO:0004312
GO:0005835
GO:0006633
AF-A0A7V9CG89-F1-model_v4 MaoC-like domain-containing protein 0.9688 4 123 GO:0004312
GO:0005835
GO:0006633
AF-A0A1V5V5F0-F1-model_v4 MaoC like domain protein 0.9656 1 124 GO:0003857
GO:0004300
GO:0005777
GO:0006635
GO:0044594

Map