F472207

General Info

Members Datasets Scaffolds Average Seq Length
646 277 1292 63

Family's Representative Sequence

Representative Sequence 3300035171|Ga0373946_0117395|Ga0373946_0117395_937_1170
Length 77
Sequence LECGGLTPLFEKEASMAQRKSIDCRDYPSEKNCSLKISGTEDEVLDAAVQHAASAHGHENTPELRDQVKSMLKDDSD

Samples

Sample ID Description Type Environment
1 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
205 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
206 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
209 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 5.26
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 42.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373946_0117395 3300035171 Viruses 1211
2 SwRhRL2b_contig_2073574 2162886007 Bacteria 3223
3 2214811066 2209111006 Bacteria 685
4 JGI24035J26624_1001174 3300002126 Bacteria 2485
5 JGI24034J26672_10097338 3300002239 Unclassified 551
6 JGI25406J46586_10000044 3300003203 Bacteria 55845
7 Ga0065714_10203058 3300005288 Bacteria 889
8 Ga0065704_10003796 3300005289 Bacteria 3792
9 Ga0065704_10005317 3300005289 Bacteria 2936
10 Ga0065704_10023571 3300005289 Unclassified 1169
11 Ga0065712_10003013 3300005290 Bacteria 4860
12 Ga0065712_10006829 3300005290 Unclassified 3851
13 Ga0065712_10097236 3300005290 Bacteria 2157
14 Ga0065712_10144200 3300005290 Unclassified 1423
15 Ga0065712_10182336 3300005290 Unclassified 1140
16 Ga0065712_10434718 3300005290 Unclassified 700
17 Ga0065712_10557702 3300005290 Bacteria 613
18 Ga0065712_10698016 3300005290 Unclassified 548
19 Ga0065715_10000511 3300005293 Bacteria 10778
20 Ga0065715_10003784 3300005293 Bacteria 3838
21 Ga0065715_10105598 3300005293 Bacteria 2882
22 Ga0065715_10714144 3300005293 Bacteria 582
23 Ga0065715_10747754 3300005293 Bacteria 613
24 Ga0065707_10137564 3300005295 Bacteria 1818
25 Ga0065707_11138091 3300005295 Unclassified 507
26 Ga0070658_10303768 3300005327 Unclassified 1361
27 Ga0070676_10465127 3300005328 Unclassified 892
28 Ga0070676_10535356 3300005328 Unclassified 836
29 Ga0070676_11052991 3300005328 Unclassified 613
30 Ga0070683_100211259 3300005329 Unclassified 1843
31 Ga0070683_101884360 3300005329 Unclassified 575
32 Ga0070690_100027281 3300005330 Bacteria 3529
33 Ga0070690_100046737 3300005330 Unclassified 2753
34 Ga0070670_101177538 3300005331 Unclassified 700
35 Ga0068869_100731059 3300005334 Unclassified 846
36 Ga0068869_102057592 3300005334 Unclassified 513
37 Ga0070666_10257423 3300005335 Bacteria 1237
38 Ga0070680_100009840 3300005336 Bacteria 7359
39 Ga0070682_100035277 3300005337 Unclassified 3053
40 Ga0068868_100194988 3300005338 Unclassified 1686
41 Ga0068868_100264569 3300005338 Unclassified 1451
42 Ga0068868_101251721 3300005338 Unclassified 688
43 Ga0070689_100146604 3300005340 Bacteria 1901
44 Ga0070691_10747537 3300005341 Unclassified 591
45 Ga0070687_100086116 3300005343 Bacteria 1726
46 Ga0070687_100754150 3300005343 Bacteria 685
47 Ga0070668_101640887 3300005347 Unclassified 590
48 Ga0070669_100037801 3300005353 Bacteria 3502
49 Ga0070669_100530691 3300005353 Bacteria 979
50 Ga0070675_100202378 3300005354 Unclassified 1724
51 Ga0070671_100284892 3300005355 Bacteria 1406
52 Ga0070671_100559591 3300005355 Bacteria 986
53 Ga0070671_101740815 3300005355 Bacteria 553
54 Ga0070674_100615599 3300005356 Unclassified 919
55 Ga0070674_101242781 3300005356 Unclassified 662
56 Ga0070674_101458605 3300005356 Unclassified 614
57 Ga0070673_100084819 3300005364 Bacteria 2577
58 Ga0070673_100448323 3300005364 Unclassified 1160
59 Ga0070673_101253074 3300005364 Unclassified 696
60 Ga0070688_100048866 3300005365 Bacteria 2630
61 Ga0070659_100765113 3300005366 Bacteria 838
62 Ga0070659_101012428 3300005366 Bacteria 730
63 Ga0070659_101017664 3300005366 Unclassified 728
64 Ga0070667_100563658 3300005367 Unclassified 1048
65 Ga0070709_10535041 3300005434 Bacteria 895
66 Ga0070714_100108440 3300005435 Unclassified 2455
67 Ga0070714_100211144 3300005435 Bacteria 1779
68 Ga0070714_100216430 3300005435 Unclassified 1758
69 Ga0070714_100227434 3300005435 Bacteria 1717
70 Ga0070713_100127255 3300005436 Bacteria 2242
71 Ga0070713_100140079 3300005436 Unclassified 2142
72 Ga0070713_100622158 3300005436 Bacteria 1027
73 Ga0070713_100796438 3300005436 Bacteria 906
74 Ga0070713_101418363 3300005436 Bacteria 674
75 Ga0070710_10025637 3300005437 Bacteria 3124
76 Ga0070710_10379250 3300005437 Unclassified 943
77 Ga0070710_10490179 3300005437 Bacteria 840
78 Ga0070710_10952575 3300005437 Unclassified 623
79 Ga0070711_100015241 3300005439 Unclassified 4864
80 Ga0070711_100267983 3300005439 Bacteria 1346
81 Ga0070711_100346437 3300005439 Unclassified 1193
82 Ga0070711_100565569 3300005439 Bacteria 945
83 Ga0070711_101513031 3300005439 Unclassified 586
84 Ga0070705_100387829 3300005440 Unclassified 1030
85 Ga0070705_100629828 3300005440 Bacteria 834
86 Ga0070705_101691075 3300005440 Unclassified 534
87 Ga0070700_100712585 3300005441 Bacteria 799
88 Ga0070694_100653623 3300005444 Bacteria 851
89 Ga0070708_100016655 3300005445 Bacteria 6107
90 Ga0070708_100027244 3300005445 Bacteria 4902
91 Ga0070708_100040302 3300005445 Bacteria 4090
92 Ga0070708_100294531 3300005445 Bacteria 1528
93 Ga0070708_100366781 3300005445 Bacteria 1357
94 Ga0070708_100673728 3300005445 Unclassified 974
95 Ga0070708_100689425 3300005445 Unclassified 962
96 Ga0070708_100995546 3300005445 Unclassified 786
97 Ga0070708_101140184 3300005445 Unclassified 730
98 Ga0070708_101225130 3300005445 Unclassified 702
99 Ga0070708_101283933 3300005445 Unclassified 684
100 Ga0070708_101308013 3300005445 Bacteria 677
101 Ga0070708_101515315 3300005445 Bacteria 625
102 Ga0070708_101601348 3300005445 Bacteria 606
103 Ga0070708_101704396 3300005445 Unclassified 586
104 Ga0070708_102119720 3300005445 Unclassified 520
105 Ga0070663_100242651 3300005455 Bacteria 1423
106 Ga0070678_100179070 3300005456 Unclassified 1734
107 Ga0070678_100342116 3300005456 Bacteria 1284
108 Ga0070662_100837940 3300005457 Unclassified 783
109 Ga0070662_100963457 3300005457 Bacteria 729
110 Ga0070662_101452658 3300005457 Bacteria 591
111 Ga0070681_10000041 3300005458 Bacteria 89178
112 Ga0070681_10006765 3300005458 Bacteria 11161
113 Ga0068867_101141195 3300005459 Bacteria 713
114 Ga0068867_102376095 3300005459 Unclassified 504
115 Ga0070706_100016203 3300005467 Bacteria 6884
116 Ga0070706_100033749 3300005467 Bacteria 4725
117 Ga0070706_100071533 3300005467 Bacteria 3208
118 Ga0070706_100144711 3300005467 Unclassified 2220
119 Ga0070706_100161438 3300005467 Bacteria 2093
120 Ga0070706_100313851 3300005467 Bacteria 1462
121 Ga0070706_100342287 3300005467 Bacteria 1394
122 Ga0070706_100432446 3300005467 Bacteria 1225
123 Ga0070706_100695514 3300005467 Unclassified 943
124 Ga0070706_101012384 3300005467 Unclassified 766
125 Ga0070706_101622878 3300005467 Unclassified 590
126 Ga0070707_100005775 3300005468 Bacteria 11540
127 Ga0070707_100013069 3300005468 Bacteria 7758
128 Ga0070707_100020702 3300005468 Bacteria 6207
129 Ga0070707_100099388 3300005468 Unclassified 2819
130 Ga0070707_100101537 3300005468 Bacteria 2788
131 Ga0070707_100166171 3300005468 Bacteria 2150
132 Ga0070707_100167250 3300005468 Unclassified 2143
133 Ga0070707_100167518 3300005468 Bacteria 2141
134 Ga0070707_100256186 3300005468 Bacteria 1703
135 Ga0070707_100381304 3300005468 Bacteria 1369
136 Ga0070707_100416287 3300005468 Bacteria 1304
137 Ga0070707_100883729 3300005468 Bacteria 858
138 Ga0070707_101824042 3300005468 Unclassified 575
139 Ga0070707_101943222 3300005468 Bacteria 556
140 Ga0070698_100012337 3300005471 Bacteria 9049
141 Ga0070698_100081393 3300005471 Bacteria 3232
142 Ga0070698_100137101 3300005471 Bacteria 2400
143 Ga0070698_100517896 3300005471 Unclassified 1131
144 Ga0070698_101698414 3300005471 Unclassified 584
145 Ga0070698_102012821 3300005471 Bacteria 531
146 Ga0070698_102116674 3300005471 Bacteria 516
147 Ga0070699_100106256 3300005518 Unclassified 2462
148 Ga0070699_100297803 3300005518 Bacteria 1447
149 Ga0070699_100724759 3300005518 Bacteria 909
150 Ga0070699_100893034 3300005518 Bacteria 814
151 Ga0070699_100926454 3300005518 Unclassified 798
152 Ga0070699_101425506 3300005518 Bacteria 635
153 Ga0070679_100000074 3300005530 Bacteria 74890
154 Ga0070679_100009577 3300005530 Bacteria 9161
155 Ga0070679_101141995 3300005530 Unclassified 724
156 Ga0070684_100016086 3300005535 Bacteria 6110
157 Ga0070684_100691411 3300005535 Bacteria 951
158 Ga0070697_100000699 3300005536 Bacteria 25148
159 Ga0070697_100002030 3300005536 Bacteria 15491
160 Ga0070697_100008913 3300005536 Bacteria 7837
161 Ga0070697_100016984 3300005536 Bacteria 5721
162 Ga0070697_100037087 3300005536 Unclassified 3937
163 Ga0070697_100065708 3300005536 Unclassified 2965
164 Ga0070697_100069405 3300005536 Bacteria 2886
165 Ga0070697_100118428 3300005536 Bacteria 2213
166 Ga0070697_100124538 3300005536 Bacteria 2158
167 Ga0070697_100178498 3300005536 Bacteria 1799
168 Ga0070697_100251413 3300005536 Bacteria 1512
169 Ga0070697_100543350 3300005536 Unclassified 1019
170 Ga0070697_100712025 3300005536 Bacteria 886
171 Ga0070697_100849716 3300005536 Unclassified 808
172 Ga0070697_101155927 3300005536 Unclassified 689
173 Ga0070697_101273705 3300005536 Bacteria 656
174 Ga0070697_101300815 3300005536 Unclassified 648
175 Ga0068853_102074736 3300005539 Unclassified 551
176 Ga0070672_100477183 3300005543 Unclassified 1077
177 Ga0070672_101143816 3300005543 Unclassified 692
178 Ga0070686_100024620 3300005544 Bacteria 3610
179 Ga0070686_100847825 3300005544 Bacteria 740
180 Ga0070695_100708191 3300005545 Bacteria 800
181 Ga0070695_101243426 3300005545 Unclassified 614
182 Ga0070696_101391240 3300005546 Unclassified 598
183 Ga0070696_101724953 3300005546 Unclassified 540
184 Ga0070693_100130903 3300005547 Bacteria 1568
185 Ga0070693_100135391 3300005547 Bacteria 1545
186 Ga0070665_100030843 3300005548 Bacteria 5396
187 Ga0070665_100086844 3300005548 Unclassified 3133
188 Ga0070665_100708212 3300005548 Unclassified 1020
189 Ga0070704_100305928 3300005549 Bacteria 1326
190 Ga0070704_101331038 3300005549 Bacteria 658
191 Ga0070704_101367655 3300005549 Unclassified 649
192 Ga0070664_100664541 3300005564 Unclassified 969
193 Ga0068854_100304731 3300005578 Bacteria 1290
194 Ga0068856_100025652 3300005614 Bacteria 5747
195 Ga0068856_100054202 3300005614 Unclassified 3954
196 Ga0068856_100802776 3300005614 Unclassified 961
197 Ga0068856_100888750 3300005614 Unclassified 910
198 Ga0070702_100581306 3300005615 Unclassified 836
199 Ga0070702_100893313 3300005615 Bacteria 695
200 Ga0070702_101444108 3300005615 Bacteria 564
201 Ga0068852_100667054 3300005616 Unclassified 1048
202 Ga0068859_102316012 3300005617 Unclassified 592
203 Ga0068864_101170209 3300005618 Unclassified 767
204 Ga0068866_10253497 3300005718 Bacteria 1078
205 Ga0068866_10562276 3300005718 Unclassified 764
206 Ga0068861_100890829 3300005719 Unclassified 842
207 Ga0068863_100252730 3300005841 Unclassified 1703
208 Ga0068863_100937877 3300005841 Bacteria 867
209 Ga0068858_100336727 3300005842 Unclassified 1444
210 Ga0081455_10178172 3300005937 Bacteria 1612
211 Ga0081455_10266799 3300005937 Unclassified 1244
212 Ga0081539_10000673 3300005985 Bacteria 68473
213 Ga0081539_10013013 3300005985 Bacteria 6318
214 Ga0081539_10054994 3300005985 Bacteria 2217
215 Ga0070717_10143510 3300006028 Bacteria 2061
216 Ga0070717_10164322 3300006028 Unclassified 1928
217 Ga0070717_10194991 3300006028 Bacteria 1771
218 Ga0070717_10515864 3300006028 Unclassified 1081
219 Ga0070717_10517820 3300006028 Unclassified 1079
220 Ga0070717_10861103 3300006028 Unclassified 825
221 Ga0070717_11555564 3300006028 Unclassified 600
222 Ga0070717_11559128 3300006028 Unclassified 599
223 Ga0070717_11643328 3300006028 Unclassified 582
224 Ga0070717_11791077 3300006028 Unclassified 555
225 Ga0070717_12097821 3300006028 Unclassified 509
226 Ga0070715_10014359 3300006163 Bacteria 2931
227 Ga0070715_10047255 3300006163 Unclassified 1833
228 Ga0070715_10512378 3300006163 Unclassified 689
229 Ga0070715_10519781 3300006163 Unclassified 685
230 Ga0070716_100113182 3300006173 Bacteria 1685
231 Ga0070716_100625806 3300006173 Bacteria 813
232 Ga0070716_101058150 3300006173 Unclassified 645
233 Ga0070716_101116190 3300006173 Unclassified 629
234 Ga0070716_101623468 3300006173 Bacteria 531
235 Ga0070712_100007387 3300006175 Bacteria 6855
236 Ga0070712_100018384 3300006175 Bacteria 4540
237 Ga0070712_100069026 3300006175 Bacteria 2520
238 Ga0070712_100121374 3300006175 Bacteria 1967
239 Ga0070712_100370005 3300006175 Unclassified 1177
240 Ga0070712_100400984 3300006175 Bacteria 1133
241 Ga0070712_100564455 3300006175 Bacteria 960
242 Ga0070712_100782466 3300006175 Bacteria 818
243 Ga0070712_100947308 3300006175 Unclassified 743
244 Ga0070712_101522833 3300006175 Unclassified 585
245 Ga0070712_101970699 3300006175 Unclassified 511
246 Ga0070712_101970700 3300006175 Unclassified 511
247 Ga0097621_100624015 3300006237 Bacteria 987
248 Ga0097621_100669614 3300006237 Unclassified 953
249 Ga0068871_100182695 3300006358 Bacteria 1803
250 Ga0068871_101720784 3300006358 Bacteria 595
251 Ga0075428_101885887 3300006844 Unclassified 621
252 Ga0075433_10109009 3300006852 Unclassified 2456
253 Ga0075433_10218147 3300006852 Unclassified 1695
254 Ga0075433_11337854 3300006852 Unclassified 620
255 Ga0075434_100201419 3300006871 Bacteria 2011
256 Ga0075434_100534293 3300006871 Bacteria 1193
257 Ga0075434_101300403 3300006871 Unclassified 738
258 Ga0075434_101992265 3300006871 Unclassified 586
259 Ga0068865_101019053 3300006881 Bacteria 726
260 Ga0075436_100023411 3300006914 Bacteria 4242
261 Ga0075436_100187032 3300006914 Bacteria 1465
262 Ga0097620_102316241 3300006931 Unclassified 592
263 Ga0075435_100435579 3300007076 Bacteria 1130
264 Ga0075435_100692124 3300007076 Unclassified 886
265 Ga0075435_100837888 3300007076 Unclassified 801
266 Ga0099794_10181734 3300007265 Bacteria 1074
267 Ga0099795_10050037 3300007788 Bacteria 1518
268 Ga0099795_10149256 3300007788 Bacteria 956
269 Ga0105251_10533850 3300009011 Bacteria 551
270 Ga0105240_10414625 3300009093 Bacteria 1514
271 Ga0105240_10571586 3300009093 Bacteria 1248
272 Ga0111539_11290008 3300009094 Bacteria 848
273 Ga0105245_10025427 3300009098 Bacteria 5208
274 Ga0105245_10163458 3300009098 Unclassified 2114
275 Ga0105245_11452139 3300009098 Bacteria 736
276 Ga0105245_11913201 3300009098 Unclassified 646
277 Ga0105247_10243401 3300009101 Bacteria 1226
278 Ga0105247_11749608 3300009101 Unclassified 515
279 Ga0105243_10823030 3300009148 Unclassified 917
280 Ga0105241_10174179 3300009174 Unclassified 1779
281 Ga0105241_11184570 3300009174 Bacteria 723
282 Ga0105241_11344132 3300009174 Bacteria 682
283 Ga0105242_10413443 3300009176 Bacteria 1262
284 Ga0105242_10846795 3300009176 Bacteria 910
285 Ga0105248_10280862 3300009177 Unclassified 1875
286 Ga0105248_11996715 3300009177 Bacteria 659
287 Ga0105237_11231812 3300009545 Bacteria 755
288 Ga0105237_12254214 3300009545 Bacteria 554
289 Ga0105238_12211132 3300009551 Bacteria 585
290 Ga0105249_10016066 3300009553 Bacteria 6635
291 Ga0099796_10298383 3300010159 Unclassified 682
292 Ga0105239_10343100 3300010375 Bacteria 1686
293 Ga0105239_10857960 3300010375 Unclassified 1041
294 Ga0105239_11408166 3300010375 Unclassified 805
295 Ga0105239_11614269 3300010375 Unclassified 750
296 Ga0105239_13373129 3300010375 Unclassified 520
297 Ga0105246_10746108 3300011119 Bacteria 863
298 Ga0157373_10777940 3300013100 Unclassified 705
299 Ga0157373_11119884 3300013100 Unclassified 591
300 Ga0157371_10432221 3300013102 Unclassified 966
301 Ga0157370_10127105 3300013104 Unclassified 2379
302 Ga0157369_10070271 3300013105 Unclassified 3762
303 Ga0157374_10244141 3300013296 Bacteria 1766
304 Ga0157374_10467545 3300013296 Unclassified 1263
305 Ga0157374_10546111 3300013296 Bacteria 1166
306 Ga0157374_11676330 3300013296 Bacteria 660
307 Ga0157374_12504954 3300013296 Bacteria 543
308 Ga0157378_10003020 3300013297 Bacteria 14952
309 Ga0157378_10018210 3300013297 Bacteria 6166
310 Ga0157378_10051876 3300013297 Bacteria 3649
311 Ga0157378_10054621 3300013297 Bacteria 3556
312 Ga0157378_10206438 3300013297 Bacteria 1861
313 Ga0157378_10384983 3300013297 Bacteria 1378
314 Ga0157378_11187472 3300013297 Bacteria 802
315 Ga0157378_12283259 3300013297 Unclassified 592
316 Ga0163162_10800448 3300013306 Bacteria 1060
317 Ga0163162_13223494 3300013306 Unclassified 523
318 Ga0157372_10044158 3300013307 Bacteria 4938
319 Ga0157372_10061558 3300013307 Bacteria 4203
320 Ga0157372_10495990 3300013307 Unclassified 1424
321 Ga0157372_12450599 3300013307 Unclassified 599
322 Ga0157372_12582865 3300013307 Bacteria 583
323 Ga0157375_10117560 3300013308 Unclassified 2764
324 Ga0157375_12917836 3300013308 Bacteria 571
325 Ga0157375_13097711 3300013308 Viruses 555
326 Ga0163163_10338062 3300014325 Unclassified 1561
327 Ga0182008_10529086 3300014497 Unclassified 652
328 Ga0182008_10943984 3300014497 Bacteria 510
329 Ga0157377_10237046 3300014745 Unclassified 1176
330 Ga0157379_10260246 3300014968 Unclassified 1576
331 Ga0157379_10786358 3300014968 Unclassified 897
332 Ga0157376_10689202 3300014969 Bacteria 1026
333 Ga0157376_11891997 3300014969 Bacteria 633
334 Ga0182006_1017981 3300015261 Bacteria 2993
335 Ga0182007_10179804 3300015262 Bacteria 731
336 Ga0163161_10453620 3300017792 Bacteria 1037
337 Ga0163161_10601660 3300017792 Unclassified 906
338 Ga0163161_11111305 3300017792 Bacteria 680
339 Ga0207666_1042320 3300025271 Unclassified 713
340 Ga0207673_1000733 3300025290 Bacteria 3519
341 Ga0207673_1003628 3300025290 Bacteria 1814
342 Ga0207697_10000970 3300025315 Bacteria 16134
343 Ga0207697_10003616 3300025315 Bacteria 7578
344 Ga0207697_10039079 3300025315 Bacteria 1947
345 Ga0207692_10190492 3300025898 Unclassified 1200
346 Ga0207692_10446228 3300025898 Unclassified 814
347 Ga0207692_10470130 3300025898 Bacteria 794
348 Ga0207692_11147254 3300025898 Unclassified 515
349 Ga0207642_10938920 3300025899 Unclassified 555
350 Ga0207710_10149810 3300025900 Bacteria 1131
351 Ga0207688_10309136 3300025901 Unclassified 968
352 Ga0207680_10119112 3300025903 Unclassified 1724
353 Ga0207685_10157748 3300025905 Bacteria 1033
354 Ga0207685_10176023 3300025905 Unclassified 988
355 Ga0207685_10524097 3300025905 Unclassified 627
356 Ga0207699_10077832 3300025906 Bacteria 2048
357 Ga0207699_10788664 3300025906 Unclassified 698
358 Ga0207699_11103386 3300025906 Unclassified 587
359 Ga0207645_10122503 3300025907 Unclassified 1689
360 Ga0207645_10307789 3300025907 Unclassified 1055
361 Ga0207645_10420407 3300025907 Unclassified 900
362 Ga0207705_10146136 3300025909 Unclassified 1769
363 Ga0207684_10000318 3300025910 Bacteria 68520
364 Ga0207684_10003308 3300025910 Bacteria 15817
365 Ga0207684_10003816 3300025910 Bacteria 14533
366 Ga0207684_10022841 3300025910 Bacteria 5341
367 Ga0207684_10024201 3300025910 Bacteria 5178
368 Ga0207684_10034439 3300025910 Archaea 4303
369 Ga0207684_10056581 3300025910 Bacteria 3327
370 Ga0207684_10302449 3300025910 Unclassified 1379
371 Ga0207684_10327335 3300025910 Bacteria 1320
372 Ga0207684_10443387 3300025910 Unclassified 1115
373 Ga0207684_11717616 3300025910 Unclassified 505
374 Ga0207707_10000077 3300025912 Bacteria 100255
375 Ga0207707_10057924 3300025912 Unclassified 3372
376 Ga0207695_10342651 3300025913 Bacteria 1382
377 Ga0207695_10960953 3300025913 Unclassified 734
378 Ga0207695_11689869 3300025913 Bacteria 514
379 Ga0207671_11142471 3300025914 Unclassified 611
380 Ga0207693_10013832 3300025915 Bacteria 6498
381 Ga0207693_10022513 3300025915 Bacteria 5007
382 Ga0207693_10030830 3300025915 Bacteria 4235
383 Ga0207693_10071760 3300025915 Bacteria 2711
384 Ga0207693_10133311 3300025915 Bacteria 1953
385 Ga0207693_10973634 3300025915 Bacteria 649
386 Ga0207663_10017342 3300025916 Unclassified 4010
387 Ga0207663_10107923 3300025916 Unclassified 1884
388 Ga0207663_10145359 3300025916 Bacteria 1657
389 Ga0207663_10273721 3300025916 Bacteria 1251
390 Ga0207663_10664339 3300025916 Unclassified 823
391 Ga0207660_10009434 3300025917 Bacteria 6317
392 Ga0207660_10499607 3300025917 Unclassified 987
393 Ga0207662_10128107 3300025918 Bacteria 1598
394 Ga0207662_10790119 3300025918 Unclassified 669
395 Ga0207657_10330546 3300025919 Bacteria 1204
396 Ga0207649_10016598 3300025920 Unclassified 4156
397 Ga0207652_10000096 3300025921 Bacteria 96047
398 Ga0207652_10237799 3300025921 Bacteria 1641
399 Ga0207646_10010847 3300025922 Bacteria 8858
400 Ga0207646_10011354 3300025922 Bacteria 8641
401 Ga0207646_10076094 3300025922 Bacteria 2999
402 Ga0207646_10086243 3300025922 Unclassified 2809
403 Ga0207646_10116626 3300025922 Bacteria 2398
404 Ga0207646_10142901 3300025922 Bacteria 2156
405 Ga0207646_10171838 3300025922 Bacteria 1957
406 Ga0207646_10287784 3300025922 Bacteria 1485
407 Ga0207646_10697213 3300025922 Bacteria 908
408 Ga0207646_11480260 3300025922 Unclassified 588
409 Ga0207646_11495276 3300025922 Bacteria 585
410 Ga0207646_11579576 3300025922 Unclassified 566
411 Ga0207646_11863166 3300025922 Bacteria 513
412 Ga0207681_10052070 3300025923 Bacteria 2775
413 Ga0207650_10337111 3300025925 Unclassified 1238
414 Ga0207659_10343601 3300025926 Unclassified 1236
415 Ga0207687_10138282 3300025927 Unclassified 1845
416 Ga0207687_10226701 3300025927 Unclassified 1474
417 Ga0207687_10286737 3300025927 Unclassified 1322
418 Ga0207700_10092241 3300025928 Bacteria 2394
419 Ga0207700_10124851 3300025928 Bacteria 2092
420 Ga0207700_10494014 3300025928 Unclassified 1082
421 Ga0207700_11776287 3300025928 Unclassified 543
422 Ga0207664_10020094 3300025929 Bacteria 4945
423 Ga0207664_10120284 3300025929 Unclassified 2196
424 Ga0207664_10363625 3300025929 Unclassified 1282
425 Ga0207664_10529931 3300025929 Bacteria 1056
426 Ga0207664_10622024 3300025929 Unclassified 970
427 Ga0207664_10643609 3300025929 Unclassified 953
428 Ga0207664_11313303 3300025929 Bacteria 643
429 Ga0207644_10398330 3300025931 Unclassified 1125
430 Ga0207690_11052528 3300025932 Unclassified 678
431 Ga0207706_10467568 3300025933 Bacteria 1090
432 Ga0207706_10512223 3300025933 Bacteria 1035
433 Ga0207706_10834778 3300025933 Unclassified 781
434 Ga0207706_11241952 3300025933 Bacteria 618
435 Ga0207686_10396084 3300025934 Unclassified 1051
436 Ga0207670_10027947 3300025936 Unclassified 3574
437 Ga0207669_10420167 3300025937 Unclassified 1052
438 Ga0207669_10911486 3300025937 Unclassified 735
439 Ga0207669_11228599 3300025937 Unclassified 635
440 Ga0207704_10664044 3300025938 Bacteria 860
441 Ga0207665_10018808 3300025939 Bacteria 4540
442 Ga0207665_10142038 3300025939 Bacteria 1713
443 Ga0207665_10201363 3300025939 Bacteria 1451
444 Ga0207665_11284723 3300025939 Unclassified 583
445 Ga0207691_10019193 3300025940 Bacteria 6472
446 Ga0207711_10809482 3300025941 Bacteria 872
447 Ga0207711_11840443 3300025941 Bacteria 548
448 Ga0207689_10872462 3300025942 Unclassified 759
449 Ga0207689_11577999 3300025942 Unclassified 547
450 Ga0207661_10021589 3300025944 Unclassified 4826
451 Ga0207679_10696625 3300025945 Unclassified 921
452 Ga0207679_12203702 3300025945 Unclassified 500
453 Ga0207651_10032412 3300025960 Unclassified 3356
454 Ga0207651_10983833 3300025960 Unclassified 753
455 Ga0207668_10536394 3300025972 Bacteria 1012
456 Ga0207640_10534922 3300025981 Bacteria 982
457 Ga0207640_11623934 3300025981 Unclassified 583
458 Ga0207658_10587107 3300025986 Unclassified 1000
459 Ga0207677_10189840 3300026023 Bacteria 1624
460 Ga0207677_10516718 3300026023 Unclassified 1035
461 Ga0207677_11217688 3300026023 Bacteria 689
462 Ga0207703_10185550 3300026035 Bacteria 1838
463 Ga0207703_10649200 3300026035 Unclassified 1001
464 Ga0207639_10157024 3300026041 Bacteria 1912
465 Ga0207678_10175375 3300026067 Unclassified 1831
466 Ga0207708_10195336 3300026075 Bacteria 1612
467 Ga0207702_10135720 3300026078 Unclassified 2219
468 Ga0207702_11111989 3300026078 Unclassified 784
469 Ga0207702_11207428 3300026078 Unclassified 750
470 Ga0207641_10493084 3300026088 Unclassified 1189
471 Ga0207641_11172902 3300026088 Bacteria 767
472 Ga0207648_10327523 3300026089 Unclassified 1377
473 Ga0207648_12132127 3300026089 Unclassified 521
474 Ga0207676_10293413 3300026095 Bacteria 1482
475 Ga0207676_11073974 3300026095 Unclassified 795
476 Ga0207675_100597528 3300026118 Bacteria 1106
477 Ga0207683_10020144 3300026121 Bacteria 5702
478 Ga0207698_10547378 3300026142 Unclassified 1134
479 Ga0210002_1045346 3300027617 Bacteria 752
480 Ga0207428_10866155 3300027907 Bacteria 639
481 Ga0268266_10018166 3300028379 Bacteria 5995
482 Ga0268266_10089283 3300028379 Bacteria 2698
483 Ga0268266_11092421 3300028379 Unclassified 772
484 Ga0268264_10593202 3300028381 Unclassified 1091
485 Ga0268264_10986224 3300028381 Bacteria 849
486 Ga0373923_0236299 3300035111 Bacteria 853
487 Ga0373923_0498672 3300035111 Bacteria 594
488 Ga0373945_0067226 3300035116 Bacteria 1349
489 Ga0373953_0176358 3300035117 Bacteria 921
490 Ga0373954_0557656 3300035118 Unclassified 568
491 Ga0373956_0046750 3300035119 Bacteria 1935
492 Ga0373943_0040392 3300035170 Bacteria 2252
493 Ga0373943_0297775 3300035170 Bacteria 915
494 Ga0373943_0579641 3300035170 Bacteria 660
495 Ga0373946_0047514 3300035171 Bacteria 1783
496 Ga0373955_0801254 3300035172 Unclassified 579
497 Ga0373935_0044854 3300035692 Bacteria 2788
498 Ga0373935_0050261 3300035692 Bacteria 2646
499 Ga0373935_0152677 3300035692 Bacteria 1568
500 Ga0373927_0139211 3300035695 Bacteria 1587
501 Ga0373927_0175879 3300035695 Bacteria 1404
502 Ga0373933_0260665 3300035724 Bacteria 1118
503 Ga0373933_0443645 3300035724 Bacteria 849
504 Ga0373947_0020927 3300035725 Bacteria 3783
505 Ga0373947_0021063 3300035725 Bacteria 3772
506 Ga0373947_0038395 3300035725 Bacteria 2845
507 Ga0373947_0308058 3300035725 Bacteria 1057
508 Ga0373947_0700845 3300035725 Unclassified 691
509 Ga0373937_0117309 3300036401 Bacteria 2479
510 Ga0373937_0336461 3300036401 Bacteria 1429
511 Ga0373937_1178528 3300036401 Bacteria 715
512 Ga0373937_1951627 3300036401 Bacteria 533
513 Ga0373925_0322958 3300037068 Unclassified 1249
514 Ga0395900_0316335 3300037418 Bacteria 1543
515 Ga0395900_0498243 3300037418 Unclassified 1169
516 Ga0395900_0769720 3300037418 Unclassified 892
517 Ga0395898_0846974 3300037466 Bacteria 854
518 Ga0395905_0215382 3300037471 Bacteria 1799
519 Ga0395905_0869682 3300037471 Unclassified 804
520 Ga0395901_0621744 3300038443 Bacteria 1087
521 Ga0395901_0936006 3300038443 Unclassified 846
522 Ga0395901_1158587 3300038443 Bacteria 741
523 Ga0436360_0449468 3300039438 Unclassified 514
524 Ga0451798_0091717 3300041458 Bacteria 1165
525 Ga0451802_0624474 3300041460 Bacteria 757
526 Ga0451804_0024167 3300041463 Bacteria 960
527 Ga0451807_2175110 3300041486 Bacteria 626
528 Ga0451835_0452261 3300041492 Unclassified 820
529 Ga0451849_0508029 3300041505 Bacteria 509
530 Ga0451853_1768930 3300041512 Bacteria 1123
531 Ga0439454_007948 3300042011 Bacteria 1342
532 Ga0495592_0046937 3300046454 Bacteria 3218
533 Ga0495592_0370170 3300046454 Unclassified 914
534 Ga0495603_0202930 3300046455 Bacteria 1146
535 Ga0495629_0590470 3300046459 Unclassified 743
536 Ga0495629_0932284 3300046459 Unclassified 568
537 Ga0495641_0113161 3300046461 Bacteria 1211
538 Ga0495651_0204194 3300046462 Bacteria 1381
539 Ga0495651_0867043 3300046462 Bacteria 554
540 Ga0495653_0653852 3300046463 Unclassified 642
541 Ga0495653_0729640 3300046463 Unclassified 600
542 Ga0495580_0659833 3300046472 Bacteria 687
543 Ga0495582_0237880 3300046473 Bacteria 1043
544 Ga0495662_0172818 3300046476 Bacteria 1065
545 Ga0495584_0391848 3300046491 Bacteria 706
546 Ga0495594_0447221 3300046499 Bacteria 735
547 Ga0495608_0632180 3300046511 Bacteria 641
548 Ga0495618_0866566 3300046514 Bacteria 523
549 Ga0495628_0021587 3300046516 Bacteria 5294
550 Ga0495628_0939109 3300046516 Unclassified 598
551 Ga0495630_0049181 3300046517 Bacteria 3155
552 Ga0495630_0235592 3300046517 Unclassified 1399
553 Ga0495630_0964610 3300046517 Bacteria 648
554 Ga0495630_1048664 3300046517 Bacteria 619
555 Ga0495666_0163448 3300046526 Unclassified 1032
556 Ga0495666_0384342 3300046526 Bacteria 631
557 Ga0495652_0098026 3300046529 Bacteria 2383
558 Ga0495652_0251826 3300046529 Bacteria 1308
559 Ga0495665_0405940 3300046531 Bacteria 691
560 Ga0495640_0656061 3300046533 Bacteria 631
561 Ga0495586_0009505 3300046535 Bacteria 5176
562 Ga0495587_0294936 3300046536 Unclassified 907
563 Ga0495645_0006846 3300046543 Bacteria 7922
564 Ga0495667_0602558 3300046559 Bacteria 684
565 Ga0495667_0869575 3300046559 Unclassified 554
566 Ga0495634_0125441 3300046642 Bacteria 1641
567 Ga0495634_0366636 3300046642 Bacteria 860
568 Ga0495635_0247989 3300046663 Bacteria 1201
569 Ga0495635_0658685 3300046663 Bacteria 681
570 Ga0495657_0221813 3300046675 Unclassified 1146
571 Ga0495599_0001804 3300046678 Bacteria 12423
572 Ga0495646_0182913 3300046680 Unclassified 1149
573 Ga0495646_0440409 3300046680 Unclassified 674
574 Ga0495647_0640925 3300046681 Bacteria 500
575 Ga0495658_0698873 3300046683 Bacteria 650
576 Ga0495613_0232591 3300046689 Bacteria 1291
577 Ga0495613_0621247 3300046689 Bacteria 717
578 Ga0495624_0143716 3300046690 Bacteria 1461
579 Ga0495589_0475399 3300046794 Bacteria 571
580 Ga0495600_0240157 3300046809 Unclassified 1155
581 Ga0495600_0711138 3300046809 Bacteria 604
582 Ga0495581_0192240 3300047315 Bacteria 1194
583 Ga0495604_0095982 3300047317 Bacteria 2189
584 Ga0495674_0104295 3300047319 Bacteria 2410
585 Ga0495674_0474888 3300047319 Bacteria 1003
586 Ga0495674_0607734 3300047319 Bacteria 866
587 Ga0495674_0670240 3300047319 Bacteria 816
588 Ga0495680_0054931 3300047322 Bacteria 3090
589 Ga0495680_0452233 3300047322 Unclassified 879
590 Ga0495680_0821651 3300047322 Bacteria 606
591 Ga0495680_0978601 3300047322 Bacteria 542
592 Ga0495675_0042191 3300047444 Bacteria 2906
593 Ga0495675_0384948 3300047444 Unclassified 820
594 Ga0495684_0003489 3300047471 Bacteria 12308
595 Ga0495614_0268410 3300048089 Unclassified 784
596 Ga0496100_0157296 3300048903 Bacteria 1626
597 Ga0496100_0298753 3300048903 Unclassified 1205
598 Ga0496101_0764189 3300048904 Unclassified 762
599 Ga0496102_0053634 3300048905 Bacteria 3675
600 Ga0496103_0581976 3300048906 Unclassified 714
601 Ga0496104_0100109 3300048907 Unclassified 2775
602 Ga0496104_0289000 3300048907 Unclassified 1552
603 Ga0496105_0036162 3300048908 Unclassified 4067
604 Ga0496105_0232144 3300048908 Bacteria 1499
605 Ga0496106_0216185 3300048909 Bacteria 1528
606 Ga0496106_1300647 3300048909 Unclassified 564
607 Ga0496107_1377515 3300048910 Bacteria 503
608 Ga0496108_0078061 3300048911 Bacteria 2802
609 Ga0496108_0642928 3300048911 Bacteria 922
610 Ga0496109_0084963 3300048912 Bacteria 2920
611 Ga0496109_0367202 3300048912 Bacteria 1359
612 Ga0496109_0398426 3300048912 Bacteria 1300
613 Ga0496109_0796768 3300048912 Unclassified 883
614 Ga0496110_0097241 3300048913 Bacteria 2638
615 Ga0496110_0798323 3300048913 Unclassified 848
616 Ga0496110_0868425 3300048913 Unclassified 808
617 Ga0496112_0044208 3300048915 Unclassified 4364
618 Ga0496112_0747633 3300048915 Unclassified 904
619 Ga0496113_0057140 3300048916 Bacteria 2931
620 Ga0496113_0568868 3300048916 Unclassified 909
621 Ga0496113_1299100 3300048916 Unclassified 566
622 Ga0496113_1387717 3300048916 Unclassified 544
623 Ga0496115_0055303 3300048918 Bacteria 3188
624 Ga0496115_0228143 3300048918 Bacteria 1536
625 Ga0496115_0393159 3300048918 Unclassified 1126
626 Ga0501069_0222715 3300049585 Bacteria 1097
627 nmdc:mga08y16_1480585_c1 3300050511 Bacteria 640
628 nmdc:mga0n895_34388_c1 3300050512 Bacteria 4877
629 nmdc:mga0n895_667836_c1 3300050512 Unclassified 1037
630 nmdc:mga0rr50_575998_c1 3300050513 Unclassified 959
631 nmdc:mga0rr50_590704_c1 3300050513 Bacteria 946
632 nmdc:mga0rr50_745254_c1 3300050513 Unclassified 836
633 nmdc:mga08x19_109300_c1 3300050514 Bacteria 1843
634 nmdc:mga08x19_225756_c1 3300050514 Bacteria 1288
635 nmdc:mga08x19_681508_c1 3300050514 Unclassified 729
636 nmdc:mga0a205_270859_c1 3300050515 Bacteria 1575
637 nmdc:mga0a205_580977_c1 3300050515 Unclassified 974
638 Ga0495601_0013922 3300053077 Unclassified 4843
639 Ga0495601_0038552 3300053077 Bacteria 2989
640 Ga0495601_0501516 3300053077 Bacteria 783
641 Ga0495601_1074361 3300053077 Unclassified 504
642 Ga0495612_0367683 3300053078 Bacteria 651
643 Ga0495655_0362102 3300053083 Unclassified 509
644 Ga0495619_0103026 3300053085 Bacteria 1944
645 Ga0495619_0320895 3300053085 Unclassified 1072
646 Ga0500566_0214617 3300053094 Bacteria 961
647 Ga0373946_0117395
648 SwRhRL2b_contig_2073574
649 2214811066
650 JGI24035J26624_1001174
651 JGI24034J26672_10097338
652 JGI25406J46586_10000044
653 Ga0065714_10203058
654 Ga0065704_10003796
655 Ga0065704_10005317
656 Ga0065704_10023571
657 Ga0065712_10003013
658 Ga0065712_10006829
659 Ga0065712_10097236
660 Ga0065712_10144200
661 Ga0065712_10182336
662 Ga0065712_10434718
663 Ga0065712_10557702
664 Ga0065712_10698016
665 Ga0065715_10000511
666 Ga0065715_10003784
667 Ga0065715_10105598
668 Ga0065715_10714144
669 Ga0065715_10747754
670 Ga0065707_10137564
671 Ga0065707_11138091
672 Ga0070658_10303768
673 Ga0070676_10465127
674 Ga0070676_10535356
675 Ga0070676_11052991
676 Ga0070683_100211259
677 Ga0070683_101884360
678 Ga0070690_100027281
679 Ga0070690_100046737
680 Ga0070670_101177538
681 Ga0068869_100731059
682 Ga0068869_102057592
683 Ga0070666_10257423
684 Ga0070680_100009840
685 Ga0070682_100035277
686 Ga0068868_100194988
687 Ga0068868_100264569
688 Ga0068868_101251721
689 Ga0070689_100146604
690 Ga0070691_10747537
691 Ga0070687_100086116
692 Ga0070687_100754150
693 Ga0070668_101640887
694 Ga0070669_100037801
695 Ga0070669_100530691
696 Ga0070675_100202378
697 Ga0070671_100284892
698 Ga0070671_100559591
699 Ga0070671_101740815
700 Ga0070674_100615599
701 Ga0070674_101242781
702 Ga0070674_101458605
703 Ga0070673_100084819
704 Ga0070673_100448323
705 Ga0070673_101253074
706 Ga0070688_100048866
707 Ga0070659_100765113
708 Ga0070659_101012428
709 Ga0070659_101017664
710 Ga0070667_100563658
711 Ga0070709_10535041
712 Ga0070714_100108440
713 Ga0070714_100211144
714 Ga0070714_100216430
715 Ga0070714_100227434
716 Ga0070713_100127255
717 Ga0070713_100140079
718 Ga0070713_100622158
719 Ga0070713_100796438
720 Ga0070713_101418363
721 Ga0070710_10025637
722 Ga0070710_10379250
723 Ga0070710_10490179
724 Ga0070710_10952575
725 Ga0070711_100015241
726 Ga0070711_100267983
727 Ga0070711_100346437
728 Ga0070711_100565569
729 Ga0070711_101513031
730 Ga0070705_100387829
731 Ga0070705_100629828
732 Ga0070705_101691075
733 Ga0070700_100712585
734 Ga0070694_100653623
735 Ga0070708_100016655
736 Ga0070708_100027244
737 Ga0070708_100040302
738 Ga0070708_100294531
739 Ga0070708_100366781
740 Ga0070708_100673728
741 Ga0070708_100689425
742 Ga0070708_100995546
743 Ga0070708_101140184
744 Ga0070708_101225130
745 Ga0070708_101283933
746 Ga0070708_101308013
747 Ga0070708_101515315
748 Ga0070708_101601348
749 Ga0070708_101704396
750 Ga0070708_102119720
751 Ga0070663_100242651
752 Ga0070678_100179070
753 Ga0070678_100342116
754 Ga0070662_100837940
755 Ga0070662_100963457
756 Ga0070662_101452658
757 Ga0070681_10000041
758 Ga0070681_10006765
759 Ga0068867_101141195
760 Ga0068867_102376095
761 Ga0070706_100016203
762 Ga0070706_100033749
763 Ga0070706_100071533
764 Ga0070706_100144711
765 Ga0070706_100161438
766 Ga0070706_100313851
767 Ga0070706_100342287
768 Ga0070706_100432446
769 Ga0070706_100695514
770 Ga0070706_101012384
771 Ga0070706_101622878
772 Ga0070707_100005775
773 Ga0070707_100013069
774 Ga0070707_100020702
775 Ga0070707_100099388
776 Ga0070707_100101537
777 Ga0070707_100166171
778 Ga0070707_100167250
779 Ga0070707_100167518
780 Ga0070707_100256186
781 Ga0070707_100381304
782 Ga0070707_100416287
783 Ga0070707_100883729
784 Ga0070707_101824042
785 Ga0070707_101943222
786 Ga0070698_100012337
787 Ga0070698_100081393
788 Ga0070698_100137101
789 Ga0070698_100517896
790 Ga0070698_101698414
791 Ga0070698_102012821
792 Ga0070698_102116674
793 Ga0070699_100106256
794 Ga0070699_100297803
795 Ga0070699_100724759
796 Ga0070699_100893034
797 Ga0070699_100926454
798 Ga0070699_101425506
799 Ga0070679_100000074
800 Ga0070679_100009577
801 Ga0070679_101141995
802 Ga0070684_100016086
803 Ga0070684_100691411
804 Ga0070697_100000699
805 Ga0070697_100002030
806 Ga0070697_100008913
807 Ga0070697_100016984
808 Ga0070697_100037087
809 Ga0070697_100065708
810 Ga0070697_100069405
811 Ga0070697_100118428
812 Ga0070697_100124538
813 Ga0070697_100178498
814 Ga0070697_100251413
815 Ga0070697_100543350
816 Ga0070697_100712025
817 Ga0070697_100849716
818 Ga0070697_101155927
819 Ga0070697_101273705
820 Ga0070697_101300815
821 Ga0068853_102074736
822 Ga0070672_100477183
823 Ga0070672_101143816
824 Ga0070686_100024620
825 Ga0070686_100847825
826 Ga0070695_100708191
827 Ga0070695_101243426
828 Ga0070696_101391240
829 Ga0070696_101724953
830 Ga0070693_100130903
831 Ga0070693_100135391
832 Ga0070665_100030843
833 Ga0070665_100086844
834 Ga0070665_100708212
835 Ga0070704_100305928
836 Ga0070704_101331038
837 Ga0070704_101367655
838 Ga0070664_100664541
839 Ga0068854_100304731
840 Ga0068856_100025652
841 Ga0068856_100054202
842 Ga0068856_100802776
843 Ga0068856_100888750
844 Ga0070702_100581306
845 Ga0070702_100893313
846 Ga0070702_101444108
847 Ga0068852_100667054
848 Ga0068859_102316012
849 Ga0068864_101170209
850 Ga0068866_10253497
851 Ga0068866_10562276
852 Ga0068861_100890829
853 Ga0068863_100252730
854 Ga0068863_100937877
855 Ga0068858_100336727
856 Ga0081455_10178172
857 Ga0081455_10266799
858 Ga0081539_10000673
859 Ga0081539_10013013
860 Ga0081539_10054994
861 Ga0070717_10143510
862 Ga0070717_10164322
863 Ga0070717_10194991
864 Ga0070717_10515864
865 Ga0070717_10517820
866 Ga0070717_10861103
867 Ga0070717_11555564
868 Ga0070717_11559128
869 Ga0070717_11643328
870 Ga0070717_11791077
871 Ga0070717_12097821
872 Ga0070715_10014359
873 Ga0070715_10047255
874 Ga0070715_10512378
875 Ga0070715_10519781
876 Ga0070716_100113182
877 Ga0070716_100625806
878 Ga0070716_101058150
879 Ga0070716_101116190
880 Ga0070716_101623468
881 Ga0070712_100007387
882 Ga0070712_100018384
883 Ga0070712_100069026
884 Ga0070712_100121374
885 Ga0070712_100370005
886 Ga0070712_100400984
887 Ga0070712_100564455
888 Ga0070712_100782466
889 Ga0070712_100947308
890 Ga0070712_101522833
891 Ga0070712_101970699
892 Ga0070712_101970700
893 Ga0097621_100624015
894 Ga0097621_100669614
895 Ga0068871_100182695
896 Ga0068871_101720784
897 Ga0075428_101885887
898 Ga0075433_10109009
899 Ga0075433_10218147
900 Ga0075433_11337854
901 Ga0075434_100201419
902 Ga0075434_100534293
903 Ga0075434_101300403
904 Ga0075434_101992265
905 Ga0068865_101019053
906 Ga0075436_100023411
907 Ga0075436_100187032
908 Ga0097620_102316241
909 Ga0075435_100435579
910 Ga0075435_100692124
911 Ga0075435_100837888
912 Ga0099794_10181734
913 Ga0099795_10050037
914 Ga0099795_10149256
915 Ga0105251_10533850
916 Ga0105240_10414625
917 Ga0105240_10571586
918 Ga0111539_11290008
919 Ga0105245_10025427
920 Ga0105245_10163458
921 Ga0105245_11452139
922 Ga0105245_11913201
923 Ga0105247_10243401
924 Ga0105247_11749608
925 Ga0105243_10823030
926 Ga0105241_10174179
927 Ga0105241_11184570
928 Ga0105241_11344132
929 Ga0105242_10413443
930 Ga0105242_10846795
931 Ga0105248_10280862
932 Ga0105248_11996715
933 Ga0105237_11231812
934 Ga0105237_12254214
935 Ga0105238_12211132
936 Ga0105249_10016066
937 Ga0099796_10298383
938 Ga0105239_10343100
939 Ga0105239_10857960
940 Ga0105239_11408166
941 Ga0105239_11614269
942 Ga0105239_13373129
943 Ga0105246_10746108
944 Ga0157373_10777940
945 Ga0157373_11119884
946 Ga0157371_10432221
947 Ga0157370_10127105
948 Ga0157369_10070271
949 Ga0157374_10244141
950 Ga0157374_10467545
951 Ga0157374_10546111
952 Ga0157374_11676330
953 Ga0157374_12504954
954 Ga0157378_10003020
955 Ga0157378_10018210
956 Ga0157378_10051876
957 Ga0157378_10054621
958 Ga0157378_10206438
959 Ga0157378_10384983
960 Ga0157378_11187472
961 Ga0157378_12283259
962 Ga0163162_10800448
963 Ga0163162_13223494
964 Ga0157372_10044158
965 Ga0157372_10061558
966 Ga0157372_10495990
967 Ga0157372_12450599
968 Ga0157372_12582865
969 Ga0157375_10117560
970 Ga0157375_12917836
971 Ga0157375_13097711
972 Ga0163163_10338062
973 Ga0182008_10529086
974 Ga0182008_10943984
975 Ga0157377_10237046
976 Ga0157379_10260246
977 Ga0157379_10786358
978 Ga0157376_10689202
979 Ga0157376_11891997
980 Ga0182006_1017981
981 Ga0182007_10179804
982 Ga0163161_10453620
983 Ga0163161_10601660
984 Ga0163161_11111305
985 Ga0207666_1042320
986 Ga0207673_1000733
987 Ga0207673_1003628
988 Ga0207697_10000970
989 Ga0207697_10003616
990 Ga0207697_10039079
991 Ga0207692_10190492
992 Ga0207692_10446228
993 Ga0207692_10470130
994 Ga0207692_11147254
995 Ga0207642_10938920
996 Ga0207710_10149810
997 Ga0207688_10309136
998 Ga0207680_10119112
999 Ga0207685_10157748
1000 Ga0207685_10176023
1001 Ga0207685_10524097
1002 Ga0207699_10077832
1003 Ga0207699_10788664
1004 Ga0207699_11103386
1005 Ga0207645_10122503
1006 Ga0207645_10307789
1007 Ga0207645_10420407
1008 Ga0207705_10146136
1009 Ga0207684_10000318
1010 Ga0207684_10003308
1011 Ga0207684_10003816
1012 Ga0207684_10022841
1013 Ga0207684_10024201
1014 Ga0207684_10034439
1015 Ga0207684_10056581
1016 Ga0207684_10302449
1017 Ga0207684_10327335
1018 Ga0207684_10443387
1019 Ga0207684_11717616
1020 Ga0207707_10000077
1021 Ga0207707_10057924
1022 Ga0207695_10342651
1023 Ga0207695_10960953
1024 Ga0207695_11689869
1025 Ga0207671_11142471
1026 Ga0207693_10013832
1027 Ga0207693_10022513
1028 Ga0207693_10030830
1029 Ga0207693_10071760
1030 Ga0207693_10133311
1031 Ga0207693_10973634
1032 Ga0207663_10017342
1033 Ga0207663_10107923
1034 Ga0207663_10145359
1035 Ga0207663_10273721
1036 Ga0207663_10664339
1037 Ga0207660_10009434
1038 Ga0207660_10499607
1039 Ga0207662_10128107
1040 Ga0207662_10790119
1041 Ga0207657_10330546
1042 Ga0207649_10016598
1043 Ga0207652_10000096
1044 Ga0207652_10237799
1045 Ga0207646_10010847
1046 Ga0207646_10011354
1047 Ga0207646_10076094
1048 Ga0207646_10086243
1049 Ga0207646_10116626
1050 Ga0207646_10142901
1051 Ga0207646_10171838
1052 Ga0207646_10287784
1053 Ga0207646_10697213
1054 Ga0207646_11480260
1055 Ga0207646_11495276
1056 Ga0207646_11579576
1057 Ga0207646_11863166
1058 Ga0207681_10052070
1059 Ga0207650_10337111
1060 Ga0207659_10343601
1061 Ga0207687_10138282
1062 Ga0207687_10226701
1063 Ga0207687_10286737
1064 Ga0207700_10092241
1065 Ga0207700_10124851
1066 Ga0207700_10494014
1067 Ga0207700_11776287
1068 Ga0207664_10020094
1069 Ga0207664_10120284
1070 Ga0207664_10363625
1071 Ga0207664_10529931
1072 Ga0207664_10622024
1073 Ga0207664_10643609
1074 Ga0207664_11313303
1075 Ga0207644_10398330
1076 Ga0207690_11052528
1077 Ga0207706_10467568
1078 Ga0207706_10512223
1079 Ga0207706_10834778
1080 Ga0207706_11241952
1081 Ga0207686_10396084
1082 Ga0207670_10027947
1083 Ga0207669_10420167
1084 Ga0207669_10911486
1085 Ga0207669_11228599
1086 Ga0207704_10664044
1087 Ga0207665_10018808
1088 Ga0207665_10142038
1089 Ga0207665_10201363
1090 Ga0207665_11284723
1091 Ga0207691_10019193
1092 Ga0207711_10809482
1093 Ga0207711_11840443
1094 Ga0207689_10872462
1095 Ga0207689_11577999
1096 Ga0207661_10021589
1097 Ga0207679_10696625
1098 Ga0207679_12203702
1099 Ga0207651_10032412
1100 Ga0207651_10983833
1101 Ga0207668_10536394
1102 Ga0207640_10534922
1103 Ga0207640_11623934
1104 Ga0207658_10587107
1105 Ga0207677_10189840
1106 Ga0207677_10516718
1107 Ga0207677_11217688
1108 Ga0207703_10185550
1109 Ga0207703_10649200
1110 Ga0207639_10157024
1111 Ga0207678_10175375
1112 Ga0207708_10195336
1113 Ga0207702_10135720
1114 Ga0207702_11111989
1115 Ga0207702_11207428
1116 Ga0207641_10493084
1117 Ga0207641_11172902
1118 Ga0207648_10327523
1119 Ga0207648_12132127
1120 Ga0207676_10293413
1121 Ga0207676_11073974
1122 Ga0207675_100597528
1123 Ga0207683_10020144
1124 Ga0207698_10547378
1125 Ga0210002_1045346
1126 Ga0207428_10866155
1127 Ga0268266_10018166
1128 Ga0268266_10089283
1129 Ga0268266_11092421
1130 Ga0268264_10593202
1131 Ga0268264_10986224
1132 Ga0373923_0236299
1133 Ga0373923_0498672
1134 Ga0373945_0067226
1135 Ga0373953_0176358
1136 Ga0373954_0557656
1137 Ga0373956_0046750
1138 Ga0373943_0040392
1139 Ga0373943_0297775
1140 Ga0373943_0579641
1141 Ga0373946_0047514
1142 Ga0373955_0801254
1143 Ga0373935_0044854
1144 Ga0373935_0050261
1145 Ga0373935_0152677
1146 Ga0373927_0139211
1147 Ga0373927_0175879
1148 Ga0373933_0260665
1149 Ga0373933_0443645
1150 Ga0373947_0020927
1151 Ga0373947_0021063
1152 Ga0373947_0038395
1153 Ga0373947_0308058
1154 Ga0373947_0700845
1155 Ga0373937_0117309
1156 Ga0373937_0336461
1157 Ga0373937_1178528
1158 Ga0373937_1951627
1159 Ga0373925_0322958
1160 Ga0395900_0316335
1161 Ga0395900_0498243
1162 Ga0395900_0769720
1163 Ga0395898_0846974
1164 Ga0395905_0215382
1165 Ga0395905_0869682
1166 Ga0395901_0621744
1167 Ga0395901_0936006
1168 Ga0395901_1158587
1169 Ga0436360_0449468
1170 Ga0451798_0091717
1171 Ga0451802_0624474
1172 Ga0451804_0024167
1173 Ga0451807_2175110
1174 Ga0451835_0452261
1175 Ga0451849_0508029
1176 Ga0451853_1768930
1177 Ga0439454_007948
1178 Ga0495592_0046937
1179 Ga0495592_0370170
1180 Ga0495603_0202930
1181 Ga0495629_0590470
1182 Ga0495629_0932284
1183 Ga0495641_0113161
1184 Ga0495651_0204194
1185 Ga0495651_0867043
1186 Ga0495653_0653852
1187 Ga0495653_0729640
1188 Ga0495580_0659833
1189 Ga0495582_0237880
1190 Ga0495662_0172818
1191 Ga0495584_0391848
1192 Ga0495594_0447221
1193 Ga0495608_0632180
1194 Ga0495618_0866566
1195 Ga0495628_0021587
1196 Ga0495628_0939109
1197 Ga0495630_0049181
1198 Ga0495630_0235592
1199 Ga0495630_0964610
1200 Ga0495630_1048664
1201 Ga0495666_0163448
1202 Ga0495666_0384342
1203 Ga0495652_0098026
1204 Ga0495652_0251826
1205 Ga0495665_0405940
1206 Ga0495640_0656061
1207 Ga0495586_0009505
1208 Ga0495587_0294936
1209 Ga0495645_0006846
1210 Ga0495667_0602558
1211 Ga0495667_0869575
1212 Ga0495634_0125441
1213 Ga0495634_0366636
1214 Ga0495635_0247989
1215 Ga0495635_0658685
1216 Ga0495657_0221813
1217 Ga0495599_0001804
1218 Ga0495646_0182913
1219 Ga0495646_0440409
1220 Ga0495647_0640925
1221 Ga0495658_0698873
1222 Ga0495613_0232591
1223 Ga0495613_0621247
1224 Ga0495624_0143716
1225 Ga0495589_0475399
1226 Ga0495600_0240157
1227 Ga0495600_0711138
1228 Ga0495581_0192240
1229 Ga0495604_0095982
1230 Ga0495674_0104295
1231 Ga0495674_0474888
1232 Ga0495674_0607734
1233 Ga0495674_0670240
1234 Ga0495680_0054931
1235 Ga0495680_0452233
1236 Ga0495680_0821651
1237 Ga0495680_0978601
1238 Ga0495675_0042191
1239 Ga0495675_0384948
1240 Ga0495684_0003489
1241 Ga0495614_0268410
1242 Ga0496100_0157296
1243 Ga0496100_0298753
1244 Ga0496101_0764189
1245 Ga0496102_0053634
1246 Ga0496103_0581976
1247 Ga0496104_0100109
1248 Ga0496104_0289000
1249 Ga0496105_0036162
1250 Ga0496105_0232144
1251 Ga0496106_0216185
1252 Ga0496106_1300647
1253 Ga0496107_1377515
1254 Ga0496108_0078061
1255 Ga0496108_0642928
1256 Ga0496109_0084963
1257 Ga0496109_0367202
1258 Ga0496109_0398426
1259 Ga0496109_0796768
1260 Ga0496110_0097241
1261 Ga0496110_0798323
1262 Ga0496110_0868425
1263 Ga0496112_0044208
1264 Ga0496112_0747633
1265 Ga0496113_0057140
1266 Ga0496113_0568868
1267 Ga0496113_1299100
1268 Ga0496113_1387717
1269 Ga0496115_0055303
1270 Ga0496115_0228143
1271 Ga0496115_0393159
1272 Ga0501069_0222715
1273 nmdc:mga08y16_1480585_c1
1274 nmdc:mga0n895_34388_c1
1275 nmdc:mga0n895_667836_c1
1276 nmdc:mga0rr50_575998_c1
1277 nmdc:mga0rr50_590704_c1
1278 nmdc:mga0rr50_745254_c1
1279 nmdc:mga08x19_109300_c1
1280 nmdc:mga08x19_225756_c1
1281 nmdc:mga08x19_681508_c1
1282 nmdc:mga0a205_270859_c1
1283 nmdc:mga0a205_580977_c1
1284 Ga0495601_0013922
1285 Ga0495601_0038552
1286 Ga0495601_0501516
1287 Ga0495601_1074361
1288 Ga0495612_0367683
1289 Ga0495655_0362102
1290 Ga0495619_0103026
1291 Ga0495619_0320895
1292 Ga0500566_0214617

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06348

DUF1059

Protein of unknown function (DUF1059)

19

74

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2owy-assembly1.cif.gz_B the recombination-associated protein rdgc adopts a novel toroidal architecture for dna binding 0.8174 27 56
5mlq-assembly1.cif.gz_B structure of cdps from nocardia brasiliensis 0.7454 28 57
4q16-assembly1.cif.gz_B structure of nad+ synthetase from deinococcus radiodurans 0.74 25 55
4q16-assembly2.cif.gz_D structure of nad+ synthetase from deinococcus radiodurans 0.7357 25 55
4q16-assembly2.cif.gz_C structure of nad+ synthetase from deinococcus radiodurans 0.7165 25 55
ID Description Score Start End Superfamily
af_A0A0R0EJH6_1_248_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9031 28 56 1.20.1740.10
af_A0A368UKA6_43_470_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8449 29 56 1.20.1740.10
1xktB02 Mainly Alpha;Orthogonal Bundle;Protein Yjbj; Chain: A;;Fatty acid synthase; domain 2 0.7675 25 57 1.10.1470.20
af_O01883_24_322_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.7365 27 57 1.50.40.10
2hszB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.6707 28 57 1.10.150.240
ID Description Score Start End GO Terms
AF-X1L045-F1-model_v4 Uncharacterized protein 0.9962 27 56
AF-A0A7J9XD48-F1-model_v4 DUF1059 domain-containing protein 0.996 4 60
AF-A0A2V7YZ35-F1-model_v4 DUF1059 domain-containing protein 0.9903 1 62
AF-A0A2V5PHA8-F1-model_v4 DUF1059 domain-containing protein 0.9854 5 63
AF-A0A2V6I0I8-F1-model_v4 DUF1059 domain-containing protein 0.979 3 63

Map