F472207
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 646 | 277 | 1292 | 63 |
Family's Representative Sequence
| Representative Sequence | 3300035171|Ga0373946_0117395|Ga0373946_0117395_937_1170 |
| Length | 77 |
| Sequence | LECGGLTPLFEKEASMAQRKSIDCRDYPSEKNCSLKISGTEDEVLDAAVQHAASAHGHENTPELRDQVKSMLKDDSD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 204 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 209 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 210 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 211 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 5.26 |
| Rhizosphere | 94.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 42.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373946_0117395 | 3300035171 | Viruses | 1211 |
| 2 | SwRhRL2b_contig_2073574 | 2162886007 | Bacteria | 3223 |
| 3 | 2214811066 | 2209111006 | Bacteria | 685 |
| 4 | JGI24035J26624_1001174 | 3300002126 | Bacteria | 2485 |
| 5 | JGI24034J26672_10097338 | 3300002239 | Unclassified | 551 |
| 6 | JGI25406J46586_10000044 | 3300003203 | Bacteria | 55845 |
| 7 | Ga0065714_10203058 | 3300005288 | Bacteria | 889 |
| 8 | Ga0065704_10003796 | 3300005289 | Bacteria | 3792 |
| 9 | Ga0065704_10005317 | 3300005289 | Bacteria | 2936 |
| 10 | Ga0065704_10023571 | 3300005289 | Unclassified | 1169 |
| 11 | Ga0065712_10003013 | 3300005290 | Bacteria | 4860 |
| 12 | Ga0065712_10006829 | 3300005290 | Unclassified | 3851 |
| 13 | Ga0065712_10097236 | 3300005290 | Bacteria | 2157 |
| 14 | Ga0065712_10144200 | 3300005290 | Unclassified | 1423 |
| 15 | Ga0065712_10182336 | 3300005290 | Unclassified | 1140 |
| 16 | Ga0065712_10434718 | 3300005290 | Unclassified | 700 |
| 17 | Ga0065712_10557702 | 3300005290 | Bacteria | 613 |
| 18 | Ga0065712_10698016 | 3300005290 | Unclassified | 548 |
| 19 | Ga0065715_10000511 | 3300005293 | Bacteria | 10778 |
| 20 | Ga0065715_10003784 | 3300005293 | Bacteria | 3838 |
| 21 | Ga0065715_10105598 | 3300005293 | Bacteria | 2882 |
| 22 | Ga0065715_10714144 | 3300005293 | Bacteria | 582 |
| 23 | Ga0065715_10747754 | 3300005293 | Bacteria | 613 |
| 24 | Ga0065707_10137564 | 3300005295 | Bacteria | 1818 |
| 25 | Ga0065707_11138091 | 3300005295 | Unclassified | 507 |
| 26 | Ga0070658_10303768 | 3300005327 | Unclassified | 1361 |
| 27 | Ga0070676_10465127 | 3300005328 | Unclassified | 892 |
| 28 | Ga0070676_10535356 | 3300005328 | Unclassified | 836 |
| 29 | Ga0070676_11052991 | 3300005328 | Unclassified | 613 |
| 30 | Ga0070683_100211259 | 3300005329 | Unclassified | 1843 |
| 31 | Ga0070683_101884360 | 3300005329 | Unclassified | 575 |
| 32 | Ga0070690_100027281 | 3300005330 | Bacteria | 3529 |
| 33 | Ga0070690_100046737 | 3300005330 | Unclassified | 2753 |
| 34 | Ga0070670_101177538 | 3300005331 | Unclassified | 700 |
| 35 | Ga0068869_100731059 | 3300005334 | Unclassified | 846 |
| 36 | Ga0068869_102057592 | 3300005334 | Unclassified | 513 |
| 37 | Ga0070666_10257423 | 3300005335 | Bacteria | 1237 |
| 38 | Ga0070680_100009840 | 3300005336 | Bacteria | 7359 |
| 39 | Ga0070682_100035277 | 3300005337 | Unclassified | 3053 |
| 40 | Ga0068868_100194988 | 3300005338 | Unclassified | 1686 |
| 41 | Ga0068868_100264569 | 3300005338 | Unclassified | 1451 |
| 42 | Ga0068868_101251721 | 3300005338 | Unclassified | 688 |
| 43 | Ga0070689_100146604 | 3300005340 | Bacteria | 1901 |
| 44 | Ga0070691_10747537 | 3300005341 | Unclassified | 591 |
| 45 | Ga0070687_100086116 | 3300005343 | Bacteria | 1726 |
| 46 | Ga0070687_100754150 | 3300005343 | Bacteria | 685 |
| 47 | Ga0070668_101640887 | 3300005347 | Unclassified | 590 |
| 48 | Ga0070669_100037801 | 3300005353 | Bacteria | 3502 |
| 49 | Ga0070669_100530691 | 3300005353 | Bacteria | 979 |
| 50 | Ga0070675_100202378 | 3300005354 | Unclassified | 1724 |
| 51 | Ga0070671_100284892 | 3300005355 | Bacteria | 1406 |
| 52 | Ga0070671_100559591 | 3300005355 | Bacteria | 986 |
| 53 | Ga0070671_101740815 | 3300005355 | Bacteria | 553 |
| 54 | Ga0070674_100615599 | 3300005356 | Unclassified | 919 |
| 55 | Ga0070674_101242781 | 3300005356 | Unclassified | 662 |
| 56 | Ga0070674_101458605 | 3300005356 | Unclassified | 614 |
| 57 | Ga0070673_100084819 | 3300005364 | Bacteria | 2577 |
| 58 | Ga0070673_100448323 | 3300005364 | Unclassified | 1160 |
| 59 | Ga0070673_101253074 | 3300005364 | Unclassified | 696 |
| 60 | Ga0070688_100048866 | 3300005365 | Bacteria | 2630 |
| 61 | Ga0070659_100765113 | 3300005366 | Bacteria | 838 |
| 62 | Ga0070659_101012428 | 3300005366 | Bacteria | 730 |
| 63 | Ga0070659_101017664 | 3300005366 | Unclassified | 728 |
| 64 | Ga0070667_100563658 | 3300005367 | Unclassified | 1048 |
| 65 | Ga0070709_10535041 | 3300005434 | Bacteria | 895 |
| 66 | Ga0070714_100108440 | 3300005435 | Unclassified | 2455 |
| 67 | Ga0070714_100211144 | 3300005435 | Bacteria | 1779 |
| 68 | Ga0070714_100216430 | 3300005435 | Unclassified | 1758 |
| 69 | Ga0070714_100227434 | 3300005435 | Bacteria | 1717 |
| 70 | Ga0070713_100127255 | 3300005436 | Bacteria | 2242 |
| 71 | Ga0070713_100140079 | 3300005436 | Unclassified | 2142 |
| 72 | Ga0070713_100622158 | 3300005436 | Bacteria | 1027 |
| 73 | Ga0070713_100796438 | 3300005436 | Bacteria | 906 |
| 74 | Ga0070713_101418363 | 3300005436 | Bacteria | 674 |
| 75 | Ga0070710_10025637 | 3300005437 | Bacteria | 3124 |
| 76 | Ga0070710_10379250 | 3300005437 | Unclassified | 943 |
| 77 | Ga0070710_10490179 | 3300005437 | Bacteria | 840 |
| 78 | Ga0070710_10952575 | 3300005437 | Unclassified | 623 |
| 79 | Ga0070711_100015241 | 3300005439 | Unclassified | 4864 |
| 80 | Ga0070711_100267983 | 3300005439 | Bacteria | 1346 |
| 81 | Ga0070711_100346437 | 3300005439 | Unclassified | 1193 |
| 82 | Ga0070711_100565569 | 3300005439 | Bacteria | 945 |
| 83 | Ga0070711_101513031 | 3300005439 | Unclassified | 586 |
| 84 | Ga0070705_100387829 | 3300005440 | Unclassified | 1030 |
| 85 | Ga0070705_100629828 | 3300005440 | Bacteria | 834 |
| 86 | Ga0070705_101691075 | 3300005440 | Unclassified | 534 |
| 87 | Ga0070700_100712585 | 3300005441 | Bacteria | 799 |
| 88 | Ga0070694_100653623 | 3300005444 | Bacteria | 851 |
| 89 | Ga0070708_100016655 | 3300005445 | Bacteria | 6107 |
| 90 | Ga0070708_100027244 | 3300005445 | Bacteria | 4902 |
| 91 | Ga0070708_100040302 | 3300005445 | Bacteria | 4090 |
| 92 | Ga0070708_100294531 | 3300005445 | Bacteria | 1528 |
| 93 | Ga0070708_100366781 | 3300005445 | Bacteria | 1357 |
| 94 | Ga0070708_100673728 | 3300005445 | Unclassified | 974 |
| 95 | Ga0070708_100689425 | 3300005445 | Unclassified | 962 |
| 96 | Ga0070708_100995546 | 3300005445 | Unclassified | 786 |
| 97 | Ga0070708_101140184 | 3300005445 | Unclassified | 730 |
| 98 | Ga0070708_101225130 | 3300005445 | Unclassified | 702 |
| 99 | Ga0070708_101283933 | 3300005445 | Unclassified | 684 |
| 100 | Ga0070708_101308013 | 3300005445 | Bacteria | 677 |
| 101 | Ga0070708_101515315 | 3300005445 | Bacteria | 625 |
| 102 | Ga0070708_101601348 | 3300005445 | Bacteria | 606 |
| 103 | Ga0070708_101704396 | 3300005445 | Unclassified | 586 |
| 104 | Ga0070708_102119720 | 3300005445 | Unclassified | 520 |
| 105 | Ga0070663_100242651 | 3300005455 | Bacteria | 1423 |
| 106 | Ga0070678_100179070 | 3300005456 | Unclassified | 1734 |
| 107 | Ga0070678_100342116 | 3300005456 | Bacteria | 1284 |
| 108 | Ga0070662_100837940 | 3300005457 | Unclassified | 783 |
| 109 | Ga0070662_100963457 | 3300005457 | Bacteria | 729 |
| 110 | Ga0070662_101452658 | 3300005457 | Bacteria | 591 |
| 111 | Ga0070681_10000041 | 3300005458 | Bacteria | 89178 |
| 112 | Ga0070681_10006765 | 3300005458 | Bacteria | 11161 |
| 113 | Ga0068867_101141195 | 3300005459 | Bacteria | 713 |
| 114 | Ga0068867_102376095 | 3300005459 | Unclassified | 504 |
| 115 | Ga0070706_100016203 | 3300005467 | Bacteria | 6884 |
| 116 | Ga0070706_100033749 | 3300005467 | Bacteria | 4725 |
| 117 | Ga0070706_100071533 | 3300005467 | Bacteria | 3208 |
| 118 | Ga0070706_100144711 | 3300005467 | Unclassified | 2220 |
| 119 | Ga0070706_100161438 | 3300005467 | Bacteria | 2093 |
| 120 | Ga0070706_100313851 | 3300005467 | Bacteria | 1462 |
| 121 | Ga0070706_100342287 | 3300005467 | Bacteria | 1394 |
| 122 | Ga0070706_100432446 | 3300005467 | Bacteria | 1225 |
| 123 | Ga0070706_100695514 | 3300005467 | Unclassified | 943 |
| 124 | Ga0070706_101012384 | 3300005467 | Unclassified | 766 |
| 125 | Ga0070706_101622878 | 3300005467 | Unclassified | 590 |
| 126 | Ga0070707_100005775 | 3300005468 | Bacteria | 11540 |
| 127 | Ga0070707_100013069 | 3300005468 | Bacteria | 7758 |
| 128 | Ga0070707_100020702 | 3300005468 | Bacteria | 6207 |
| 129 | Ga0070707_100099388 | 3300005468 | Unclassified | 2819 |
| 130 | Ga0070707_100101537 | 3300005468 | Bacteria | 2788 |
| 131 | Ga0070707_100166171 | 3300005468 | Bacteria | 2150 |
| 132 | Ga0070707_100167250 | 3300005468 | Unclassified | 2143 |
| 133 | Ga0070707_100167518 | 3300005468 | Bacteria | 2141 |
| 134 | Ga0070707_100256186 | 3300005468 | Bacteria | 1703 |
| 135 | Ga0070707_100381304 | 3300005468 | Bacteria | 1369 |
| 136 | Ga0070707_100416287 | 3300005468 | Bacteria | 1304 |
| 137 | Ga0070707_100883729 | 3300005468 | Bacteria | 858 |
| 138 | Ga0070707_101824042 | 3300005468 | Unclassified | 575 |
| 139 | Ga0070707_101943222 | 3300005468 | Bacteria | 556 |
| 140 | Ga0070698_100012337 | 3300005471 | Bacteria | 9049 |
| 141 | Ga0070698_100081393 | 3300005471 | Bacteria | 3232 |
| 142 | Ga0070698_100137101 | 3300005471 | Bacteria | 2400 |
| 143 | Ga0070698_100517896 | 3300005471 | Unclassified | 1131 |
| 144 | Ga0070698_101698414 | 3300005471 | Unclassified | 584 |
| 145 | Ga0070698_102012821 | 3300005471 | Bacteria | 531 |
| 146 | Ga0070698_102116674 | 3300005471 | Bacteria | 516 |
| 147 | Ga0070699_100106256 | 3300005518 | Unclassified | 2462 |
| 148 | Ga0070699_100297803 | 3300005518 | Bacteria | 1447 |
| 149 | Ga0070699_100724759 | 3300005518 | Bacteria | 909 |
| 150 | Ga0070699_100893034 | 3300005518 | Bacteria | 814 |
| 151 | Ga0070699_100926454 | 3300005518 | Unclassified | 798 |
| 152 | Ga0070699_101425506 | 3300005518 | Bacteria | 635 |
| 153 | Ga0070679_100000074 | 3300005530 | Bacteria | 74890 |
| 154 | Ga0070679_100009577 | 3300005530 | Bacteria | 9161 |
| 155 | Ga0070679_101141995 | 3300005530 | Unclassified | 724 |
| 156 | Ga0070684_100016086 | 3300005535 | Bacteria | 6110 |
| 157 | Ga0070684_100691411 | 3300005535 | Bacteria | 951 |
| 158 | Ga0070697_100000699 | 3300005536 | Bacteria | 25148 |
| 159 | Ga0070697_100002030 | 3300005536 | Bacteria | 15491 |
| 160 | Ga0070697_100008913 | 3300005536 | Bacteria | 7837 |
| 161 | Ga0070697_100016984 | 3300005536 | Bacteria | 5721 |
| 162 | Ga0070697_100037087 | 3300005536 | Unclassified | 3937 |
| 163 | Ga0070697_100065708 | 3300005536 | Unclassified | 2965 |
| 164 | Ga0070697_100069405 | 3300005536 | Bacteria | 2886 |
| 165 | Ga0070697_100118428 | 3300005536 | Bacteria | 2213 |
| 166 | Ga0070697_100124538 | 3300005536 | Bacteria | 2158 |
| 167 | Ga0070697_100178498 | 3300005536 | Bacteria | 1799 |
| 168 | Ga0070697_100251413 | 3300005536 | Bacteria | 1512 |
| 169 | Ga0070697_100543350 | 3300005536 | Unclassified | 1019 |
| 170 | Ga0070697_100712025 | 3300005536 | Bacteria | 886 |
| 171 | Ga0070697_100849716 | 3300005536 | Unclassified | 808 |
| 172 | Ga0070697_101155927 | 3300005536 | Unclassified | 689 |
| 173 | Ga0070697_101273705 | 3300005536 | Bacteria | 656 |
| 174 | Ga0070697_101300815 | 3300005536 | Unclassified | 648 |
| 175 | Ga0068853_102074736 | 3300005539 | Unclassified | 551 |
| 176 | Ga0070672_100477183 | 3300005543 | Unclassified | 1077 |
| 177 | Ga0070672_101143816 | 3300005543 | Unclassified | 692 |
| 178 | Ga0070686_100024620 | 3300005544 | Bacteria | 3610 |
| 179 | Ga0070686_100847825 | 3300005544 | Bacteria | 740 |
| 180 | Ga0070695_100708191 | 3300005545 | Bacteria | 800 |
| 181 | Ga0070695_101243426 | 3300005545 | Unclassified | 614 |
| 182 | Ga0070696_101391240 | 3300005546 | Unclassified | 598 |
| 183 | Ga0070696_101724953 | 3300005546 | Unclassified | 540 |
| 184 | Ga0070693_100130903 | 3300005547 | Bacteria | 1568 |
| 185 | Ga0070693_100135391 | 3300005547 | Bacteria | 1545 |
| 186 | Ga0070665_100030843 | 3300005548 | Bacteria | 5396 |
| 187 | Ga0070665_100086844 | 3300005548 | Unclassified | 3133 |
| 188 | Ga0070665_100708212 | 3300005548 | Unclassified | 1020 |
| 189 | Ga0070704_100305928 | 3300005549 | Bacteria | 1326 |
| 190 | Ga0070704_101331038 | 3300005549 | Bacteria | 658 |
| 191 | Ga0070704_101367655 | 3300005549 | Unclassified | 649 |
| 192 | Ga0070664_100664541 | 3300005564 | Unclassified | 969 |
| 193 | Ga0068854_100304731 | 3300005578 | Bacteria | 1290 |
| 194 | Ga0068856_100025652 | 3300005614 | Bacteria | 5747 |
| 195 | Ga0068856_100054202 | 3300005614 | Unclassified | 3954 |
| 196 | Ga0068856_100802776 | 3300005614 | Unclassified | 961 |
| 197 | Ga0068856_100888750 | 3300005614 | Unclassified | 910 |
| 198 | Ga0070702_100581306 | 3300005615 | Unclassified | 836 |
| 199 | Ga0070702_100893313 | 3300005615 | Bacteria | 695 |
| 200 | Ga0070702_101444108 | 3300005615 | Bacteria | 564 |
| 201 | Ga0068852_100667054 | 3300005616 | Unclassified | 1048 |
| 202 | Ga0068859_102316012 | 3300005617 | Unclassified | 592 |
| 203 | Ga0068864_101170209 | 3300005618 | Unclassified | 767 |
| 204 | Ga0068866_10253497 | 3300005718 | Bacteria | 1078 |
| 205 | Ga0068866_10562276 | 3300005718 | Unclassified | 764 |
| 206 | Ga0068861_100890829 | 3300005719 | Unclassified | 842 |
| 207 | Ga0068863_100252730 | 3300005841 | Unclassified | 1703 |
| 208 | Ga0068863_100937877 | 3300005841 | Bacteria | 867 |
| 209 | Ga0068858_100336727 | 3300005842 | Unclassified | 1444 |
| 210 | Ga0081455_10178172 | 3300005937 | Bacteria | 1612 |
| 211 | Ga0081455_10266799 | 3300005937 | Unclassified | 1244 |
| 212 | Ga0081539_10000673 | 3300005985 | Bacteria | 68473 |
| 213 | Ga0081539_10013013 | 3300005985 | Bacteria | 6318 |
| 214 | Ga0081539_10054994 | 3300005985 | Bacteria | 2217 |
| 215 | Ga0070717_10143510 | 3300006028 | Bacteria | 2061 |
| 216 | Ga0070717_10164322 | 3300006028 | Unclassified | 1928 |
| 217 | Ga0070717_10194991 | 3300006028 | Bacteria | 1771 |
| 218 | Ga0070717_10515864 | 3300006028 | Unclassified | 1081 |
| 219 | Ga0070717_10517820 | 3300006028 | Unclassified | 1079 |
| 220 | Ga0070717_10861103 | 3300006028 | Unclassified | 825 |
| 221 | Ga0070717_11555564 | 3300006028 | Unclassified | 600 |
| 222 | Ga0070717_11559128 | 3300006028 | Unclassified | 599 |
| 223 | Ga0070717_11643328 | 3300006028 | Unclassified | 582 |
| 224 | Ga0070717_11791077 | 3300006028 | Unclassified | 555 |
| 225 | Ga0070717_12097821 | 3300006028 | Unclassified | 509 |
| 226 | Ga0070715_10014359 | 3300006163 | Bacteria | 2931 |
| 227 | Ga0070715_10047255 | 3300006163 | Unclassified | 1833 |
| 228 | Ga0070715_10512378 | 3300006163 | Unclassified | 689 |
| 229 | Ga0070715_10519781 | 3300006163 | Unclassified | 685 |
| 230 | Ga0070716_100113182 | 3300006173 | Bacteria | 1685 |
| 231 | Ga0070716_100625806 | 3300006173 | Bacteria | 813 |
| 232 | Ga0070716_101058150 | 3300006173 | Unclassified | 645 |
| 233 | Ga0070716_101116190 | 3300006173 | Unclassified | 629 |
| 234 | Ga0070716_101623468 | 3300006173 | Bacteria | 531 |
| 235 | Ga0070712_100007387 | 3300006175 | Bacteria | 6855 |
| 236 | Ga0070712_100018384 | 3300006175 | Bacteria | 4540 |
| 237 | Ga0070712_100069026 | 3300006175 | Bacteria | 2520 |
| 238 | Ga0070712_100121374 | 3300006175 | Bacteria | 1967 |
| 239 | Ga0070712_100370005 | 3300006175 | Unclassified | 1177 |
| 240 | Ga0070712_100400984 | 3300006175 | Bacteria | 1133 |
| 241 | Ga0070712_100564455 | 3300006175 | Bacteria | 960 |
| 242 | Ga0070712_100782466 | 3300006175 | Bacteria | 818 |
| 243 | Ga0070712_100947308 | 3300006175 | Unclassified | 743 |
| 244 | Ga0070712_101522833 | 3300006175 | Unclassified | 585 |
| 245 | Ga0070712_101970699 | 3300006175 | Unclassified | 511 |
| 246 | Ga0070712_101970700 | 3300006175 | Unclassified | 511 |
| 247 | Ga0097621_100624015 | 3300006237 | Bacteria | 987 |
| 248 | Ga0097621_100669614 | 3300006237 | Unclassified | 953 |
| 249 | Ga0068871_100182695 | 3300006358 | Bacteria | 1803 |
| 250 | Ga0068871_101720784 | 3300006358 | Bacteria | 595 |
| 251 | Ga0075428_101885887 | 3300006844 | Unclassified | 621 |
| 252 | Ga0075433_10109009 | 3300006852 | Unclassified | 2456 |
| 253 | Ga0075433_10218147 | 3300006852 | Unclassified | 1695 |
| 254 | Ga0075433_11337854 | 3300006852 | Unclassified | 620 |
| 255 | Ga0075434_100201419 | 3300006871 | Bacteria | 2011 |
| 256 | Ga0075434_100534293 | 3300006871 | Bacteria | 1193 |
| 257 | Ga0075434_101300403 | 3300006871 | Unclassified | 738 |
| 258 | Ga0075434_101992265 | 3300006871 | Unclassified | 586 |
| 259 | Ga0068865_101019053 | 3300006881 | Bacteria | 726 |
| 260 | Ga0075436_100023411 | 3300006914 | Bacteria | 4242 |
| 261 | Ga0075436_100187032 | 3300006914 | Bacteria | 1465 |
| 262 | Ga0097620_102316241 | 3300006931 | Unclassified | 592 |
| 263 | Ga0075435_100435579 | 3300007076 | Bacteria | 1130 |
| 264 | Ga0075435_100692124 | 3300007076 | Unclassified | 886 |
| 265 | Ga0075435_100837888 | 3300007076 | Unclassified | 801 |
| 266 | Ga0099794_10181734 | 3300007265 | Bacteria | 1074 |
| 267 | Ga0099795_10050037 | 3300007788 | Bacteria | 1518 |
| 268 | Ga0099795_10149256 | 3300007788 | Bacteria | 956 |
| 269 | Ga0105251_10533850 | 3300009011 | Bacteria | 551 |
| 270 | Ga0105240_10414625 | 3300009093 | Bacteria | 1514 |
| 271 | Ga0105240_10571586 | 3300009093 | Bacteria | 1248 |
| 272 | Ga0111539_11290008 | 3300009094 | Bacteria | 848 |
| 273 | Ga0105245_10025427 | 3300009098 | Bacteria | 5208 |
| 274 | Ga0105245_10163458 | 3300009098 | Unclassified | 2114 |
| 275 | Ga0105245_11452139 | 3300009098 | Bacteria | 736 |
| 276 | Ga0105245_11913201 | 3300009098 | Unclassified | 646 |
| 277 | Ga0105247_10243401 | 3300009101 | Bacteria | 1226 |
| 278 | Ga0105247_11749608 | 3300009101 | Unclassified | 515 |
| 279 | Ga0105243_10823030 | 3300009148 | Unclassified | 917 |
| 280 | Ga0105241_10174179 | 3300009174 | Unclassified | 1779 |
| 281 | Ga0105241_11184570 | 3300009174 | Bacteria | 723 |
| 282 | Ga0105241_11344132 | 3300009174 | Bacteria | 682 |
| 283 | Ga0105242_10413443 | 3300009176 | Bacteria | 1262 |
| 284 | Ga0105242_10846795 | 3300009176 | Bacteria | 910 |
| 285 | Ga0105248_10280862 | 3300009177 | Unclassified | 1875 |
| 286 | Ga0105248_11996715 | 3300009177 | Bacteria | 659 |
| 287 | Ga0105237_11231812 | 3300009545 | Bacteria | 755 |
| 288 | Ga0105237_12254214 | 3300009545 | Bacteria | 554 |
| 289 | Ga0105238_12211132 | 3300009551 | Bacteria | 585 |
| 290 | Ga0105249_10016066 | 3300009553 | Bacteria | 6635 |
| 291 | Ga0099796_10298383 | 3300010159 | Unclassified | 682 |
| 292 | Ga0105239_10343100 | 3300010375 | Bacteria | 1686 |
| 293 | Ga0105239_10857960 | 3300010375 | Unclassified | 1041 |
| 294 | Ga0105239_11408166 | 3300010375 | Unclassified | 805 |
| 295 | Ga0105239_11614269 | 3300010375 | Unclassified | 750 |
| 296 | Ga0105239_13373129 | 3300010375 | Unclassified | 520 |
| 297 | Ga0105246_10746108 | 3300011119 | Bacteria | 863 |
| 298 | Ga0157373_10777940 | 3300013100 | Unclassified | 705 |
| 299 | Ga0157373_11119884 | 3300013100 | Unclassified | 591 |
| 300 | Ga0157371_10432221 | 3300013102 | Unclassified | 966 |
| 301 | Ga0157370_10127105 | 3300013104 | Unclassified | 2379 |
| 302 | Ga0157369_10070271 | 3300013105 | Unclassified | 3762 |
| 303 | Ga0157374_10244141 | 3300013296 | Bacteria | 1766 |
| 304 | Ga0157374_10467545 | 3300013296 | Unclassified | 1263 |
| 305 | Ga0157374_10546111 | 3300013296 | Bacteria | 1166 |
| 306 | Ga0157374_11676330 | 3300013296 | Bacteria | 660 |
| 307 | Ga0157374_12504954 | 3300013296 | Bacteria | 543 |
| 308 | Ga0157378_10003020 | 3300013297 | Bacteria | 14952 |
| 309 | Ga0157378_10018210 | 3300013297 | Bacteria | 6166 |
| 310 | Ga0157378_10051876 | 3300013297 | Bacteria | 3649 |
| 311 | Ga0157378_10054621 | 3300013297 | Bacteria | 3556 |
| 312 | Ga0157378_10206438 | 3300013297 | Bacteria | 1861 |
| 313 | Ga0157378_10384983 | 3300013297 | Bacteria | 1378 |
| 314 | Ga0157378_11187472 | 3300013297 | Bacteria | 802 |
| 315 | Ga0157378_12283259 | 3300013297 | Unclassified | 592 |
| 316 | Ga0163162_10800448 | 3300013306 | Bacteria | 1060 |
| 317 | Ga0163162_13223494 | 3300013306 | Unclassified | 523 |
| 318 | Ga0157372_10044158 | 3300013307 | Bacteria | 4938 |
| 319 | Ga0157372_10061558 | 3300013307 | Bacteria | 4203 |
| 320 | Ga0157372_10495990 | 3300013307 | Unclassified | 1424 |
| 321 | Ga0157372_12450599 | 3300013307 | Unclassified | 599 |
| 322 | Ga0157372_12582865 | 3300013307 | Bacteria | 583 |
| 323 | Ga0157375_10117560 | 3300013308 | Unclassified | 2764 |
| 324 | Ga0157375_12917836 | 3300013308 | Bacteria | 571 |
| 325 | Ga0157375_13097711 | 3300013308 | Viruses | 555 |
| 326 | Ga0163163_10338062 | 3300014325 | Unclassified | 1561 |
| 327 | Ga0182008_10529086 | 3300014497 | Unclassified | 652 |
| 328 | Ga0182008_10943984 | 3300014497 | Bacteria | 510 |
| 329 | Ga0157377_10237046 | 3300014745 | Unclassified | 1176 |
| 330 | Ga0157379_10260246 | 3300014968 | Unclassified | 1576 |
| 331 | Ga0157379_10786358 | 3300014968 | Unclassified | 897 |
| 332 | Ga0157376_10689202 | 3300014969 | Bacteria | 1026 |
| 333 | Ga0157376_11891997 | 3300014969 | Bacteria | 633 |
| 334 | Ga0182006_1017981 | 3300015261 | Bacteria | 2993 |
| 335 | Ga0182007_10179804 | 3300015262 | Bacteria | 731 |
| 336 | Ga0163161_10453620 | 3300017792 | Bacteria | 1037 |
| 337 | Ga0163161_10601660 | 3300017792 | Unclassified | 906 |
| 338 | Ga0163161_11111305 | 3300017792 | Bacteria | 680 |
| 339 | Ga0207666_1042320 | 3300025271 | Unclassified | 713 |
| 340 | Ga0207673_1000733 | 3300025290 | Bacteria | 3519 |
| 341 | Ga0207673_1003628 | 3300025290 | Bacteria | 1814 |
| 342 | Ga0207697_10000970 | 3300025315 | Bacteria | 16134 |
| 343 | Ga0207697_10003616 | 3300025315 | Bacteria | 7578 |
| 344 | Ga0207697_10039079 | 3300025315 | Bacteria | 1947 |
| 345 | Ga0207692_10190492 | 3300025898 | Unclassified | 1200 |
| 346 | Ga0207692_10446228 | 3300025898 | Unclassified | 814 |
| 347 | Ga0207692_10470130 | 3300025898 | Bacteria | 794 |
| 348 | Ga0207692_11147254 | 3300025898 | Unclassified | 515 |
| 349 | Ga0207642_10938920 | 3300025899 | Unclassified | 555 |
| 350 | Ga0207710_10149810 | 3300025900 | Bacteria | 1131 |
| 351 | Ga0207688_10309136 | 3300025901 | Unclassified | 968 |
| 352 | Ga0207680_10119112 | 3300025903 | Unclassified | 1724 |
| 353 | Ga0207685_10157748 | 3300025905 | Bacteria | 1033 |
| 354 | Ga0207685_10176023 | 3300025905 | Unclassified | 988 |
| 355 | Ga0207685_10524097 | 3300025905 | Unclassified | 627 |
| 356 | Ga0207699_10077832 | 3300025906 | Bacteria | 2048 |
| 357 | Ga0207699_10788664 | 3300025906 | Unclassified | 698 |
| 358 | Ga0207699_11103386 | 3300025906 | Unclassified | 587 |
| 359 | Ga0207645_10122503 | 3300025907 | Unclassified | 1689 |
| 360 | Ga0207645_10307789 | 3300025907 | Unclassified | 1055 |
| 361 | Ga0207645_10420407 | 3300025907 | Unclassified | 900 |
| 362 | Ga0207705_10146136 | 3300025909 | Unclassified | 1769 |
| 363 | Ga0207684_10000318 | 3300025910 | Bacteria | 68520 |
| 364 | Ga0207684_10003308 | 3300025910 | Bacteria | 15817 |
| 365 | Ga0207684_10003816 | 3300025910 | Bacteria | 14533 |
| 366 | Ga0207684_10022841 | 3300025910 | Bacteria | 5341 |
| 367 | Ga0207684_10024201 | 3300025910 | Bacteria | 5178 |
| 368 | Ga0207684_10034439 | 3300025910 | Archaea | 4303 |
| 369 | Ga0207684_10056581 | 3300025910 | Bacteria | 3327 |
| 370 | Ga0207684_10302449 | 3300025910 | Unclassified | 1379 |
| 371 | Ga0207684_10327335 | 3300025910 | Bacteria | 1320 |
| 372 | Ga0207684_10443387 | 3300025910 | Unclassified | 1115 |
| 373 | Ga0207684_11717616 | 3300025910 | Unclassified | 505 |
| 374 | Ga0207707_10000077 | 3300025912 | Bacteria | 100255 |
| 375 | Ga0207707_10057924 | 3300025912 | Unclassified | 3372 |
| 376 | Ga0207695_10342651 | 3300025913 | Bacteria | 1382 |
| 377 | Ga0207695_10960953 | 3300025913 | Unclassified | 734 |
| 378 | Ga0207695_11689869 | 3300025913 | Bacteria | 514 |
| 379 | Ga0207671_11142471 | 3300025914 | Unclassified | 611 |
| 380 | Ga0207693_10013832 | 3300025915 | Bacteria | 6498 |
| 381 | Ga0207693_10022513 | 3300025915 | Bacteria | 5007 |
| 382 | Ga0207693_10030830 | 3300025915 | Bacteria | 4235 |
| 383 | Ga0207693_10071760 | 3300025915 | Bacteria | 2711 |
| 384 | Ga0207693_10133311 | 3300025915 | Bacteria | 1953 |
| 385 | Ga0207693_10973634 | 3300025915 | Bacteria | 649 |
| 386 | Ga0207663_10017342 | 3300025916 | Unclassified | 4010 |
| 387 | Ga0207663_10107923 | 3300025916 | Unclassified | 1884 |
| 388 | Ga0207663_10145359 | 3300025916 | Bacteria | 1657 |
| 389 | Ga0207663_10273721 | 3300025916 | Bacteria | 1251 |
| 390 | Ga0207663_10664339 | 3300025916 | Unclassified | 823 |
| 391 | Ga0207660_10009434 | 3300025917 | Bacteria | 6317 |
| 392 | Ga0207660_10499607 | 3300025917 | Unclassified | 987 |
| 393 | Ga0207662_10128107 | 3300025918 | Bacteria | 1598 |
| 394 | Ga0207662_10790119 | 3300025918 | Unclassified | 669 |
| 395 | Ga0207657_10330546 | 3300025919 | Bacteria | 1204 |
| 396 | Ga0207649_10016598 | 3300025920 | Unclassified | 4156 |
| 397 | Ga0207652_10000096 | 3300025921 | Bacteria | 96047 |
| 398 | Ga0207652_10237799 | 3300025921 | Bacteria | 1641 |
| 399 | Ga0207646_10010847 | 3300025922 | Bacteria | 8858 |
| 400 | Ga0207646_10011354 | 3300025922 | Bacteria | 8641 |
| 401 | Ga0207646_10076094 | 3300025922 | Bacteria | 2999 |
| 402 | Ga0207646_10086243 | 3300025922 | Unclassified | 2809 |
| 403 | Ga0207646_10116626 | 3300025922 | Bacteria | 2398 |
| 404 | Ga0207646_10142901 | 3300025922 | Bacteria | 2156 |
| 405 | Ga0207646_10171838 | 3300025922 | Bacteria | 1957 |
| 406 | Ga0207646_10287784 | 3300025922 | Bacteria | 1485 |
| 407 | Ga0207646_10697213 | 3300025922 | Bacteria | 908 |
| 408 | Ga0207646_11480260 | 3300025922 | Unclassified | 588 |
| 409 | Ga0207646_11495276 | 3300025922 | Bacteria | 585 |
| 410 | Ga0207646_11579576 | 3300025922 | Unclassified | 566 |
| 411 | Ga0207646_11863166 | 3300025922 | Bacteria | 513 |
| 412 | Ga0207681_10052070 | 3300025923 | Bacteria | 2775 |
| 413 | Ga0207650_10337111 | 3300025925 | Unclassified | 1238 |
| 414 | Ga0207659_10343601 | 3300025926 | Unclassified | 1236 |
| 415 | Ga0207687_10138282 | 3300025927 | Unclassified | 1845 |
| 416 | Ga0207687_10226701 | 3300025927 | Unclassified | 1474 |
| 417 | Ga0207687_10286737 | 3300025927 | Unclassified | 1322 |
| 418 | Ga0207700_10092241 | 3300025928 | Bacteria | 2394 |
| 419 | Ga0207700_10124851 | 3300025928 | Bacteria | 2092 |
| 420 | Ga0207700_10494014 | 3300025928 | Unclassified | 1082 |
| 421 | Ga0207700_11776287 | 3300025928 | Unclassified | 543 |
| 422 | Ga0207664_10020094 | 3300025929 | Bacteria | 4945 |
| 423 | Ga0207664_10120284 | 3300025929 | Unclassified | 2196 |
| 424 | Ga0207664_10363625 | 3300025929 | Unclassified | 1282 |
| 425 | Ga0207664_10529931 | 3300025929 | Bacteria | 1056 |
| 426 | Ga0207664_10622024 | 3300025929 | Unclassified | 970 |
| 427 | Ga0207664_10643609 | 3300025929 | Unclassified | 953 |
| 428 | Ga0207664_11313303 | 3300025929 | Bacteria | 643 |
| 429 | Ga0207644_10398330 | 3300025931 | Unclassified | 1125 |
| 430 | Ga0207690_11052528 | 3300025932 | Unclassified | 678 |
| 431 | Ga0207706_10467568 | 3300025933 | Bacteria | 1090 |
| 432 | Ga0207706_10512223 | 3300025933 | Bacteria | 1035 |
| 433 | Ga0207706_10834778 | 3300025933 | Unclassified | 781 |
| 434 | Ga0207706_11241952 | 3300025933 | Bacteria | 618 |
| 435 | Ga0207686_10396084 | 3300025934 | Unclassified | 1051 |
| 436 | Ga0207670_10027947 | 3300025936 | Unclassified | 3574 |
| 437 | Ga0207669_10420167 | 3300025937 | Unclassified | 1052 |
| 438 | Ga0207669_10911486 | 3300025937 | Unclassified | 735 |
| 439 | Ga0207669_11228599 | 3300025937 | Unclassified | 635 |
| 440 | Ga0207704_10664044 | 3300025938 | Bacteria | 860 |
| 441 | Ga0207665_10018808 | 3300025939 | Bacteria | 4540 |
| 442 | Ga0207665_10142038 | 3300025939 | Bacteria | 1713 |
| 443 | Ga0207665_10201363 | 3300025939 | Bacteria | 1451 |
| 444 | Ga0207665_11284723 | 3300025939 | Unclassified | 583 |
| 445 | Ga0207691_10019193 | 3300025940 | Bacteria | 6472 |
| 446 | Ga0207711_10809482 | 3300025941 | Bacteria | 872 |
| 447 | Ga0207711_11840443 | 3300025941 | Bacteria | 548 |
| 448 | Ga0207689_10872462 | 3300025942 | Unclassified | 759 |
| 449 | Ga0207689_11577999 | 3300025942 | Unclassified | 547 |
| 450 | Ga0207661_10021589 | 3300025944 | Unclassified | 4826 |
| 451 | Ga0207679_10696625 | 3300025945 | Unclassified | 921 |
| 452 | Ga0207679_12203702 | 3300025945 | Unclassified | 500 |
| 453 | Ga0207651_10032412 | 3300025960 | Unclassified | 3356 |
| 454 | Ga0207651_10983833 | 3300025960 | Unclassified | 753 |
| 455 | Ga0207668_10536394 | 3300025972 | Bacteria | 1012 |
| 456 | Ga0207640_10534922 | 3300025981 | Bacteria | 982 |
| 457 | Ga0207640_11623934 | 3300025981 | Unclassified | 583 |
| 458 | Ga0207658_10587107 | 3300025986 | Unclassified | 1000 |
| 459 | Ga0207677_10189840 | 3300026023 | Bacteria | 1624 |
| 460 | Ga0207677_10516718 | 3300026023 | Unclassified | 1035 |
| 461 | Ga0207677_11217688 | 3300026023 | Bacteria | 689 |
| 462 | Ga0207703_10185550 | 3300026035 | Bacteria | 1838 |
| 463 | Ga0207703_10649200 | 3300026035 | Unclassified | 1001 |
| 464 | Ga0207639_10157024 | 3300026041 | Bacteria | 1912 |
| 465 | Ga0207678_10175375 | 3300026067 | Unclassified | 1831 |
| 466 | Ga0207708_10195336 | 3300026075 | Bacteria | 1612 |
| 467 | Ga0207702_10135720 | 3300026078 | Unclassified | 2219 |
| 468 | Ga0207702_11111989 | 3300026078 | Unclassified | 784 |
| 469 | Ga0207702_11207428 | 3300026078 | Unclassified | 750 |
| 470 | Ga0207641_10493084 | 3300026088 | Unclassified | 1189 |
| 471 | Ga0207641_11172902 | 3300026088 | Bacteria | 767 |
| 472 | Ga0207648_10327523 | 3300026089 | Unclassified | 1377 |
| 473 | Ga0207648_12132127 | 3300026089 | Unclassified | 521 |
| 474 | Ga0207676_10293413 | 3300026095 | Bacteria | 1482 |
| 475 | Ga0207676_11073974 | 3300026095 | Unclassified | 795 |
| 476 | Ga0207675_100597528 | 3300026118 | Bacteria | 1106 |
| 477 | Ga0207683_10020144 | 3300026121 | Bacteria | 5702 |
| 478 | Ga0207698_10547378 | 3300026142 | Unclassified | 1134 |
| 479 | Ga0210002_1045346 | 3300027617 | Bacteria | 752 |
| 480 | Ga0207428_10866155 | 3300027907 | Bacteria | 639 |
| 481 | Ga0268266_10018166 | 3300028379 | Bacteria | 5995 |
| 482 | Ga0268266_10089283 | 3300028379 | Bacteria | 2698 |
| 483 | Ga0268266_11092421 | 3300028379 | Unclassified | 772 |
| 484 | Ga0268264_10593202 | 3300028381 | Unclassified | 1091 |
| 485 | Ga0268264_10986224 | 3300028381 | Bacteria | 849 |
| 486 | Ga0373923_0236299 | 3300035111 | Bacteria | 853 |
| 487 | Ga0373923_0498672 | 3300035111 | Bacteria | 594 |
| 488 | Ga0373945_0067226 | 3300035116 | Bacteria | 1349 |
| 489 | Ga0373953_0176358 | 3300035117 | Bacteria | 921 |
| 490 | Ga0373954_0557656 | 3300035118 | Unclassified | 568 |
| 491 | Ga0373956_0046750 | 3300035119 | Bacteria | 1935 |
| 492 | Ga0373943_0040392 | 3300035170 | Bacteria | 2252 |
| 493 | Ga0373943_0297775 | 3300035170 | Bacteria | 915 |
| 494 | Ga0373943_0579641 | 3300035170 | Bacteria | 660 |
| 495 | Ga0373946_0047514 | 3300035171 | Bacteria | 1783 |
| 496 | Ga0373955_0801254 | 3300035172 | Unclassified | 579 |
| 497 | Ga0373935_0044854 | 3300035692 | Bacteria | 2788 |
| 498 | Ga0373935_0050261 | 3300035692 | Bacteria | 2646 |
| 499 | Ga0373935_0152677 | 3300035692 | Bacteria | 1568 |
| 500 | Ga0373927_0139211 | 3300035695 | Bacteria | 1587 |
| 501 | Ga0373927_0175879 | 3300035695 | Bacteria | 1404 |
| 502 | Ga0373933_0260665 | 3300035724 | Bacteria | 1118 |
| 503 | Ga0373933_0443645 | 3300035724 | Bacteria | 849 |
| 504 | Ga0373947_0020927 | 3300035725 | Bacteria | 3783 |
| 505 | Ga0373947_0021063 | 3300035725 | Bacteria | 3772 |
| 506 | Ga0373947_0038395 | 3300035725 | Bacteria | 2845 |
| 507 | Ga0373947_0308058 | 3300035725 | Bacteria | 1057 |
| 508 | Ga0373947_0700845 | 3300035725 | Unclassified | 691 |
| 509 | Ga0373937_0117309 | 3300036401 | Bacteria | 2479 |
| 510 | Ga0373937_0336461 | 3300036401 | Bacteria | 1429 |
| 511 | Ga0373937_1178528 | 3300036401 | Bacteria | 715 |
| 512 | Ga0373937_1951627 | 3300036401 | Bacteria | 533 |
| 513 | Ga0373925_0322958 | 3300037068 | Unclassified | 1249 |
| 514 | Ga0395900_0316335 | 3300037418 | Bacteria | 1543 |
| 515 | Ga0395900_0498243 | 3300037418 | Unclassified | 1169 |
| 516 | Ga0395900_0769720 | 3300037418 | Unclassified | 892 |
| 517 | Ga0395898_0846974 | 3300037466 | Bacteria | 854 |
| 518 | Ga0395905_0215382 | 3300037471 | Bacteria | 1799 |
| 519 | Ga0395905_0869682 | 3300037471 | Unclassified | 804 |
| 520 | Ga0395901_0621744 | 3300038443 | Bacteria | 1087 |
| 521 | Ga0395901_0936006 | 3300038443 | Unclassified | 846 |
| 522 | Ga0395901_1158587 | 3300038443 | Bacteria | 741 |
| 523 | Ga0436360_0449468 | 3300039438 | Unclassified | 514 |
| 524 | Ga0451798_0091717 | 3300041458 | Bacteria | 1165 |
| 525 | Ga0451802_0624474 | 3300041460 | Bacteria | 757 |
| 526 | Ga0451804_0024167 | 3300041463 | Bacteria | 960 |
| 527 | Ga0451807_2175110 | 3300041486 | Bacteria | 626 |
| 528 | Ga0451835_0452261 | 3300041492 | Unclassified | 820 |
| 529 | Ga0451849_0508029 | 3300041505 | Bacteria | 509 |
| 530 | Ga0451853_1768930 | 3300041512 | Bacteria | 1123 |
| 531 | Ga0439454_007948 | 3300042011 | Bacteria | 1342 |
| 532 | Ga0495592_0046937 | 3300046454 | Bacteria | 3218 |
| 533 | Ga0495592_0370170 | 3300046454 | Unclassified | 914 |
| 534 | Ga0495603_0202930 | 3300046455 | Bacteria | 1146 |
| 535 | Ga0495629_0590470 | 3300046459 | Unclassified | 743 |
| 536 | Ga0495629_0932284 | 3300046459 | Unclassified | 568 |
| 537 | Ga0495641_0113161 | 3300046461 | Bacteria | 1211 |
| 538 | Ga0495651_0204194 | 3300046462 | Bacteria | 1381 |
| 539 | Ga0495651_0867043 | 3300046462 | Bacteria | 554 |
| 540 | Ga0495653_0653852 | 3300046463 | Unclassified | 642 |
| 541 | Ga0495653_0729640 | 3300046463 | Unclassified | 600 |
| 542 | Ga0495580_0659833 | 3300046472 | Bacteria | 687 |
| 543 | Ga0495582_0237880 | 3300046473 | Bacteria | 1043 |
| 544 | Ga0495662_0172818 | 3300046476 | Bacteria | 1065 |
| 545 | Ga0495584_0391848 | 3300046491 | Bacteria | 706 |
| 546 | Ga0495594_0447221 | 3300046499 | Bacteria | 735 |
| 547 | Ga0495608_0632180 | 3300046511 | Bacteria | 641 |
| 548 | Ga0495618_0866566 | 3300046514 | Bacteria | 523 |
| 549 | Ga0495628_0021587 | 3300046516 | Bacteria | 5294 |
| 550 | Ga0495628_0939109 | 3300046516 | Unclassified | 598 |
| 551 | Ga0495630_0049181 | 3300046517 | Bacteria | 3155 |
| 552 | Ga0495630_0235592 | 3300046517 | Unclassified | 1399 |
| 553 | Ga0495630_0964610 | 3300046517 | Bacteria | 648 |
| 554 | Ga0495630_1048664 | 3300046517 | Bacteria | 619 |
| 555 | Ga0495666_0163448 | 3300046526 | Unclassified | 1032 |
| 556 | Ga0495666_0384342 | 3300046526 | Bacteria | 631 |
| 557 | Ga0495652_0098026 | 3300046529 | Bacteria | 2383 |
| 558 | Ga0495652_0251826 | 3300046529 | Bacteria | 1308 |
| 559 | Ga0495665_0405940 | 3300046531 | Bacteria | 691 |
| 560 | Ga0495640_0656061 | 3300046533 | Bacteria | 631 |
| 561 | Ga0495586_0009505 | 3300046535 | Bacteria | 5176 |
| 562 | Ga0495587_0294936 | 3300046536 | Unclassified | 907 |
| 563 | Ga0495645_0006846 | 3300046543 | Bacteria | 7922 |
| 564 | Ga0495667_0602558 | 3300046559 | Bacteria | 684 |
| 565 | Ga0495667_0869575 | 3300046559 | Unclassified | 554 |
| 566 | Ga0495634_0125441 | 3300046642 | Bacteria | 1641 |
| 567 | Ga0495634_0366636 | 3300046642 | Bacteria | 860 |
| 568 | Ga0495635_0247989 | 3300046663 | Bacteria | 1201 |
| 569 | Ga0495635_0658685 | 3300046663 | Bacteria | 681 |
| 570 | Ga0495657_0221813 | 3300046675 | Unclassified | 1146 |
| 571 | Ga0495599_0001804 | 3300046678 | Bacteria | 12423 |
| 572 | Ga0495646_0182913 | 3300046680 | Unclassified | 1149 |
| 573 | Ga0495646_0440409 | 3300046680 | Unclassified | 674 |
| 574 | Ga0495647_0640925 | 3300046681 | Bacteria | 500 |
| 575 | Ga0495658_0698873 | 3300046683 | Bacteria | 650 |
| 576 | Ga0495613_0232591 | 3300046689 | Bacteria | 1291 |
| 577 | Ga0495613_0621247 | 3300046689 | Bacteria | 717 |
| 578 | Ga0495624_0143716 | 3300046690 | Bacteria | 1461 |
| 579 | Ga0495589_0475399 | 3300046794 | Bacteria | 571 |
| 580 | Ga0495600_0240157 | 3300046809 | Unclassified | 1155 |
| 581 | Ga0495600_0711138 | 3300046809 | Bacteria | 604 |
| 582 | Ga0495581_0192240 | 3300047315 | Bacteria | 1194 |
| 583 | Ga0495604_0095982 | 3300047317 | Bacteria | 2189 |
| 584 | Ga0495674_0104295 | 3300047319 | Bacteria | 2410 |
| 585 | Ga0495674_0474888 | 3300047319 | Bacteria | 1003 |
| 586 | Ga0495674_0607734 | 3300047319 | Bacteria | 866 |
| 587 | Ga0495674_0670240 | 3300047319 | Bacteria | 816 |
| 588 | Ga0495680_0054931 | 3300047322 | Bacteria | 3090 |
| 589 | Ga0495680_0452233 | 3300047322 | Unclassified | 879 |
| 590 | Ga0495680_0821651 | 3300047322 | Bacteria | 606 |
| 591 | Ga0495680_0978601 | 3300047322 | Bacteria | 542 |
| 592 | Ga0495675_0042191 | 3300047444 | Bacteria | 2906 |
| 593 | Ga0495675_0384948 | 3300047444 | Unclassified | 820 |
| 594 | Ga0495684_0003489 | 3300047471 | Bacteria | 12308 |
| 595 | Ga0495614_0268410 | 3300048089 | Unclassified | 784 |
| 596 | Ga0496100_0157296 | 3300048903 | Bacteria | 1626 |
| 597 | Ga0496100_0298753 | 3300048903 | Unclassified | 1205 |
| 598 | Ga0496101_0764189 | 3300048904 | Unclassified | 762 |
| 599 | Ga0496102_0053634 | 3300048905 | Bacteria | 3675 |
| 600 | Ga0496103_0581976 | 3300048906 | Unclassified | 714 |
| 601 | Ga0496104_0100109 | 3300048907 | Unclassified | 2775 |
| 602 | Ga0496104_0289000 | 3300048907 | Unclassified | 1552 |
| 603 | Ga0496105_0036162 | 3300048908 | Unclassified | 4067 |
| 604 | Ga0496105_0232144 | 3300048908 | Bacteria | 1499 |
| 605 | Ga0496106_0216185 | 3300048909 | Bacteria | 1528 |
| 606 | Ga0496106_1300647 | 3300048909 | Unclassified | 564 |
| 607 | Ga0496107_1377515 | 3300048910 | Bacteria | 503 |
| 608 | Ga0496108_0078061 | 3300048911 | Bacteria | 2802 |
| 609 | Ga0496108_0642928 | 3300048911 | Bacteria | 922 |
| 610 | Ga0496109_0084963 | 3300048912 | Bacteria | 2920 |
| 611 | Ga0496109_0367202 | 3300048912 | Bacteria | 1359 |
| 612 | Ga0496109_0398426 | 3300048912 | Bacteria | 1300 |
| 613 | Ga0496109_0796768 | 3300048912 | Unclassified | 883 |
| 614 | Ga0496110_0097241 | 3300048913 | Bacteria | 2638 |
| 615 | Ga0496110_0798323 | 3300048913 | Unclassified | 848 |
| 616 | Ga0496110_0868425 | 3300048913 | Unclassified | 808 |
| 617 | Ga0496112_0044208 | 3300048915 | Unclassified | 4364 |
| 618 | Ga0496112_0747633 | 3300048915 | Unclassified | 904 |
| 619 | Ga0496113_0057140 | 3300048916 | Bacteria | 2931 |
| 620 | Ga0496113_0568868 | 3300048916 | Unclassified | 909 |
| 621 | Ga0496113_1299100 | 3300048916 | Unclassified | 566 |
| 622 | Ga0496113_1387717 | 3300048916 | Unclassified | 544 |
| 623 | Ga0496115_0055303 | 3300048918 | Bacteria | 3188 |
| 624 | Ga0496115_0228143 | 3300048918 | Bacteria | 1536 |
| 625 | Ga0496115_0393159 | 3300048918 | Unclassified | 1126 |
| 626 | Ga0501069_0222715 | 3300049585 | Bacteria | 1097 |
| 627 | nmdc:mga08y16_1480585_c1 | 3300050511 | Bacteria | 640 |
| 628 | nmdc:mga0n895_34388_c1 | 3300050512 | Bacteria | 4877 |
| 629 | nmdc:mga0n895_667836_c1 | 3300050512 | Unclassified | 1037 |
| 630 | nmdc:mga0rr50_575998_c1 | 3300050513 | Unclassified | 959 |
| 631 | nmdc:mga0rr50_590704_c1 | 3300050513 | Bacteria | 946 |
| 632 | nmdc:mga0rr50_745254_c1 | 3300050513 | Unclassified | 836 |
| 633 | nmdc:mga08x19_109300_c1 | 3300050514 | Bacteria | 1843 |
| 634 | nmdc:mga08x19_225756_c1 | 3300050514 | Bacteria | 1288 |
| 635 | nmdc:mga08x19_681508_c1 | 3300050514 | Unclassified | 729 |
| 636 | nmdc:mga0a205_270859_c1 | 3300050515 | Bacteria | 1575 |
| 637 | nmdc:mga0a205_580977_c1 | 3300050515 | Unclassified | 974 |
| 638 | Ga0495601_0013922 | 3300053077 | Unclassified | 4843 |
| 639 | Ga0495601_0038552 | 3300053077 | Bacteria | 2989 |
| 640 | Ga0495601_0501516 | 3300053077 | Bacteria | 783 |
| 641 | Ga0495601_1074361 | 3300053077 | Unclassified | 504 |
| 642 | Ga0495612_0367683 | 3300053078 | Bacteria | 651 |
| 643 | Ga0495655_0362102 | 3300053083 | Unclassified | 509 |
| 644 | Ga0495619_0103026 | 3300053085 | Bacteria | 1944 |
| 645 | Ga0495619_0320895 | 3300053085 | Unclassified | 1072 |
| 646 | Ga0500566_0214617 | 3300053094 | Bacteria | 961 |
| 647 | Ga0373946_0117395 | |||
| 648 | SwRhRL2b_contig_2073574 | |||
| 649 | 2214811066 | |||
| 650 | JGI24035J26624_1001174 | |||
| 651 | JGI24034J26672_10097338 | |||
| 652 | JGI25406J46586_10000044 | |||
| 653 | Ga0065714_10203058 | |||
| 654 | Ga0065704_10003796 | |||
| 655 | Ga0065704_10005317 | |||
| 656 | Ga0065704_10023571 | |||
| 657 | Ga0065712_10003013 | |||
| 658 | Ga0065712_10006829 | |||
| 659 | Ga0065712_10097236 | |||
| 660 | Ga0065712_10144200 | |||
| 661 | Ga0065712_10182336 | |||
| 662 | Ga0065712_10434718 | |||
| 663 | Ga0065712_10557702 | |||
| 664 | Ga0065712_10698016 | |||
| 665 | Ga0065715_10000511 | |||
| 666 | Ga0065715_10003784 | |||
| 667 | Ga0065715_10105598 | |||
| 668 | Ga0065715_10714144 | |||
| 669 | Ga0065715_10747754 | |||
| 670 | Ga0065707_10137564 | |||
| 671 | Ga0065707_11138091 | |||
| 672 | Ga0070658_10303768 | |||
| 673 | Ga0070676_10465127 | |||
| 674 | Ga0070676_10535356 | |||
| 675 | Ga0070676_11052991 | |||
| 676 | Ga0070683_100211259 | |||
| 677 | Ga0070683_101884360 | |||
| 678 | Ga0070690_100027281 | |||
| 679 | Ga0070690_100046737 | |||
| 680 | Ga0070670_101177538 | |||
| 681 | Ga0068869_100731059 | |||
| 682 | Ga0068869_102057592 | |||
| 683 | Ga0070666_10257423 | |||
| 684 | Ga0070680_100009840 | |||
| 685 | Ga0070682_100035277 | |||
| 686 | Ga0068868_100194988 | |||
| 687 | Ga0068868_100264569 | |||
| 688 | Ga0068868_101251721 | |||
| 689 | Ga0070689_100146604 | |||
| 690 | Ga0070691_10747537 | |||
| 691 | Ga0070687_100086116 | |||
| 692 | Ga0070687_100754150 | |||
| 693 | Ga0070668_101640887 | |||
| 694 | Ga0070669_100037801 | |||
| 695 | Ga0070669_100530691 | |||
| 696 | Ga0070675_100202378 | |||
| 697 | Ga0070671_100284892 | |||
| 698 | Ga0070671_100559591 | |||
| 699 | Ga0070671_101740815 | |||
| 700 | Ga0070674_100615599 | |||
| 701 | Ga0070674_101242781 | |||
| 702 | Ga0070674_101458605 | |||
| 703 | Ga0070673_100084819 | |||
| 704 | Ga0070673_100448323 | |||
| 705 | Ga0070673_101253074 | |||
| 706 | Ga0070688_100048866 | |||
| 707 | Ga0070659_100765113 | |||
| 708 | Ga0070659_101012428 | |||
| 709 | Ga0070659_101017664 | |||
| 710 | Ga0070667_100563658 | |||
| 711 | Ga0070709_10535041 | |||
| 712 | Ga0070714_100108440 | |||
| 713 | Ga0070714_100211144 | |||
| 714 | Ga0070714_100216430 | |||
| 715 | Ga0070714_100227434 | |||
| 716 | Ga0070713_100127255 | |||
| 717 | Ga0070713_100140079 | |||
| 718 | Ga0070713_100622158 | |||
| 719 | Ga0070713_100796438 | |||
| 720 | Ga0070713_101418363 | |||
| 721 | Ga0070710_10025637 | |||
| 722 | Ga0070710_10379250 | |||
| 723 | Ga0070710_10490179 | |||
| 724 | Ga0070710_10952575 | |||
| 725 | Ga0070711_100015241 | |||
| 726 | Ga0070711_100267983 | |||
| 727 | Ga0070711_100346437 | |||
| 728 | Ga0070711_100565569 | |||
| 729 | Ga0070711_101513031 | |||
| 730 | Ga0070705_100387829 | |||
| 731 | Ga0070705_100629828 | |||
| 732 | Ga0070705_101691075 | |||
| 733 | Ga0070700_100712585 | |||
| 734 | Ga0070694_100653623 | |||
| 735 | Ga0070708_100016655 | |||
| 736 | Ga0070708_100027244 | |||
| 737 | Ga0070708_100040302 | |||
| 738 | Ga0070708_100294531 | |||
| 739 | Ga0070708_100366781 | |||
| 740 | Ga0070708_100673728 | |||
| 741 | Ga0070708_100689425 | |||
| 742 | Ga0070708_100995546 | |||
| 743 | Ga0070708_101140184 | |||
| 744 | Ga0070708_101225130 | |||
| 745 | Ga0070708_101283933 | |||
| 746 | Ga0070708_101308013 | |||
| 747 | Ga0070708_101515315 | |||
| 748 | Ga0070708_101601348 | |||
| 749 | Ga0070708_101704396 | |||
| 750 | Ga0070708_102119720 | |||
| 751 | Ga0070663_100242651 | |||
| 752 | Ga0070678_100179070 | |||
| 753 | Ga0070678_100342116 | |||
| 754 | Ga0070662_100837940 | |||
| 755 | Ga0070662_100963457 | |||
| 756 | Ga0070662_101452658 | |||
| 757 | Ga0070681_10000041 | |||
| 758 | Ga0070681_10006765 | |||
| 759 | Ga0068867_101141195 | |||
| 760 | Ga0068867_102376095 | |||
| 761 | Ga0070706_100016203 | |||
| 762 | Ga0070706_100033749 | |||
| 763 | Ga0070706_100071533 | |||
| 764 | Ga0070706_100144711 | |||
| 765 | Ga0070706_100161438 | |||
| 766 | Ga0070706_100313851 | |||
| 767 | Ga0070706_100342287 | |||
| 768 | Ga0070706_100432446 | |||
| 769 | Ga0070706_100695514 | |||
| 770 | Ga0070706_101012384 | |||
| 771 | Ga0070706_101622878 | |||
| 772 | Ga0070707_100005775 | |||
| 773 | Ga0070707_100013069 | |||
| 774 | Ga0070707_100020702 | |||
| 775 | Ga0070707_100099388 | |||
| 776 | Ga0070707_100101537 | |||
| 777 | Ga0070707_100166171 | |||
| 778 | Ga0070707_100167250 | |||
| 779 | Ga0070707_100167518 | |||
| 780 | Ga0070707_100256186 | |||
| 781 | Ga0070707_100381304 | |||
| 782 | Ga0070707_100416287 | |||
| 783 | Ga0070707_100883729 | |||
| 784 | Ga0070707_101824042 | |||
| 785 | Ga0070707_101943222 | |||
| 786 | Ga0070698_100012337 | |||
| 787 | Ga0070698_100081393 | |||
| 788 | Ga0070698_100137101 | |||
| 789 | Ga0070698_100517896 | |||
| 790 | Ga0070698_101698414 | |||
| 791 | Ga0070698_102012821 | |||
| 792 | Ga0070698_102116674 | |||
| 793 | Ga0070699_100106256 | |||
| 794 | Ga0070699_100297803 | |||
| 795 | Ga0070699_100724759 | |||
| 796 | Ga0070699_100893034 | |||
| 797 | Ga0070699_100926454 | |||
| 798 | Ga0070699_101425506 | |||
| 799 | Ga0070679_100000074 | |||
| 800 | Ga0070679_100009577 | |||
| 801 | Ga0070679_101141995 | |||
| 802 | Ga0070684_100016086 | |||
| 803 | Ga0070684_100691411 | |||
| 804 | Ga0070697_100000699 | |||
| 805 | Ga0070697_100002030 | |||
| 806 | Ga0070697_100008913 | |||
| 807 | Ga0070697_100016984 | |||
| 808 | Ga0070697_100037087 | |||
| 809 | Ga0070697_100065708 | |||
| 810 | Ga0070697_100069405 | |||
| 811 | Ga0070697_100118428 | |||
| 812 | Ga0070697_100124538 | |||
| 813 | Ga0070697_100178498 | |||
| 814 | Ga0070697_100251413 | |||
| 815 | Ga0070697_100543350 | |||
| 816 | Ga0070697_100712025 | |||
| 817 | Ga0070697_100849716 | |||
| 818 | Ga0070697_101155927 | |||
| 819 | Ga0070697_101273705 | |||
| 820 | Ga0070697_101300815 | |||
| 821 | Ga0068853_102074736 | |||
| 822 | Ga0070672_100477183 | |||
| 823 | Ga0070672_101143816 | |||
| 824 | Ga0070686_100024620 | |||
| 825 | Ga0070686_100847825 | |||
| 826 | Ga0070695_100708191 | |||
| 827 | Ga0070695_101243426 | |||
| 828 | Ga0070696_101391240 | |||
| 829 | Ga0070696_101724953 | |||
| 830 | Ga0070693_100130903 | |||
| 831 | Ga0070693_100135391 | |||
| 832 | Ga0070665_100030843 | |||
| 833 | Ga0070665_100086844 | |||
| 834 | Ga0070665_100708212 | |||
| 835 | Ga0070704_100305928 | |||
| 836 | Ga0070704_101331038 | |||
| 837 | Ga0070704_101367655 | |||
| 838 | Ga0070664_100664541 | |||
| 839 | Ga0068854_100304731 | |||
| 840 | Ga0068856_100025652 | |||
| 841 | Ga0068856_100054202 | |||
| 842 | Ga0068856_100802776 | |||
| 843 | Ga0068856_100888750 | |||
| 844 | Ga0070702_100581306 | |||
| 845 | Ga0070702_100893313 | |||
| 846 | Ga0070702_101444108 | |||
| 847 | Ga0068852_100667054 | |||
| 848 | Ga0068859_102316012 | |||
| 849 | Ga0068864_101170209 | |||
| 850 | Ga0068866_10253497 | |||
| 851 | Ga0068866_10562276 | |||
| 852 | Ga0068861_100890829 | |||
| 853 | Ga0068863_100252730 | |||
| 854 | Ga0068863_100937877 | |||
| 855 | Ga0068858_100336727 | |||
| 856 | Ga0081455_10178172 | |||
| 857 | Ga0081455_10266799 | |||
| 858 | Ga0081539_10000673 | |||
| 859 | Ga0081539_10013013 | |||
| 860 | Ga0081539_10054994 | |||
| 861 | Ga0070717_10143510 | |||
| 862 | Ga0070717_10164322 | |||
| 863 | Ga0070717_10194991 | |||
| 864 | Ga0070717_10515864 | |||
| 865 | Ga0070717_10517820 | |||
| 866 | Ga0070717_10861103 | |||
| 867 | Ga0070717_11555564 | |||
| 868 | Ga0070717_11559128 | |||
| 869 | Ga0070717_11643328 | |||
| 870 | Ga0070717_11791077 | |||
| 871 | Ga0070717_12097821 | |||
| 872 | Ga0070715_10014359 | |||
| 873 | Ga0070715_10047255 | |||
| 874 | Ga0070715_10512378 | |||
| 875 | Ga0070715_10519781 | |||
| 876 | Ga0070716_100113182 | |||
| 877 | Ga0070716_100625806 | |||
| 878 | Ga0070716_101058150 | |||
| 879 | Ga0070716_101116190 | |||
| 880 | Ga0070716_101623468 | |||
| 881 | Ga0070712_100007387 | |||
| 882 | Ga0070712_100018384 | |||
| 883 | Ga0070712_100069026 | |||
| 884 | Ga0070712_100121374 | |||
| 885 | Ga0070712_100370005 | |||
| 886 | Ga0070712_100400984 | |||
| 887 | Ga0070712_100564455 | |||
| 888 | Ga0070712_100782466 | |||
| 889 | Ga0070712_100947308 | |||
| 890 | Ga0070712_101522833 | |||
| 891 | Ga0070712_101970699 | |||
| 892 | Ga0070712_101970700 | |||
| 893 | Ga0097621_100624015 | |||
| 894 | Ga0097621_100669614 | |||
| 895 | Ga0068871_100182695 | |||
| 896 | Ga0068871_101720784 | |||
| 897 | Ga0075428_101885887 | |||
| 898 | Ga0075433_10109009 | |||
| 899 | Ga0075433_10218147 | |||
| 900 | Ga0075433_11337854 | |||
| 901 | Ga0075434_100201419 | |||
| 902 | Ga0075434_100534293 | |||
| 903 | Ga0075434_101300403 | |||
| 904 | Ga0075434_101992265 | |||
| 905 | Ga0068865_101019053 | |||
| 906 | Ga0075436_100023411 | |||
| 907 | Ga0075436_100187032 | |||
| 908 | Ga0097620_102316241 | |||
| 909 | Ga0075435_100435579 | |||
| 910 | Ga0075435_100692124 | |||
| 911 | Ga0075435_100837888 | |||
| 912 | Ga0099794_10181734 | |||
| 913 | Ga0099795_10050037 | |||
| 914 | Ga0099795_10149256 | |||
| 915 | Ga0105251_10533850 | |||
| 916 | Ga0105240_10414625 | |||
| 917 | Ga0105240_10571586 | |||
| 918 | Ga0111539_11290008 | |||
| 919 | Ga0105245_10025427 | |||
| 920 | Ga0105245_10163458 | |||
| 921 | Ga0105245_11452139 | |||
| 922 | Ga0105245_11913201 | |||
| 923 | Ga0105247_10243401 | |||
| 924 | Ga0105247_11749608 | |||
| 925 | Ga0105243_10823030 | |||
| 926 | Ga0105241_10174179 | |||
| 927 | Ga0105241_11184570 | |||
| 928 | Ga0105241_11344132 | |||
| 929 | Ga0105242_10413443 | |||
| 930 | Ga0105242_10846795 | |||
| 931 | Ga0105248_10280862 | |||
| 932 | Ga0105248_11996715 | |||
| 933 | Ga0105237_11231812 | |||
| 934 | Ga0105237_12254214 | |||
| 935 | Ga0105238_12211132 | |||
| 936 | Ga0105249_10016066 | |||
| 937 | Ga0099796_10298383 | |||
| 938 | Ga0105239_10343100 | |||
| 939 | Ga0105239_10857960 | |||
| 940 | Ga0105239_11408166 | |||
| 941 | Ga0105239_11614269 | |||
| 942 | Ga0105239_13373129 | |||
| 943 | Ga0105246_10746108 | |||
| 944 | Ga0157373_10777940 | |||
| 945 | Ga0157373_11119884 | |||
| 946 | Ga0157371_10432221 | |||
| 947 | Ga0157370_10127105 | |||
| 948 | Ga0157369_10070271 | |||
| 949 | Ga0157374_10244141 | |||
| 950 | Ga0157374_10467545 | |||
| 951 | Ga0157374_10546111 | |||
| 952 | Ga0157374_11676330 | |||
| 953 | Ga0157374_12504954 | |||
| 954 | Ga0157378_10003020 | |||
| 955 | Ga0157378_10018210 | |||
| 956 | Ga0157378_10051876 | |||
| 957 | Ga0157378_10054621 | |||
| 958 | Ga0157378_10206438 | |||
| 959 | Ga0157378_10384983 | |||
| 960 | Ga0157378_11187472 | |||
| 961 | Ga0157378_12283259 | |||
| 962 | Ga0163162_10800448 | |||
| 963 | Ga0163162_13223494 | |||
| 964 | Ga0157372_10044158 | |||
| 965 | Ga0157372_10061558 | |||
| 966 | Ga0157372_10495990 | |||
| 967 | Ga0157372_12450599 | |||
| 968 | Ga0157372_12582865 | |||
| 969 | Ga0157375_10117560 | |||
| 970 | Ga0157375_12917836 | |||
| 971 | Ga0157375_13097711 | |||
| 972 | Ga0163163_10338062 | |||
| 973 | Ga0182008_10529086 | |||
| 974 | Ga0182008_10943984 | |||
| 975 | Ga0157377_10237046 | |||
| 976 | Ga0157379_10260246 | |||
| 977 | Ga0157379_10786358 | |||
| 978 | Ga0157376_10689202 | |||
| 979 | Ga0157376_11891997 | |||
| 980 | Ga0182006_1017981 | |||
| 981 | Ga0182007_10179804 | |||
| 982 | Ga0163161_10453620 | |||
| 983 | Ga0163161_10601660 | |||
| 984 | Ga0163161_11111305 | |||
| 985 | Ga0207666_1042320 | |||
| 986 | Ga0207673_1000733 | |||
| 987 | Ga0207673_1003628 | |||
| 988 | Ga0207697_10000970 | |||
| 989 | Ga0207697_10003616 | |||
| 990 | Ga0207697_10039079 | |||
| 991 | Ga0207692_10190492 | |||
| 992 | Ga0207692_10446228 | |||
| 993 | Ga0207692_10470130 | |||
| 994 | Ga0207692_11147254 | |||
| 995 | Ga0207642_10938920 | |||
| 996 | Ga0207710_10149810 | |||
| 997 | Ga0207688_10309136 | |||
| 998 | Ga0207680_10119112 | |||
| 999 | Ga0207685_10157748 | |||
| 1000 | Ga0207685_10176023 | |||
| 1001 | Ga0207685_10524097 | |||
| 1002 | Ga0207699_10077832 | |||
| 1003 | Ga0207699_10788664 | |||
| 1004 | Ga0207699_11103386 | |||
| 1005 | Ga0207645_10122503 | |||
| 1006 | Ga0207645_10307789 | |||
| 1007 | Ga0207645_10420407 | |||
| 1008 | Ga0207705_10146136 | |||
| 1009 | Ga0207684_10000318 | |||
| 1010 | Ga0207684_10003308 | |||
| 1011 | Ga0207684_10003816 | |||
| 1012 | Ga0207684_10022841 | |||
| 1013 | Ga0207684_10024201 | |||
| 1014 | Ga0207684_10034439 | |||
| 1015 | Ga0207684_10056581 | |||
| 1016 | Ga0207684_10302449 | |||
| 1017 | Ga0207684_10327335 | |||
| 1018 | Ga0207684_10443387 | |||
| 1019 | Ga0207684_11717616 | |||
| 1020 | Ga0207707_10000077 | |||
| 1021 | Ga0207707_10057924 | |||
| 1022 | Ga0207695_10342651 | |||
| 1023 | Ga0207695_10960953 | |||
| 1024 | Ga0207695_11689869 | |||
| 1025 | Ga0207671_11142471 | |||
| 1026 | Ga0207693_10013832 | |||
| 1027 | Ga0207693_10022513 | |||
| 1028 | Ga0207693_10030830 | |||
| 1029 | Ga0207693_10071760 | |||
| 1030 | Ga0207693_10133311 | |||
| 1031 | Ga0207693_10973634 | |||
| 1032 | Ga0207663_10017342 | |||
| 1033 | Ga0207663_10107923 | |||
| 1034 | Ga0207663_10145359 | |||
| 1035 | Ga0207663_10273721 | |||
| 1036 | Ga0207663_10664339 | |||
| 1037 | Ga0207660_10009434 | |||
| 1038 | Ga0207660_10499607 | |||
| 1039 | Ga0207662_10128107 | |||
| 1040 | Ga0207662_10790119 | |||
| 1041 | Ga0207657_10330546 | |||
| 1042 | Ga0207649_10016598 | |||
| 1043 | Ga0207652_10000096 | |||
| 1044 | Ga0207652_10237799 | |||
| 1045 | Ga0207646_10010847 | |||
| 1046 | Ga0207646_10011354 | |||
| 1047 | Ga0207646_10076094 | |||
| 1048 | Ga0207646_10086243 | |||
| 1049 | Ga0207646_10116626 | |||
| 1050 | Ga0207646_10142901 | |||
| 1051 | Ga0207646_10171838 | |||
| 1052 | Ga0207646_10287784 | |||
| 1053 | Ga0207646_10697213 | |||
| 1054 | Ga0207646_11480260 | |||
| 1055 | Ga0207646_11495276 | |||
| 1056 | Ga0207646_11579576 | |||
| 1057 | Ga0207646_11863166 | |||
| 1058 | Ga0207681_10052070 | |||
| 1059 | Ga0207650_10337111 | |||
| 1060 | Ga0207659_10343601 | |||
| 1061 | Ga0207687_10138282 | |||
| 1062 | Ga0207687_10226701 | |||
| 1063 | Ga0207687_10286737 | |||
| 1064 | Ga0207700_10092241 | |||
| 1065 | Ga0207700_10124851 | |||
| 1066 | Ga0207700_10494014 | |||
| 1067 | Ga0207700_11776287 | |||
| 1068 | Ga0207664_10020094 | |||
| 1069 | Ga0207664_10120284 | |||
| 1070 | Ga0207664_10363625 | |||
| 1071 | Ga0207664_10529931 | |||
| 1072 | Ga0207664_10622024 | |||
| 1073 | Ga0207664_10643609 | |||
| 1074 | Ga0207664_11313303 | |||
| 1075 | Ga0207644_10398330 | |||
| 1076 | Ga0207690_11052528 | |||
| 1077 | Ga0207706_10467568 | |||
| 1078 | Ga0207706_10512223 | |||
| 1079 | Ga0207706_10834778 | |||
| 1080 | Ga0207706_11241952 | |||
| 1081 | Ga0207686_10396084 | |||
| 1082 | Ga0207670_10027947 | |||
| 1083 | Ga0207669_10420167 | |||
| 1084 | Ga0207669_10911486 | |||
| 1085 | Ga0207669_11228599 | |||
| 1086 | Ga0207704_10664044 | |||
| 1087 | Ga0207665_10018808 | |||
| 1088 | Ga0207665_10142038 | |||
| 1089 | Ga0207665_10201363 | |||
| 1090 | Ga0207665_11284723 | |||
| 1091 | Ga0207691_10019193 | |||
| 1092 | Ga0207711_10809482 | |||
| 1093 | Ga0207711_11840443 | |||
| 1094 | Ga0207689_10872462 | |||
| 1095 | Ga0207689_11577999 | |||
| 1096 | Ga0207661_10021589 | |||
| 1097 | Ga0207679_10696625 | |||
| 1098 | Ga0207679_12203702 | |||
| 1099 | Ga0207651_10032412 | |||
| 1100 | Ga0207651_10983833 | |||
| 1101 | Ga0207668_10536394 | |||
| 1102 | Ga0207640_10534922 | |||
| 1103 | Ga0207640_11623934 | |||
| 1104 | Ga0207658_10587107 | |||
| 1105 | Ga0207677_10189840 | |||
| 1106 | Ga0207677_10516718 | |||
| 1107 | Ga0207677_11217688 | |||
| 1108 | Ga0207703_10185550 | |||
| 1109 | Ga0207703_10649200 | |||
| 1110 | Ga0207639_10157024 | |||
| 1111 | Ga0207678_10175375 | |||
| 1112 | Ga0207708_10195336 | |||
| 1113 | Ga0207702_10135720 | |||
| 1114 | Ga0207702_11111989 | |||
| 1115 | Ga0207702_11207428 | |||
| 1116 | Ga0207641_10493084 | |||
| 1117 | Ga0207641_11172902 | |||
| 1118 | Ga0207648_10327523 | |||
| 1119 | Ga0207648_12132127 | |||
| 1120 | Ga0207676_10293413 | |||
| 1121 | Ga0207676_11073974 | |||
| 1122 | Ga0207675_100597528 | |||
| 1123 | Ga0207683_10020144 | |||
| 1124 | Ga0207698_10547378 | |||
| 1125 | Ga0210002_1045346 | |||
| 1126 | Ga0207428_10866155 | |||
| 1127 | Ga0268266_10018166 | |||
| 1128 | Ga0268266_10089283 | |||
| 1129 | Ga0268266_11092421 | |||
| 1130 | Ga0268264_10593202 | |||
| 1131 | Ga0268264_10986224 | |||
| 1132 | Ga0373923_0236299 | |||
| 1133 | Ga0373923_0498672 | |||
| 1134 | Ga0373945_0067226 | |||
| 1135 | Ga0373953_0176358 | |||
| 1136 | Ga0373954_0557656 | |||
| 1137 | Ga0373956_0046750 | |||
| 1138 | Ga0373943_0040392 | |||
| 1139 | Ga0373943_0297775 | |||
| 1140 | Ga0373943_0579641 | |||
| 1141 | Ga0373946_0047514 | |||
| 1142 | Ga0373955_0801254 | |||
| 1143 | Ga0373935_0044854 | |||
| 1144 | Ga0373935_0050261 | |||
| 1145 | Ga0373935_0152677 | |||
| 1146 | Ga0373927_0139211 | |||
| 1147 | Ga0373927_0175879 | |||
| 1148 | Ga0373933_0260665 | |||
| 1149 | Ga0373933_0443645 | |||
| 1150 | Ga0373947_0020927 | |||
| 1151 | Ga0373947_0021063 | |||
| 1152 | Ga0373947_0038395 | |||
| 1153 | Ga0373947_0308058 | |||
| 1154 | Ga0373947_0700845 | |||
| 1155 | Ga0373937_0117309 | |||
| 1156 | Ga0373937_0336461 | |||
| 1157 | Ga0373937_1178528 | |||
| 1158 | Ga0373937_1951627 | |||
| 1159 | Ga0373925_0322958 | |||
| 1160 | Ga0395900_0316335 | |||
| 1161 | Ga0395900_0498243 | |||
| 1162 | Ga0395900_0769720 | |||
| 1163 | Ga0395898_0846974 | |||
| 1164 | Ga0395905_0215382 | |||
| 1165 | Ga0395905_0869682 | |||
| 1166 | Ga0395901_0621744 | |||
| 1167 | Ga0395901_0936006 | |||
| 1168 | Ga0395901_1158587 | |||
| 1169 | Ga0436360_0449468 | |||
| 1170 | Ga0451798_0091717 | |||
| 1171 | Ga0451802_0624474 | |||
| 1172 | Ga0451804_0024167 | |||
| 1173 | Ga0451807_2175110 | |||
| 1174 | Ga0451835_0452261 | |||
| 1175 | Ga0451849_0508029 | |||
| 1176 | Ga0451853_1768930 | |||
| 1177 | Ga0439454_007948 | |||
| 1178 | Ga0495592_0046937 | |||
| 1179 | Ga0495592_0370170 | |||
| 1180 | Ga0495603_0202930 | |||
| 1181 | Ga0495629_0590470 | |||
| 1182 | Ga0495629_0932284 | |||
| 1183 | Ga0495641_0113161 | |||
| 1184 | Ga0495651_0204194 | |||
| 1185 | Ga0495651_0867043 | |||
| 1186 | Ga0495653_0653852 | |||
| 1187 | Ga0495653_0729640 | |||
| 1188 | Ga0495580_0659833 | |||
| 1189 | Ga0495582_0237880 | |||
| 1190 | Ga0495662_0172818 | |||
| 1191 | Ga0495584_0391848 | |||
| 1192 | Ga0495594_0447221 | |||
| 1193 | Ga0495608_0632180 | |||
| 1194 | Ga0495618_0866566 | |||
| 1195 | Ga0495628_0021587 | |||
| 1196 | Ga0495628_0939109 | |||
| 1197 | Ga0495630_0049181 | |||
| 1198 | Ga0495630_0235592 | |||
| 1199 | Ga0495630_0964610 | |||
| 1200 | Ga0495630_1048664 | |||
| 1201 | Ga0495666_0163448 | |||
| 1202 | Ga0495666_0384342 | |||
| 1203 | Ga0495652_0098026 | |||
| 1204 | Ga0495652_0251826 | |||
| 1205 | Ga0495665_0405940 | |||
| 1206 | Ga0495640_0656061 | |||
| 1207 | Ga0495586_0009505 | |||
| 1208 | Ga0495587_0294936 | |||
| 1209 | Ga0495645_0006846 | |||
| 1210 | Ga0495667_0602558 | |||
| 1211 | Ga0495667_0869575 | |||
| 1212 | Ga0495634_0125441 | |||
| 1213 | Ga0495634_0366636 | |||
| 1214 | Ga0495635_0247989 | |||
| 1215 | Ga0495635_0658685 | |||
| 1216 | Ga0495657_0221813 | |||
| 1217 | Ga0495599_0001804 | |||
| 1218 | Ga0495646_0182913 | |||
| 1219 | Ga0495646_0440409 | |||
| 1220 | Ga0495647_0640925 | |||
| 1221 | Ga0495658_0698873 | |||
| 1222 | Ga0495613_0232591 | |||
| 1223 | Ga0495613_0621247 | |||
| 1224 | Ga0495624_0143716 | |||
| 1225 | Ga0495589_0475399 | |||
| 1226 | Ga0495600_0240157 | |||
| 1227 | Ga0495600_0711138 | |||
| 1228 | Ga0495581_0192240 | |||
| 1229 | Ga0495604_0095982 | |||
| 1230 | Ga0495674_0104295 | |||
| 1231 | Ga0495674_0474888 | |||
| 1232 | Ga0495674_0607734 | |||
| 1233 | Ga0495674_0670240 | |||
| 1234 | Ga0495680_0054931 | |||
| 1235 | Ga0495680_0452233 | |||
| 1236 | Ga0495680_0821651 | |||
| 1237 | Ga0495680_0978601 | |||
| 1238 | Ga0495675_0042191 | |||
| 1239 | Ga0495675_0384948 | |||
| 1240 | Ga0495684_0003489 | |||
| 1241 | Ga0495614_0268410 | |||
| 1242 | Ga0496100_0157296 | |||
| 1243 | Ga0496100_0298753 | |||
| 1244 | Ga0496101_0764189 | |||
| 1245 | Ga0496102_0053634 | |||
| 1246 | Ga0496103_0581976 | |||
| 1247 | Ga0496104_0100109 | |||
| 1248 | Ga0496104_0289000 | |||
| 1249 | Ga0496105_0036162 | |||
| 1250 | Ga0496105_0232144 | |||
| 1251 | Ga0496106_0216185 | |||
| 1252 | Ga0496106_1300647 | |||
| 1253 | Ga0496107_1377515 | |||
| 1254 | Ga0496108_0078061 | |||
| 1255 | Ga0496108_0642928 | |||
| 1256 | Ga0496109_0084963 | |||
| 1257 | Ga0496109_0367202 | |||
| 1258 | Ga0496109_0398426 | |||
| 1259 | Ga0496109_0796768 | |||
| 1260 | Ga0496110_0097241 | |||
| 1261 | Ga0496110_0798323 | |||
| 1262 | Ga0496110_0868425 | |||
| 1263 | Ga0496112_0044208 | |||
| 1264 | Ga0496112_0747633 | |||
| 1265 | Ga0496113_0057140 | |||
| 1266 | Ga0496113_0568868 | |||
| 1267 | Ga0496113_1299100 | |||
| 1268 | Ga0496113_1387717 | |||
| 1269 | Ga0496115_0055303 | |||
| 1270 | Ga0496115_0228143 | |||
| 1271 | Ga0496115_0393159 | |||
| 1272 | Ga0501069_0222715 | |||
| 1273 | nmdc:mga08y16_1480585_c1 | |||
| 1274 | nmdc:mga0n895_34388_c1 | |||
| 1275 | nmdc:mga0n895_667836_c1 | |||
| 1276 | nmdc:mga0rr50_575998_c1 | |||
| 1277 | nmdc:mga0rr50_590704_c1 | |||
| 1278 | nmdc:mga0rr50_745254_c1 | |||
| 1279 | nmdc:mga08x19_109300_c1 | |||
| 1280 | nmdc:mga08x19_225756_c1 | |||
| 1281 | nmdc:mga08x19_681508_c1 | |||
| 1282 | nmdc:mga0a205_270859_c1 | |||
| 1283 | nmdc:mga0a205_580977_c1 | |||
| 1284 | Ga0495601_0013922 | |||
| 1285 | Ga0495601_0038552 | |||
| 1286 | Ga0495601_0501516 | |||
| 1287 | Ga0495601_1074361 | |||
| 1288 | Ga0495612_0367683 | |||
| 1289 | Ga0495655_0362102 | |||
| 1290 | Ga0495619_0103026 | |||
| 1291 | Ga0495619_0320895 | |||
| 1292 | Ga0500566_0214617 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2owy-assembly1.cif.gz_B | the recombination-associated protein rdgc adopts a novel toroidal architecture for dna binding | 0.8174 | 27 | 56 |
| 5mlq-assembly1.cif.gz_B | structure of cdps from nocardia brasiliensis | 0.7454 | 28 | 57 |
| 4q16-assembly1.cif.gz_B | structure of nad+ synthetase from deinococcus radiodurans | 0.74 | 25 | 55 |
| 4q16-assembly2.cif.gz_D | structure of nad+ synthetase from deinococcus radiodurans | 0.7357 | 25 | 55 |
| 4q16-assembly2.cif.gz_C | structure of nad+ synthetase from deinococcus radiodurans | 0.7165 | 25 | 55 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0EJH6_1_248_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.9031 | 28 | 56 | 1.20.1740.10 |
| af_A0A368UKA6_43_470_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8449 | 29 | 56 | 1.20.1740.10 |
| 1xktB02 | Mainly Alpha;Orthogonal Bundle;Protein Yjbj; Chain: A;;Fatty acid synthase; domain 2 | 0.7675 | 25 | 57 | 1.10.1470.20 |
| af_O01883_24_322_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.7365 | 27 | 57 | 1.50.40.10 |
| 2hszB02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.6707 | 28 | 57 | 1.10.150.240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1L045-F1-model_v4 | Uncharacterized protein | 0.9962 | 27 | 56 |
|
| AF-A0A7J9XD48-F1-model_v4 | DUF1059 domain-containing protein | 0.996 | 4 | 60 |
|
| AF-A0A2V7YZ35-F1-model_v4 | DUF1059 domain-containing protein | 0.9903 | 1 | 62 |
|
| AF-A0A2V5PHA8-F1-model_v4 | DUF1059 domain-containing protein | 0.9854 | 5 | 63 |
|
| AF-A0A2V6I0I8-F1-model_v4 | DUF1059 domain-containing protein | 0.979 | 3 | 63 |
|