F472103
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 645 | 299 | 645 | 67 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_102121942|Ga0070668_1021219422 |
| Length | 78 |
| Sequence | VDNTVAQSNNTMANERTDSKGSGTMKVTLLRSPIGFNRNQLAVVKSLGLRRIRHTVEIKDTPAMRGMVHKVRHLVEVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090002 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 179 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 183 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 191 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 204 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 205 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 206 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 297 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.91 |
| Metatranscriptomes | 1.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.62 |
| Nodule | 0 |
| Rhizoplane | 3.41 |
| Rhizosphere | 95.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNA_F6ESG4R02F99NE | 2088090002 | Bacteria | 519 |
| 2 | JGI24751J29686_10002990 | 3300002459 | Bacteria | 3413 |
| 3 | JGI24751J29686_10080272 | 3300002459 | Bacteria | 676 |
| 4 | Ga0058863_11687864 | 3300004799 | Unclassified | 507 |
| 5 | Ga0058861_10070191 | 3300004800 | Bacteria | 1718 |
| 6 | Ga0058862_12512468 | 3300004803 | Bacteria | 861 |
| 7 | Ga0058862_12835766 | 3300004803 | Bacteria | 1387 |
| 8 | Ga0058862_12893714 | 3300004803 | Bacteria | 1913 |
| 9 | Ga0065714_10329800 | 3300005288 | Bacteria | 594 |
| 10 | Ga0065712_10071314 | 3300005290 | Bacteria | 5345 |
| 11 | Ga0065712_10101699 | 3300005290 | Bacteria | 2027 |
| 12 | Ga0065712_10269749 | 3300005290 | Bacteria | 911 |
| 13 | Ga0065712_10518856 | 3300005290 | Bacteria | 604 |
| 14 | Ga0065712_10605422 | 3300005290 | Bacteria | 588 |
| 15 | Ga0065712_10628472 | 3300005290 | Bacteria | 577 |
| 16 | Ga0065715_10422444 | 3300005293 | Bacteria | 856 |
| 17 | Ga0065715_10520569 | 3300005293 | Bacteria | 764 |
| 18 | Ga0065707_10173975 | 3300005295 | Bacteria | 1464 |
| 19 | Ga0070658_10302065 | 3300005327 | Bacteria | 1365 |
| 20 | Ga0070658_11694789 | 3300005327 | Bacteria | 547 |
| 21 | Ga0070683_100261901 | 3300005329 | Bacteria | 1645 |
| 22 | Ga0070683_101286941 | 3300005329 | Bacteria | 703 |
| 23 | Ga0070690_100665097 | 3300005330 | Bacteria | 797 |
| 24 | Ga0070670_100050949 | 3300005331 | Bacteria | 3557 |
| 25 | Ga0070670_100278888 | 3300005331 | Bacteria | 1459 |
| 26 | Ga0070670_100596116 | 3300005331 | Bacteria | 988 |
| 27 | Ga0070670_100911954 | 3300005331 | Bacteria | 797 |
| 28 | Ga0070670_102197235 | 3300005331 | Bacteria | 508 |
| 29 | Ga0070677_10104469 | 3300005333 | Bacteria | 1255 |
| 30 | Ga0070677_10140954 | 3300005333 | Bacteria | 1112 |
| 31 | Ga0068869_100139170 | 3300005334 | Bacteria | 1873 |
| 32 | Ga0068869_100271176 | 3300005334 | Bacteria | 1361 |
| 33 | Ga0068869_100338717 | 3300005334 | Bacteria | 1223 |
| 34 | Ga0068869_101174195 | 3300005334 | Bacteria | 674 |
| 35 | Ga0068869_101488801 | 3300005334 | Bacteria | 601 |
| 36 | Ga0070666_10501666 | 3300005335 | Bacteria | 880 |
| 37 | Ga0070666_10551035 | 3300005335 | Bacteria | 839 |
| 38 | Ga0070666_11123088 | 3300005335 | Bacteria | 585 |
| 39 | Ga0070680_100345010 | 3300005336 | Bacteria | 1266 |
| 40 | Ga0070682_100148242 | 3300005337 | Bacteria | 1607 |
| 41 | Ga0068868_100322874 | 3300005338 | Bacteria | 1315 |
| 42 | Ga0070660_100002987 | 3300005339 | Bacteria | 11642 |
| 43 | Ga0070660_100138512 | 3300005339 | Bacteria | 1951 |
| 44 | Ga0070689_100210129 | 3300005340 | Bacteria | 1592 |
| 45 | Ga0070689_101793862 | 3300005340 | Unclassified | 559 |
| 46 | Ga0070691_10753841 | 3300005341 | Bacteria | 589 |
| 47 | Ga0070661_100460429 | 3300005344 | Bacteria | 1013 |
| 48 | Ga0070661_101595586 | 3300005344 | Bacteria | 552 |
| 49 | Ga0070668_101574622 | 3300005347 | Bacteria | 602 |
| 50 | Ga0070668_102121942 | 3300005347 | Bacteria | 519 |
| 51 | Ga0070669_100266395 | 3300005353 | Bacteria | 1369 |
| 52 | Ga0070675_100315632 | 3300005354 | Bacteria | 1380 |
| 53 | Ga0070675_100503460 | 3300005354 | Bacteria | 1091 |
| 54 | Ga0070671_100435498 | 3300005355 | Bacteria | 1124 |
| 55 | Ga0070671_101544139 | 3300005355 | Bacteria | 588 |
| 56 | Ga0070674_100046049 | 3300005356 | Bacteria | 2982 |
| 57 | Ga0070674_100078891 | 3300005356 | Bacteria | 2347 |
| 58 | Ga0070674_101067818 | 3300005356 | Bacteria | 712 |
| 59 | Ga0070674_102019813 | 3300005356 | Bacteria | 525 |
| 60 | Ga0070673_100003427 | 3300005364 | Bacteria | 9877 |
| 61 | Ga0070673_100117740 | 3300005364 | Bacteria | 2211 |
| 62 | Ga0070673_100650339 | 3300005364 | Bacteria | 965 |
| 63 | Ga0070673_100950529 | 3300005364 | Bacteria | 798 |
| 64 | Ga0070688_100408199 | 3300005365 | Bacteria | 1007 |
| 65 | Ga0070688_100489627 | 3300005365 | Bacteria | 926 |
| 66 | Ga0070688_100656809 | 3300005365 | Bacteria | 808 |
| 67 | Ga0070688_101438511 | 3300005365 | Bacteria | 559 |
| 68 | Ga0070659_101495240 | 3300005366 | Bacteria | 602 |
| 69 | Ga0070667_100168474 | 3300005367 | Bacteria | 1932 |
| 70 | Ga0070667_100423262 | 3300005367 | Bacteria | 1214 |
| 71 | Ga0070667_101014034 | 3300005367 | Bacteria | 775 |
| 72 | Ga0070667_101310295 | 3300005367 | Bacteria | 679 |
| 73 | Ga0070667_101786484 | 3300005367 | Bacteria | 579 |
| 74 | Ga0070667_101815461 | 3300005367 | Bacteria | 574 |
| 75 | Ga0070709_10020289 | 3300005434 | Bacteria | 3854 |
| 76 | Ga0070713_101514279 | 3300005436 | Unclassified | 651 |
| 77 | Ga0070710_10097350 | 3300005437 | Bacteria | 1746 |
| 78 | Ga0070705_100732958 | 3300005440 | Bacteria | 780 |
| 79 | Ga0070705_101120349 | 3300005440 | Bacteria | 645 |
| 80 | Ga0070700_100548056 | 3300005441 | Bacteria | 898 |
| 81 | Ga0070700_101074592 | 3300005441 | Bacteria | 666 |
| 82 | Ga0070700_101148122 | 3300005441 | Bacteria | 646 |
| 83 | Ga0070694_100871495 | 3300005444 | Bacteria | 742 |
| 84 | Ga0070708_101240510 | 3300005445 | Bacteria | 697 |
| 85 | Ga0070678_100233115 | 3300005456 | Bacteria | 1536 |
| 86 | Ga0070662_100851136 | 3300005457 | Bacteria | 776 |
| 87 | Ga0070662_101626249 | 3300005457 | Bacteria | 558 |
| 88 | Ga0070662_101945811 | 3300005457 | Bacteria | 508 |
| 89 | Ga0070681_10019826 | 3300005458 | Bacteria | 6735 |
| 90 | Ga0068867_100513996 | 3300005459 | Bacteria | 1031 |
| 91 | Ga0068867_101847949 | 3300005459 | Bacteria | 569 |
| 92 | Ga0070685_10580950 | 3300005466 | Bacteria | 804 |
| 93 | Ga0070685_11308965 | 3300005466 | Bacteria | 554 |
| 94 | Ga0070698_101511185 | 3300005471 | Bacteria | 623 |
| 95 | Ga0070699_100119032 | 3300005518 | Bacteria | 2322 |
| 96 | Ga0070699_100164340 | 3300005518 | Bacteria | 1966 |
| 97 | Ga0070699_101586749 | 3300005518 | Bacteria | 600 |
| 98 | Ga0070699_101775577 | 3300005518 | Bacteria | 565 |
| 99 | Ga0070679_100044653 | 3300005530 | Bacteria | 4415 |
| 100 | Ga0070679_100084074 | 3300005530 | Bacteria | 3171 |
| 101 | Ga0070684_100338991 | 3300005535 | Bacteria | 1382 |
| 102 | Ga0070684_100709529 | 3300005535 | Bacteria | 938 |
| 103 | Ga0070684_102230004 | 3300005535 | Bacteria | 517 |
| 104 | Ga0070697_100842893 | 3300005536 | Bacteria | 812 |
| 105 | Ga0068853_100264579 | 3300005539 | Bacteria | 1582 |
| 106 | Ga0070672_100287420 | 3300005543 | Bacteria | 1392 |
| 107 | Ga0070672_100428160 | 3300005543 | Bacteria | 1137 |
| 108 | Ga0070686_100282478 | 3300005544 | Bacteria | 1225 |
| 109 | Ga0070686_100335256 | 3300005544 | Bacteria | 1132 |
| 110 | Ga0070695_100404437 | 3300005545 | Bacteria | 1036 |
| 111 | Ga0070696_100848751 | 3300005546 | Bacteria | 755 |
| 112 | Ga0070696_101166463 | 3300005546 | Bacteria | 650 |
| 113 | Ga0070665_100005447 | 3300005548 | Bacteria | 13122 |
| 114 | Ga0070665_100663567 | 3300005548 | Bacteria | 1056 |
| 115 | Ga0070704_101248001 | 3300005549 | Bacteria | 679 |
| 116 | Ga0070704_101347523 | 3300005549 | Bacteria | 654 |
| 117 | Ga0068855_100286434 | 3300005563 | Bacteria | 1827 |
| 118 | Ga0068855_100421940 | 3300005563 | Bacteria | 1459 |
| 119 | Ga0068855_100534530 | 3300005563 | Bacteria | 1271 |
| 120 | Ga0068855_100868726 | 3300005563 | Bacteria | 955 |
| 121 | Ga0068855_101104655 | 3300005563 | Bacteria | 829 |
| 122 | Ga0070664_100461940 | 3300005564 | Bacteria | 1166 |
| 123 | Ga0070664_100723900 | 3300005564 | Bacteria | 928 |
| 124 | Ga0070664_100812333 | 3300005564 | Bacteria | 875 |
| 125 | Ga0070664_100843581 | 3300005564 | Bacteria | 858 |
| 126 | Ga0070664_101612142 | 3300005564 | Bacteria | 615 |
| 127 | Ga0070664_101695089 | 3300005564 | Unclassified | 599 |
| 128 | Ga0068857_101894243 | 3300005577 | Bacteria | 584 |
| 129 | Ga0068854_100428672 | 3300005578 | Bacteria | 1100 |
| 130 | Ga0068854_101091286 | 3300005578 | Bacteria | 711 |
| 131 | Ga0068854_101671245 | 3300005578 | Bacteria | 582 |
| 132 | Ga0068854_102054371 | 3300005578 | Bacteria | 527 |
| 133 | Ga0068856_100018557 | 3300005614 | Bacteria | 6740 |
| 134 | Ga0070702_100647573 | 3300005615 | Bacteria | 799 |
| 135 | Ga0070702_101366398 | 3300005615 | Bacteria | 578 |
| 136 | Ga0068852_100647787 | 3300005616 | Bacteria | 1064 |
| 137 | Ga0068852_102051610 | 3300005616 | Bacteria | 594 |
| 138 | Ga0068852_102268577 | 3300005616 | Bacteria | 564 |
| 139 | Ga0068859_100573752 | 3300005617 | Bacteria | 1222 |
| 140 | Ga0068859_101413220 | 3300005617 | Bacteria | 767 |
| 141 | Ga0068859_102313179 | 3300005617 | Bacteria | 593 |
| 142 | Ga0068864_100385694 | 3300005618 | Bacteria | 1329 |
| 143 | Ga0068864_100497372 | 3300005618 | Bacteria | 1172 |
| 144 | Ga0068864_100580014 | 3300005618 | Bacteria | 1086 |
| 145 | Ga0068864_101084216 | 3300005618 | Bacteria | 797 |
| 146 | Ga0068866_10457970 | 3300005718 | Bacteria | 836 |
| 147 | Ga0068861_100196584 | 3300005719 | Bacteria | 1690 |
| 148 | Ga0068861_100326592 | 3300005719 | Bacteria | 1338 |
| 149 | Ga0068861_100451931 | 3300005719 | Bacteria | 1151 |
| 150 | Ga0068861_100496389 | 3300005719 | Bacteria | 1102 |
| 151 | Ga0068861_102301584 | 3300005719 | Bacteria | 541 |
| 152 | Ga0068851_10998528 | 3300005834 | Bacteria | 528 |
| 153 | Ga0068870_10198737 | 3300005840 | Bacteria | 1214 |
| 154 | Ga0068870_11290736 | 3300005840 | Bacteria | 531 |
| 155 | Ga0068863_100116322 | 3300005841 | Bacteria | 2548 |
| 156 | Ga0068863_100127685 | 3300005841 | Bacteria | 2427 |
| 157 | Ga0068863_101247544 | 3300005841 | Bacteria | 750 |
| 158 | Ga0068858_100133765 | 3300005842 | Bacteria | 2326 |
| 159 | Ga0068858_100411153 | 3300005842 | Bacteria | 1300 |
| 160 | Ga0068858_101550906 | 3300005842 | Bacteria | 653 |
| 161 | Ga0068860_100304719 | 3300005843 | Bacteria | 1561 |
| 162 | Ga0068860_100344425 | 3300005843 | Bacteria | 1466 |
| 163 | Ga0068860_100725428 | 3300005843 | Bacteria | 1004 |
| 164 | Ga0068860_101415446 | 3300005843 | Bacteria | 716 |
| 165 | Ga0068860_101655613 | 3300005843 | Bacteria | 662 |
| 166 | Ga0068862_100130660 | 3300005844 | Bacteria | 2221 |
| 167 | Ga0068862_100556118 | 3300005844 | Bacteria | 1096 |
| 168 | Ga0068862_101632664 | 3300005844 | Unclassified | 652 |
| 169 | Ga0068862_101975256 | 3300005844 | Bacteria | 594 |
| 170 | Ga0068862_102242035 | 3300005844 | Bacteria | 558 |
| 171 | Ga0068862_102242425 | 3300005844 | Bacteria | 558 |
| 172 | Ga0068862_102299841 | 3300005844 | Bacteria | 551 |
| 173 | Ga0081455_10174261 | 3300005937 | Bacteria | 1635 |
| 174 | Ga0081455_10833757 | 3300005937 | Unclassified | 577 |
| 175 | Ga0070715_10237715 | 3300006163 | Bacteria | 946 |
| 176 | Ga0070715_10935810 | 3300006163 | Unclassified | 536 |
| 177 | Ga0070716_100341366 | 3300006173 | Bacteria | 1057 |
| 178 | Ga0075367_10258480 | 3300006178 | Bacteria | 1093 |
| 179 | Ga0097621_100020231 | 3300006237 | Bacteria | 5126 |
| 180 | Ga0097621_100118810 | 3300006237 | Bacteria | 2241 |
| 181 | Ga0097621_100147924 | 3300006237 | Bacteria | 2013 |
| 182 | Ga0068871_100006055 | 3300006358 | Bacteria | 8509 |
| 183 | Ga0068871_100148240 | 3300006358 | Bacteria | 2000 |
| 184 | Ga0068871_100460996 | 3300006358 | Bacteria | 1141 |
| 185 | Ga0075428_100312003 | 3300006844 | Bacteria | 1690 |
| 186 | Ga0075428_102132995 | 3300006844 | Unclassified | 579 |
| 187 | Ga0075433_10128181 | 3300006852 | Bacteria | 2254 |
| 188 | Ga0075433_11282772 | 3300006852 | Bacteria | 635 |
| 189 | Ga0075434_101943943 | 3300006871 | Bacteria | 594 |
| 190 | Ga0075429_100522210 | 3300006880 | Bacteria | 1040 |
| 191 | Ga0068865_100006729 | 3300006881 | Bacteria | 7032 |
| 192 | Ga0068865_100391738 | 3300006881 | Bacteria | 1136 |
| 193 | Ga0068865_100715964 | 3300006881 | Bacteria | 857 |
| 194 | Ga0068865_101055817 | 3300006881 | Bacteria | 714 |
| 195 | Ga0075436_100028497 | 3300006914 | Bacteria | 3842 |
| 196 | Ga0097620_100573707 | 3300006931 | Bacteria | 1222 |
| 197 | Ga0097620_101413166 | 3300006931 | Bacteria | 767 |
| 198 | Ga0097620_102312791 | 3300006931 | Bacteria | 593 |
| 199 | Ga0075435_101236869 | 3300007076 | Bacteria | 653 |
| 200 | Ga0105251_10210348 | 3300009011 | Bacteria | 876 |
| 201 | Ga0105240_10045226 | 3300009093 | Bacteria | 5587 |
| 202 | Ga0105240_10177867 | 3300009093 | Bacteria | 2514 |
| 203 | Ga0105240_10887187 | 3300009093 | Bacteria | 960 |
| 204 | Ga0105245_10607498 | 3300009098 | Bacteria | 1121 |
| 205 | Ga0105245_10689778 | 3300009098 | Bacteria | 1054 |
| 206 | Ga0105245_11313691 | 3300009098 | Bacteria | 772 |
| 207 | Ga0105245_12152927 | 3300009098 | Bacteria | 611 |
| 208 | Ga0105245_12545687 | 3300009098 | Unclassified | 565 |
| 209 | Ga0105247_10004209 | 3300009101 | Bacteria | 9230 |
| 210 | Ga0114129_10123569 | 3300009147 | Bacteria | 3560 |
| 211 | Ga0114129_10150048 | 3300009147 | Bacteria | 3190 |
| 212 | Ga0114129_11155727 | 3300009147 | Bacteria | 966 |
| 213 | Ga0114129_11235126 | 3300009147 | Bacteria | 929 |
| 214 | Ga0114129_12294442 | 3300009147 | Bacteria | 648 |
| 215 | Ga0105243_10245118 | 3300009148 | Bacteria | 1597 |
| 216 | Ga0105243_10952956 | 3300009148 | Bacteria | 857 |
| 217 | Ga0105241_11270462 | 3300009174 | Bacteria | 700 |
| 218 | Ga0105241_11696682 | 3300009174 | Bacteria | 614 |
| 219 | Ga0105241_12533961 | 3300009174 | Unclassified | 514 |
| 220 | Ga0105242_10067271 | 3300009176 | Bacteria | 2962 |
| 221 | Ga0105242_10177665 | 3300009176 | Bacteria | 1876 |
| 222 | Ga0105242_10901770 | 3300009176 | Bacteria | 884 |
| 223 | Ga0105242_12782863 | 3300009176 | Bacteria | 539 |
| 224 | Ga0105248_10013460 | 3300009177 | Bacteria | 9007 |
| 225 | Ga0105248_10019507 | 3300009177 | Bacteria | 7503 |
| 226 | Ga0105248_10224670 | 3300009177 | Bacteria | 2114 |
| 227 | Ga0105248_10448915 | 3300009177 | Bacteria | 1453 |
| 228 | Ga0105248_10481300 | 3300009177 | Bacteria | 1399 |
| 229 | Ga0105248_10719068 | 3300009177 | Bacteria | 1127 |
| 230 | Ga0105248_10819264 | 3300009177 | Bacteria | 1051 |
| 231 | Ga0105248_11783822 | 3300009177 | Bacteria | 698 |
| 232 | Ga0105248_13243032 | 3300009177 | Bacteria | 517 |
| 233 | Ga0105237_11729579 | 3300009545 | Bacteria | 633 |
| 234 | Ga0105238_10125557 | 3300009551 | Bacteria | 2545 |
| 235 | Ga0105238_12725545 | 3300009551 | Bacteria | 531 |
| 236 | Ga0105249_10205139 | 3300009553 | Bacteria | 1931 |
| 237 | Ga0105249_10936999 | 3300009553 | Bacteria | 934 |
| 238 | Ga0105249_11617360 | 3300009553 | Bacteria | 720 |
| 239 | Ga0105249_12292786 | 3300009553 | Bacteria | 613 |
| 240 | Ga0105249_13304575 | 3300009553 | Bacteria | 519 |
| 241 | Ga0099796_10030103 | 3300010159 | Bacteria | 1758 |
| 242 | Ga0105239_10725470 | 3300010375 | Bacteria | 1137 |
| 243 | Ga0105246_10270358 | 3300011119 | Bacteria | 1358 |
| 244 | Ga0105246_10667877 | 3300011119 | Bacteria | 907 |
| 245 | Ga0105246_10811883 | 3300011119 | Bacteria | 831 |
| 246 | Ga0157369_11245679 | 3300013105 | Bacteria | 759 |
| 247 | Ga0157378_10363162 | 3300013297 | Bacteria | 1417 |
| 248 | Ga0157378_11149159 | 3300013297 | Bacteria | 815 |
| 249 | Ga0157378_11186863 | 3300013297 | Bacteria | 802 |
| 250 | Ga0157378_12234604 | 3300013297 | Bacteria | 598 |
| 251 | Ga0163162_10519827 | 3300013306 | Bacteria | 1320 |
| 252 | Ga0163162_11473787 | 3300013306 | Bacteria | 775 |
| 253 | Ga0163162_13114052 | 3300013306 | Bacteria | 532 |
| 254 | Ga0163162_13287241 | 3300013306 | Bacteria | 518 |
| 255 | Ga0163162_13325897 | 3300013306 | Bacteria | 514 |
| 256 | Ga0157375_10444566 | 3300013308 | Bacteria | 1462 |
| 257 | Ga0157375_10766805 | 3300013308 | Bacteria | 1115 |
| 258 | Ga0157375_12472611 | 3300013308 | Unclassified | 620 |
| 259 | Ga0163163_10087285 | 3300014325 | Bacteria | 3130 |
| 260 | Ga0163163_10319094 | 3300014325 | Bacteria | 1607 |
| 261 | Ga0163163_10548084 | 3300014325 | Bacteria | 1219 |
| 262 | Ga0163163_10641362 | 3300014325 | Bacteria | 1126 |
| 263 | Ga0163163_11731632 | 3300014325 | Bacteria | 686 |
| 264 | Ga0157380_10280688 | 3300014326 | Bacteria | 1524 |
| 265 | Ga0157380_13426170 | 3300014326 | Bacteria | 508 |
| 266 | Ga0157380_13507926 | 3300014326 | Unclassified | 502 |
| 267 | Ga0157377_10660678 | 3300014745 | Bacteria | 754 |
| 268 | Ga0157379_10356802 | 3300014968 | Bacteria | 1339 |
| 269 | Ga0157379_11456189 | 3300014968 | Bacteria | 665 |
| 270 | Ga0157379_11748557 | 3300014968 | Bacteria | 610 |
| 271 | Ga0157379_12387208 | 3300014968 | Bacteria | 528 |
| 272 | Ga0157376_10414998 | 3300014969 | Bacteria | 1305 |
| 273 | Ga0157376_10510102 | 3300014969 | Bacteria | 1183 |
| 274 | Ga0157376_11266519 | 3300014969 | Bacteria | 767 |
| 275 | Ga0157376_11434349 | 3300014969 | Bacteria | 722 |
| 276 | Ga0157376_12045711 | 3300014969 | Bacteria | 611 |
| 277 | Ga0163161_10812730 | 3300017792 | Bacteria | 786 |
| 278 | Ga0224712_10584166 | 3300022467 | Unclassified | 545 |
| 279 | Ga0207697_10232639 | 3300025315 | Bacteria | 814 |
| 280 | Ga0207682_10094553 | 3300025893 | Bacteria | 1300 |
| 281 | Ga0207692_10181644 | 3300025898 | Bacteria | 1226 |
| 282 | Ga0207692_11158308 | 3300025898 | Bacteria | 513 |
| 283 | Ga0207642_10258962 | 3300025899 | Bacteria | 991 |
| 284 | Ga0207688_10190402 | 3300025901 | Bacteria | 1227 |
| 285 | Ga0207688_10559536 | 3300025901 | Bacteria | 719 |
| 286 | Ga0207688_10745755 | 3300025901 | Bacteria | 620 |
| 287 | Ga0207680_10942505 | 3300025903 | Bacteria | 619 |
| 288 | Ga0207685_10776622 | 3300025905 | Bacteria | 526 |
| 289 | Ga0207699_10014062 | 3300025906 | Bacteria | 4113 |
| 290 | Ga0207645_10479675 | 3300025907 | Bacteria | 841 |
| 291 | Ga0207643_10090349 | 3300025908 | Bacteria | 1785 |
| 292 | Ga0207705_10546213 | 3300025909 | Bacteria | 901 |
| 293 | Ga0207705_11076000 | 3300025909 | Bacteria | 620 |
| 294 | Ga0207654_10223831 | 3300025911 | Bacteria | 1249 |
| 295 | Ga0207707_10042746 | 3300025912 | Bacteria | 3954 |
| 296 | Ga0207707_10599424 | 3300025912 | Bacteria | 933 |
| 297 | Ga0207695_10084625 | 3300025913 | Bacteria | 3202 |
| 298 | Ga0207695_10131709 | 3300025913 | Bacteria | 2458 |
| 299 | Ga0207695_10350332 | 3300025913 | Bacteria | 1364 |
| 300 | Ga0207660_10141452 | 3300025917 | Bacteria | 1840 |
| 301 | Ga0207657_10013143 | 3300025919 | Bacteria | 8130 |
| 302 | Ga0207657_10149049 | 3300025919 | Bacteria | 1906 |
| 303 | Ga0207649_10659408 | 3300025920 | Bacteria | 809 |
| 304 | Ga0207649_10910409 | 3300025920 | Bacteria | 690 |
| 305 | Ga0207652_10085259 | 3300025921 | Bacteria | 2768 |
| 306 | Ga0207652_10607803 | 3300025921 | Bacteria | 980 |
| 307 | Ga0207681_10215274 | 3300025923 | Bacteria | 1483 |
| 308 | Ga0207694_10150838 | 3300025924 | Bacteria | 1873 |
| 309 | Ga0207694_10487438 | 3300025924 | Bacteria | 1031 |
| 310 | Ga0207650_10063849 | 3300025925 | Bacteria | 2755 |
| 311 | Ga0207650_10193461 | 3300025925 | Bacteria | 1626 |
| 312 | Ga0207650_10400909 | 3300025925 | Bacteria | 1135 |
| 313 | Ga0207650_10731305 | 3300025925 | Bacteria | 837 |
| 314 | Ga0207659_10308581 | 3300025926 | Bacteria | 1302 |
| 315 | Ga0207659_10350045 | 3300025926 | Bacteria | 1225 |
| 316 | Ga0207659_10525156 | 3300025926 | Bacteria | 1004 |
| 317 | Ga0207659_10638716 | 3300025926 | Bacteria | 909 |
| 318 | Ga0207687_10329664 | 3300025927 | Bacteria | 1238 |
| 319 | Ga0207687_10462116 | 3300025927 | Bacteria | 1054 |
| 320 | Ga0207687_11437491 | 3300025927 | Unclassified | 592 |
| 321 | Ga0207700_11330332 | 3300025928 | Unclassified | 640 |
| 322 | Ga0207644_11009988 | 3300025931 | Bacteria | 698 |
| 323 | Ga0207690_10232957 | 3300025932 | Bacteria | 1415 |
| 324 | Ga0207690_10727685 | 3300025932 | Bacteria | 817 |
| 325 | Ga0207706_10812443 | 3300025933 | Bacteria | 794 |
| 326 | Ga0207706_11353126 | 3300025933 | Bacteria | 586 |
| 327 | Ga0207686_10013361 | 3300025934 | Bacteria | 4541 |
| 328 | Ga0207686_10519480 | 3300025934 | Bacteria | 926 |
| 329 | Ga0207709_11010645 | 3300025935 | Bacteria | 680 |
| 330 | Ga0207669_10392616 | 3300025937 | Bacteria | 1084 |
| 331 | Ga0207669_10788056 | 3300025937 | Bacteria | 787 |
| 332 | Ga0207669_11819998 | 3300025937 | Unclassified | 520 |
| 333 | Ga0207704_10005828 | 3300025938 | Bacteria | 5701 |
| 334 | Ga0207704_11306999 | 3300025938 | Bacteria | 620 |
| 335 | Ga0207665_11330151 | 3300025939 | Bacteria | 573 |
| 336 | Ga0207691_10197382 | 3300025940 | Bacteria | 1752 |
| 337 | Ga0207691_10419050 | 3300025940 | Bacteria | 1141 |
| 338 | Ga0207691_11004862 | 3300025940 | Bacteria | 696 |
| 339 | Ga0207711_10026433 | 3300025941 | Bacteria | 4870 |
| 340 | Ga0207711_10136539 | 3300025941 | Bacteria | 2203 |
| 341 | Ga0207711_10422755 | 3300025941 | Bacteria | 1239 |
| 342 | Ga0207711_10480730 | 3300025941 | Bacteria | 1157 |
| 343 | Ga0207711_10561479 | 3300025941 | Bacteria | 1065 |
| 344 | Ga0207711_10746099 | 3300025941 | Bacteria | 912 |
| 345 | Ga0207711_11004973 | 3300025941 | Bacteria | 774 |
| 346 | Ga0207711_11650168 | 3300025941 | Bacteria | 584 |
| 347 | Ga0207689_10034411 | 3300025942 | Bacteria | 4209 |
| 348 | Ga0207689_10062920 | 3300025942 | Bacteria | 3052 |
| 349 | Ga0207689_10365682 | 3300025942 | Bacteria | 1200 |
| 350 | Ga0207689_10618427 | 3300025942 | Bacteria | 912 |
| 351 | Ga0207689_10772295 | 3300025942 | Bacteria | 811 |
| 352 | Ga0207689_10891739 | 3300025942 | Bacteria | 750 |
| 353 | Ga0207679_10392851 | 3300025945 | Bacteria | 1218 |
| 354 | Ga0207679_10395275 | 3300025945 | Bacteria | 1215 |
| 355 | Ga0207679_10885125 | 3300025945 | Bacteria | 816 |
| 356 | Ga0207679_10967676 | 3300025945 | Bacteria | 780 |
| 357 | Ga0207679_11684293 | 3300025945 | Bacteria | 580 |
| 358 | Ga0207667_10168529 | 3300025949 | Bacteria | 2251 |
| 359 | Ga0207667_10380613 | 3300025949 | Bacteria | 1438 |
| 360 | Ga0207667_11051211 | 3300025949 | Bacteria | 799 |
| 361 | Ga0207667_11569865 | 3300025949 | Bacteria | 627 |
| 362 | Ga0207651_10041000 | 3300025960 | Bacteria | 3069 |
| 363 | Ga0207651_10110459 | 3300025960 | Bacteria | 2062 |
| 364 | Ga0207651_12040288 | 3300025960 | Bacteria | 515 |
| 365 | Ga0207712_10447401 | 3300025961 | Bacteria | 1095 |
| 366 | Ga0207712_10979130 | 3300025961 | Bacteria | 750 |
| 367 | Ga0207712_11432289 | 3300025961 | Bacteria | 618 |
| 368 | Ga0207640_10114374 | 3300025981 | Bacteria | 1920 |
| 369 | Ga0207640_11200014 | 3300025981 | Bacteria | 675 |
| 370 | Ga0207640_11814302 | 3300025981 | Bacteria | 551 |
| 371 | Ga0207658_10945183 | 3300025986 | Bacteria | 786 |
| 372 | Ga0207677_10266317 | 3300026023 | Bacteria | 1399 |
| 373 | Ga0207677_10762861 | 3300026023 | Bacteria | 863 |
| 374 | Ga0207703_10116219 | 3300026035 | Bacteria | 2290 |
| 375 | Ga0207703_11140074 | 3300026035 | Bacteria | 749 |
| 376 | Ga0207703_12206250 | 3300026035 | Bacteria | 527 |
| 377 | Ga0207639_11714702 | 3300026041 | Bacteria | 589 |
| 378 | Ga0207639_11730632 | 3300026041 | Bacteria | 586 |
| 379 | Ga0207678_10226816 | 3300026067 | Bacteria | 1599 |
| 380 | Ga0207678_10382018 | 3300026067 | Bacteria | 1218 |
| 381 | Ga0207708_10881091 | 3300026075 | Bacteria | 774 |
| 382 | Ga0207708_10948384 | 3300026075 | Bacteria | 746 |
| 383 | Ga0207702_10262266 | 3300026078 | Bacteria | 1627 |
| 384 | Ga0207702_12346875 | 3300026078 | Bacteria | 521 |
| 385 | Ga0207641_10319476 | 3300026088 | Bacteria | 1472 |
| 386 | Ga0207641_10538452 | 3300026088 | Bacteria | 1137 |
| 387 | Ga0207641_10571695 | 3300026088 | Bacteria | 1104 |
| 388 | Ga0207641_10752171 | 3300026088 | Bacteria | 962 |
| 389 | Ga0207641_11010931 | 3300026088 | Bacteria | 828 |
| 390 | Ga0207641_11685763 | 3300026088 | Bacteria | 636 |
| 391 | Ga0207641_12543463 | 3300026088 | Bacteria | 510 |
| 392 | Ga0207648_11067706 | 3300026089 | Bacteria | 757 |
| 393 | Ga0207676_10069079 | 3300026095 | Bacteria | 2828 |
| 394 | Ga0207676_10259868 | 3300026095 | Bacteria | 1567 |
| 395 | Ga0207676_10990839 | 3300026095 | Bacteria | 828 |
| 396 | Ga0207674_10062761 | 3300026116 | Bacteria | 3752 |
| 397 | Ga0207674_10203527 | 3300026116 | Bacteria | 1929 |
| 398 | Ga0207674_10741845 | 3300026116 | Bacteria | 948 |
| 399 | Ga0207674_12260899 | 3300026116 | Bacteria | 506 |
| 400 | Ga0207675_100036086 | 3300026118 | Bacteria | 4611 |
| 401 | Ga0207675_100588336 | 3300026118 | Bacteria | 1115 |
| 402 | Ga0207675_100703465 | 3300026118 | Bacteria | 1020 |
| 403 | Ga0207675_102402739 | 3300026118 | Bacteria | 539 |
| 404 | Ga0207698_10803886 | 3300026142 | Bacteria | 943 |
| 405 | Ga0209974_10068780 | 3300027876 | Bacteria | 1206 |
| 406 | Ga0207428_10107542 | 3300027907 | Bacteria | 2149 |
| 407 | Ga0268266_10439711 | 3300028379 | Bacteria | 1238 |
| 408 | Ga0268266_11584602 | 3300028379 | Bacteria | 630 |
| 409 | Ga0268266_11703262 | 3300028379 | Unclassified | 606 |
| 410 | Ga0268265_10374275 | 3300028380 | Bacteria | 1308 |
| 411 | Ga0268265_12107161 | 3300028380 | Bacteria | 571 |
| 412 | Ga0268265_12213937 | 3300028380 | Bacteria | 557 |
| 413 | Ga0268265_12311931 | 3300028380 | Unclassified | 544 |
| 414 | Ga0268264_10042810 | 3300028381 | Bacteria | 3749 |
| 415 | Ga0268264_10630972 | 3300028381 | Bacteria | 1059 |
| 416 | Ga0268264_10759201 | 3300028381 | Bacteria | 967 |
| 417 | Ga0268264_11352914 | 3300028381 | Bacteria | 722 |
| 418 | Ga0268264_11502035 | 3300028381 | Bacteria | 684 |
| 419 | Ga0265332_10048353 | 3300031238 | Bacteria | 1830 |
| 420 | Ga0307408_100880662 | 3300031548 | Bacteria | 818 |
| 421 | Ga0265314_10007579 | 3300031711 | Bacteria | 9400 |
| 422 | Ga0307410_11006253 | 3300031852 | Bacteria | 719 |
| 423 | Ga0307416_100160347 | 3300032002 | Bacteria | 2078 |
| 424 | Ga0307411_11200009 | 3300032005 | Bacteria | 688 |
| 425 | Ga0373926_0217316 | 3300035083 | Bacteria | 737 |
| 426 | Ga0373940_0119908 | 3300035088 | Bacteria | 815 |
| 427 | Ga0373944_0043759 | 3300035089 | Bacteria | 1392 |
| 428 | Ga0373944_0073733 | 3300035089 | Bacteria | 1116 |
| 429 | Ga0373949_0033224 | 3300035090 | Bacteria | 1239 |
| 430 | Ga0373949_0124773 | 3300035090 | Bacteria | 726 |
| 431 | Ga0373952_0078480 | 3300035092 | Bacteria | 839 |
| 432 | Ga0373932_0056975 | 3300035112 | Bacteria | 1177 |
| 433 | Ga0373936_0066682 | 3300035113 | Bacteria | 1478 |
| 434 | Ga0373936_0092396 | 3300035113 | Bacteria | 1270 |
| 435 | Ga0373936_0429403 | 3300035113 | Bacteria | 609 |
| 436 | Ga0373939_0495396 | 3300035114 | Bacteria | 521 |
| 437 | Ga0373941_0032565 | 3300035115 | Bacteria | 1561 |
| 438 | Ga0373945_0035271 | 3300035116 | Bacteria | 1787 |
| 439 | Ga0373953_0044678 | 3300035117 | Bacteria | 1772 |
| 440 | Ga0373953_0166198 | 3300035117 | Bacteria | 949 |
| 441 | Ga0373953_0357585 | 3300035117 | Bacteria | 640 |
| 442 | Ga0373956_0208787 | 3300035119 | Bacteria | 926 |
| 443 | Ga0373956_0318300 | 3300035119 | Bacteria | 741 |
| 444 | Ga0373956_0434951 | 3300035119 | Bacteria | 626 |
| 445 | Ga0373957_0393842 | 3300035120 | Bacteria | 595 |
| 446 | Ga0373960_0314377 | 3300035121 | Bacteria | 586 |
| 447 | Ga0373943_0036985 | 3300035170 | Bacteria | 2341 |
| 448 | Ga0373943_0227905 | 3300035170 | Bacteria | 1040 |
| 449 | Ga0373946_0550365 | 3300035171 | Bacteria | 595 |
| 450 | Ga0373946_0614479 | 3300035171 | Bacteria | 564 |
| 451 | Ga0373955_0059904 | 3300035172 | Bacteria | 2098 |
| 452 | Ga0373955_0117147 | 3300035172 | Bacteria | 1545 |
| 453 | Ga0373962_0020596 | 3300035242 | Bacteria | 1733 |
| 454 | Ga0373962_0119812 | 3300035242 | Bacteria | 838 |
| 455 | Ga0373924_0284127 | 3300035410 | Bacteria | 734 |
| 456 | Ga0373924_0293802 | 3300035410 | Bacteria | 721 |
| 457 | Ga0373935_0087624 | 3300035692 | Bacteria | 2033 |
| 458 | Ga0373935_0659096 | 3300035692 | Bacteria | 768 |
| 459 | Ga0373935_1057631 | 3300035692 | Bacteria | 603 |
| 460 | Ga0373927_0785312 | 3300035695 | Bacteria | 629 |
| 461 | Ga0373933_0563395 | 3300035724 | Bacteria | 748 |
| 462 | Ga0373947_0018266 | 3300035725 | Bacteria | 4036 |
| 463 | Ga0373947_0085310 | 3300035725 | Bacteria | 1961 |
| 464 | Ga0373937_0055553 | 3300036401 | Bacteria | 3635 |
| 465 | Ga0373937_0105781 | 3300036401 | Bacteria | 2615 |
| 466 | Ga0373937_0525359 | 3300036401 | Bacteria | 1124 |
| 467 | Ga0373937_0663831 | 3300036401 | Bacteria | 988 |
| 468 | Ga0373937_1423261 | 3300036401 | Bacteria | 641 |
| 469 | Ga0373937_1612530 | 3300036401 | Bacteria | 596 |
| 470 | Ga0373937_1632611 | 3300036401 | Bacteria | 592 |
| 471 | Ga0373937_1810046 | 3300036401 | Bacteria | 557 |
| 472 | Ga0373925_0160073 | 3300037068 | Bacteria | 1773 |
| 473 | Ga0373925_0281546 | 3300037068 | Bacteria | 1339 |
| 474 | Ga0373925_0346976 | 3300037068 | Bacteria | 1205 |
| 475 | Ga0373925_0460133 | 3300037068 | Bacteria | 1042 |
| 476 | Ga0373925_0855660 | 3300037068 | Bacteria | 749 |
| 477 | Ga0373925_1189255 | 3300037068 | Bacteria | 627 |
| 478 | Ga0436362_0941488 | 3300039453 | Bacteria | 849 |
| 479 | Ga0451853_0176660 | 3300041512 | Bacteria | 599 |
| 480 | Ga0439460_0065210 | 3300042461 | Bacteria | 1119 |
| 481 | Ga0453683_0712373 | 3300044673 | Bacteria | 658 |
| 482 | Ga0451576_0277902 | 3300045051 | Bacteria | 1751 |
| 483 | Ga0466967_1719151 | 3300045976 | Bacteria | 625 |
| 484 | Ga0495592_0386335 | 3300046454 | Bacteria | 890 |
| 485 | Ga0495603_0056649 | 3300046455 | Bacteria | 2320 |
| 486 | Ga0495590_0221155 | 3300046457 | Bacteria | 699 |
| 487 | Ga0495629_0039618 | 3300046459 | Bacteria | 3316 |
| 488 | Ga0495629_0108936 | 3300046459 | Bacteria | 1932 |
| 489 | Ga0495629_0316991 | 3300046459 | Bacteria | 1066 |
| 490 | Ga0495629_0690277 | 3300046459 | Bacteria | 678 |
| 491 | Ga0495629_0968157 | 3300046459 | Bacteria | 555 |
| 492 | Ga0495641_0068787 | 3300046461 | Bacteria | 1592 |
| 493 | Ga0495653_0089085 | 3300046463 | Bacteria | 2262 |
| 494 | Ga0495653_0159656 | 3300046463 | Bacteria | 1566 |
| 495 | Ga0495653_0252550 | 3300046463 | Bacteria | 1170 |
| 496 | Ga0495653_0492522 | 3300046463 | Bacteria | 765 |
| 497 | Ga0495580_0510654 | 3300046472 | Bacteria | 802 |
| 498 | Ga0495580_0597560 | 3300046472 | Bacteria | 729 |
| 499 | Ga0495582_0422807 | 3300046473 | Bacteria | 769 |
| 500 | Ga0495582_0514545 | 3300046473 | Bacteria | 692 |
| 501 | Ga0495639_0407678 | 3300046475 | Bacteria | 687 |
| 502 | Ga0495639_0513715 | 3300046475 | Bacteria | 612 |
| 503 | Ga0495662_0460798 | 3300046476 | Bacteria | 624 |
| 504 | Ga0495664_0138486 | 3300046477 | Bacteria | 1475 |
| 505 | Ga0495594_0551693 | 3300046499 | Unclassified | 654 |
| 506 | Ga0495594_0754485 | 3300046499 | Bacteria | 549 |
| 507 | Ga0495596_0301736 | 3300046500 | Bacteria | 623 |
| 508 | Ga0495608_0294871 | 3300046511 | Bacteria | 1005 |
| 509 | Ga0495610_0116527 | 3300046512 | Bacteria | 1177 |
| 510 | Ga0495628_0162934 | 3300046516 | Bacteria | 1694 |
| 511 | Ga0495628_0401499 | 3300046516 | Bacteria | 1001 |
| 512 | Ga0495630_0239054 | 3300046517 | Bacteria | 1388 |
| 513 | Ga0495630_0318966 | 3300046517 | Bacteria | 1188 |
| 514 | Ga0495630_0478384 | 3300046517 | Bacteria | 955 |
| 515 | Ga0495630_0659959 | 3300046517 | Bacteria | 801 |
| 516 | Ga0495663_0270249 | 3300046525 | Bacteria | 607 |
| 517 | Ga0495666_0192761 | 3300046526 | Bacteria | 939 |
| 518 | Ga0495642_0266488 | 3300046528 | Bacteria | 750 |
| 519 | Ga0495640_0030475 | 3300046533 | Bacteria | 3862 |
| 520 | Ga0495586_0077462 | 3300046535 | Bacteria | 1823 |
| 521 | Ga0495586_0632529 | 3300046535 | Bacteria | 618 |
| 522 | Ga0495586_0887621 | 3300046535 | Bacteria | 514 |
| 523 | Ga0495621_0069184 | 3300046539 | Bacteria | 1297 |
| 524 | Ga0495621_0209773 | 3300046539 | Bacteria | 786 |
| 525 | Ga0495621_0387659 | 3300046539 | Bacteria | 591 |
| 526 | Ga0495645_0004427 | 3300046543 | Bacteria | 9593 |
| 527 | Ga0495645_0315041 | 3300046543 | Bacteria | 1018 |
| 528 | Ga0495667_0170548 | 3300046559 | Bacteria | 1398 |
| 529 | Ga0495667_0352457 | 3300046559 | Bacteria | 930 |
| 530 | Ga0495667_0540001 | 3300046559 | Bacteria | 729 |
| 531 | Ga0495667_0946690 | 3300046559 | Bacteria | 527 |
| 532 | Ga0495634_0323067 | 3300046642 | Bacteria | 929 |
| 533 | Ga0495634_0680230 | 3300046642 | Bacteria | 593 |
| 534 | Ga0495611_0179280 | 3300046648 | Bacteria | 990 |
| 535 | Ga0495635_0088954 | 3300046663 | Bacteria | 2113 |
| 536 | Ga0495635_0452811 | 3300046663 | Bacteria | 848 |
| 537 | Ga0495635_0967834 | 3300046663 | Bacteria | 543 |
| 538 | Ga0495659_0233321 | 3300046664 | Bacteria | 763 |
| 539 | Ga0495657_0314935 | 3300046675 | Bacteria | 931 |
| 540 | Ga0495646_0336580 | 3300046680 | Bacteria | 793 |
| 541 | Ga0495647_0173683 | 3300046681 | Bacteria | 934 |
| 542 | Ga0495647_0182375 | 3300046681 | Bacteria | 914 |
| 543 | Ga0495647_0187512 | 3300046681 | Bacteria | 902 |
| 544 | Ga0495658_0063955 | 3300046683 | Bacteria | 2118 |
| 545 | Ga0495658_0143499 | 3300046683 | Bacteria | 1462 |
| 546 | Ga0495658_0195287 | 3300046683 | Bacteria | 1260 |
| 547 | Ga0495658_0276569 | 3300046683 | Bacteria | 1059 |
| 548 | Ga0495658_0514264 | 3300046683 | Bacteria | 766 |
| 549 | Ga0495669_0043985 | 3300046684 | Bacteria | 1989 |
| 550 | Ga0495613_0202812 | 3300046689 | Bacteria | 1398 |
| 551 | Ga0495613_0468282 | 3300046689 | Bacteria | 852 |
| 552 | Ga0495613_0483883 | 3300046689 | Bacteria | 835 |
| 553 | Ga0495613_0709851 | 3300046689 | Bacteria | 661 |
| 554 | Ga0495613_0749542 | 3300046689 | Bacteria | 640 |
| 555 | Ga0495624_0143899 | 3300046690 | Bacteria | 1460 |
| 556 | Ga0495589_0369051 | 3300046794 | Bacteria | 660 |
| 557 | Ga0495600_0334896 | 3300046809 | Bacteria | 950 |
| 558 | Ga0495581_0230317 | 3300047315 | Bacteria | 1084 |
| 559 | Ga0495581_0320979 | 3300047315 | Bacteria | 905 |
| 560 | Ga0495604_0115887 | 3300047317 | Bacteria | 1946 |
| 561 | Ga0495674_0111892 | 3300047319 | Bacteria | 2314 |
| 562 | Ga0495674_0130151 | 3300047319 | Bacteria | 2120 |
| 563 | Ga0495674_0481768 | 3300047319 | Bacteria | 994 |
| 564 | Ga0495672_0157192 | 3300047320 | Bacteria | 1173 |
| 565 | Ga0495676_0801951 | 3300047321 | Bacteria | 606 |
| 566 | Ga0495680_0504547 | 3300047322 | Bacteria | 821 |
| 567 | Ga0495675_0369920 | 3300047444 | Bacteria | 840 |
| 568 | Ga0495677_0067254 | 3300047445 | Bacteria | 1333 |
| 569 | Ga0495684_0073724 | 3300047471 | Bacteria | 2593 |
| 570 | Ga0495593_0553400 | 3300047673 | Bacteria | 577 |
| 571 | Ga0495602_0306123 | 3300048088 | Bacteria | 1161 |
| 572 | Ga0496100_0682033 | 3300048903 | Bacteria | 801 |
| 573 | Ga0496101_0966544 | 3300048904 | Bacteria | 670 |
| 574 | Ga0496102_0198095 | 3300048905 | Bacteria | 1893 |
| 575 | Ga0496104_0017385 | 3300048907 | Bacteria | 6549 |
| 576 | Ga0496105_1392591 | 3300048908 | Bacteria | 508 |
| 577 | Ga0496106_0299493 | 3300048909 | Bacteria | 1289 |
| 578 | Ga0496107_0652246 | 3300048910 | Bacteria | 776 |
| 579 | Ga0496108_0011060 | 3300048911 | Bacteria | 7328 |
| 580 | Ga0496109_0151382 | 3300048912 | Bacteria | 2172 |
| 581 | Ga0496109_0191312 | 3300048912 | Bacteria | 1923 |
| 582 | Ga0496109_0204246 | 3300048912 | Bacteria | 1858 |
| 583 | Ga0496109_0224919 | 3300048912 | Bacteria | 1765 |
| 584 | Ga0496110_0157481 | 3300048913 | Bacteria | 2058 |
| 585 | Ga0496110_0195598 | 3300048913 | Bacteria | 1836 |
| 586 | Ga0496110_0399484 | 3300048913 | Bacteria | 1253 |
| 587 | Ga0496111_0181555 | 3300048914 | Bacteria | 1564 |
| 588 | Ga0496112_0016237 | 3300048915 | Bacteria | 6967 |
| 589 | Ga0496112_0205425 | 3300048915 | Bacteria | 1928 |
| 590 | Ga0496112_0509564 | 3300048915 | Bacteria | 1138 |
| 591 | Ga0496113_0032056 | 3300048916 | Bacteria | 3817 |
| 592 | Ga0496113_1293943 | 3300048916 | Bacteria | 567 |
| 593 | Ga0496114_0013645 | 3300048917 | Bacteria | 6514 |
| 594 | Ga0495682_0101315 | 3300049460 | Bacteria | 1033 |
| 595 | Ga0501034_0077055 | 3300049571 | Bacteria | 3340 |
| 596 | Ga0501034_0108508 | 3300049571 | Bacteria | 2767 |
| 597 | Ga0501034_1039997 | 3300049571 | Bacteria | 702 |
| 598 | Ga0501036_0638071 | 3300049572 | Bacteria | 882 |
| 599 | Ga0501036_1046904 | 3300049572 | Bacteria | 667 |
| 600 | Ga0501037_0399894 | 3300049573 | Bacteria | 942 |
| 601 | Ga0501043_0067123 | 3300049579 | Bacteria | 2817 |
| 602 | Ga0501047_0015370 | 3300049581 | Bacteria | 7290 |
| 603 | Ga0501047_0399559 | 3300049581 | Bacteria | 1207 |
| 604 | Ga0501068_0172060 | 3300049584 | Bacteria | 1367 |
| 605 | Ga0501069_0373707 | 3300049585 | Bacteria | 842 |
| 606 | Ga0501080_0935207 | 3300049742 | Bacteria | 754 |
| 607 | Ga0501083_0137210 | 3300049744 | Bacteria | 1602 |
| 608 | Ga0501083_0501650 | 3300049744 | Bacteria | 790 |
| 609 | Ga0501268_131814 | 3300049765 | Bacteria | 563 |
| 610 | Ga0501035_1457144 | 3300049822 | Bacteria | 523 |
| 611 | Ga0501044_0003452 | 3300049823 | Bacteria | 17800 |
| 612 | Ga0501044_0832038 | 3300049823 | Bacteria | 801 |
| 613 | nmdc:mga06z11_310287_c1 | 3300050494 | Bacteria | 939 |
| 614 | nmdc:mga05p37_119480_c1 | 3300050507 | Bacteria | 3238 |
| 615 | nmdc:mga05p37_1513211_c1 | 3300050507 | Bacteria | 667 |
| 616 | nmdc:mga05p37_1745505_c1 | 3300050507 | Bacteria | 604 |
| 617 | nmdc:mga05p37_47027_c1 | 3300050507 | Bacteria | 5306 |
| 618 | nmdc:mga09592_112102_c1 | 3300050508 | Bacteria | 2340 |
| 619 | nmdc:mga08y16_1578794_c1 | 3300050511 | Bacteria | 614 |
| 620 | nmdc:mga08y16_95418_c1 | 3300050511 | Bacteria | 3098 |
| 621 | nmdc:mga0n895_1012336_c1 | 3300050512 | Bacteria | 811 |
| 622 | nmdc:mga0n895_1652621_c1 | 3300050512 | Bacteria | 604 |
| 623 | nmdc:mga0n895_1721021_c1 | 3300050512 | Bacteria | 589 |
| 624 | nmdc:mga0n895_2113049_c1 | 3300050512 | Bacteria | 519 |
| 625 | nmdc:mga0n895_675524_c1 | 3300050512 | Bacteria | 1030 |
| 626 | nmdc:mga0rr50_1096711_c1 | 3300050513 | Bacteria | 677 |
| 627 | nmdc:mga0rr50_1228000_c1 | 3300050513 | Bacteria | 636 |
| 628 | nmdc:mga08x19_811162_c1 | 3300050514 | Bacteria | 665 |
| 629 | nmdc:mga0a205_798332_c1 | 3300050515 | Bacteria | 792 |
| 630 | nmdc:mga0a205_98384_c1 | 3300050515 | Bacteria | 2824 |
| 631 | Ga0495601_0179517 | 3300053077 | Bacteria | 1384 |
| 632 | Ga0495595_0015689 | 3300053084 | Bacteria | 3233 |
| 633 | Ga0495595_0247835 | 3300053084 | Bacteria | 892 |
| 634 | Ga0495595_0315265 | 3300053084 | Bacteria | 787 |
| 635 | Ga0495619_0044291 | 3300053085 | Bacteria | 2921 |
| 636 | Ga0495619_0138514 | 3300053085 | Bacteria | 1674 |
| 637 | Ga0495619_0247047 | 3300053085 | Bacteria | 1236 |
| 638 | Ga0495619_0463495 | 3300053085 | Bacteria | 873 |
| 639 | Ga0500658_0026256 | 3300053134 | Bacteria | 2243 |
| 640 | Ga0500658_0304386 | 3300053134 | Bacteria | 733 |
| 641 | Ga0501084_1272833 | 3300054114 | Unclassified | 617 |
| 642 | Ga0501084_1703677 | 3300054114 | Bacteria | 527 |
| 643 | Ga0587085_107945 | 3300059506 | Unclassified | 596 |
| 644 | Ga0501082_0257595 | 3300060353 | Bacteria | 1518 |
| 645 | Ga0501082_1348514 | 3300060353 | Unclassified | 623 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026075 | Ga0207708_10948384 | Ga0207708_109483842 | 55 |
| 2 | 3300005844 | Ga0068862_100130660 | Ga0068862_1001306603 | 59 |
| 3 | 3300009098 | Ga0105245_12152927 | Ga0105245_121529271 | 59 |
| 4 | 3300026118 | Ga0207675_102402739 | Ga0207675_1024027392 | 59 |
| 5 | 3300005367 | Ga0070667_100423262 | Ga0070667_1004232621 | 60 |
| 6 | 3300005441 | Ga0070700_101074592 | Ga0070700_1010745922 | 60 |
| 7 | 3300054114 | Ga0501084_1272833 | Ga0501084_1272833_271_480 | 63 |
| 8 | 3300060353 | Ga0501082_1348514 | Ga0501082_1348514_376_585 | 63 |
| 9 | 3300005518 | Ga0070699_100164340 | Ga0070699_1001643402 | 64 |
| 10 | 3300002459 | JGI24751J29686_10002990 | JGI24751J29686_100029903 | 65 |
| 11 | 3300005290 | Ga0065712_10071314 | Ga0065712_100713147 | 65 |
| 12 | 3300005293 | Ga0065715_10422444 | Ga0065715_104224442 | 65 |
| 13 | 3300005331 | Ga0070670_100050949 | Ga0070670_1000509495 | 65 |
| 14 | 3300005331 | Ga0070670_100911954 | Ga0070670_1009119542 | 65 |
| 15 | 3300005340 | Ga0070689_101793862 | Ga0070689_1017938622 | 65 |
| 16 | 3300005355 | Ga0070671_100435498 | Ga0070671_1004354983 | 65 |
| 17 | 3300005364 | Ga0070673_100650339 | Ga0070673_1006503392 | 65 |
| 18 | 3300005365 | Ga0070688_100489627 | Ga0070688_1004896272 | 65 |
| 19 | 3300005365 | Ga0070688_100656809 | Ga0070688_1006568092 | 65 |
| 20 | 3300005564 | Ga0070664_101695089 | Ga0070664_1016950892 | 65 |
| 21 | 3300005617 | Ga0068859_100573752 | Ga0068859_1005737523 | 65 |
| 22 | 3300005618 | Ga0068864_100580014 | Ga0068864_1005800143 | 65 |
| 23 | 3300005841 | Ga0068863_100127685 | Ga0068863_1001276853 | 65 |
| 24 | 3300005843 | Ga0068860_100344425 | Ga0068860_1003444253 | 65 |
| 25 | 3300005844 | Ga0068862_101632664 | Ga0068862_1016326642 | 65 |
| 26 | 3300005844 | Ga0068862_102242035 | Ga0068862_1022420352 | 65 |
| 27 | 3300006237 | Ga0097621_100147924 | Ga0097621_1001479243 | 65 |
| 28 | 3300006358 | Ga0068871_100148240 | Ga0068871_1001482402 | 65 |
| 29 | 3300006844 | Ga0075428_102132995 | Ga0075428_1021329952 | 65 |
| 30 | 3300006931 | Ga0097620_100573707 | Ga0097620_1005737073 | 65 |
| 31 | 3300009177 | Ga0105248_10013460 | Ga0105248_100134609 | 65 |
| 32 | 3300009177 | Ga0105248_10448915 | Ga0105248_104489152 | 65 |
| 33 | 3300009553 | Ga0105249_10205139 | Ga0105249_102051392 | 65 |
| 34 | 3300011119 | Ga0105246_10811883 | Ga0105246_108118831 | 65 |
| 35 | 3300013306 | Ga0163162_13114052 | Ga0163162_131140521 | 65 |
| 36 | 3300013306 | Ga0163162_13325897 | Ga0163162_133258972 | 65 |
| 37 | 3300013308 | Ga0157375_12472611 | Ga0157375_124726112 | 65 |
| 38 | 3300014325 | Ga0163163_10319094 | Ga0163163_103190943 | 65 |
| 39 | 3300014968 | Ga0157379_10356802 | Ga0157379_103568022 | 65 |
| 40 | 3300014969 | Ga0157376_11434349 | Ga0157376_114343492 | 65 |
| 41 | 3300025925 | Ga0207650_10063849 | Ga0207650_100638495 | 65 |
| 42 | 3300025925 | Ga0207650_10731305 | Ga0207650_107313052 | 65 |
| 43 | 3300025941 | Ga0207711_10136539 | Ga0207711_101365394 | 65 |
| 44 | 3300025941 | Ga0207711_10422755 | Ga0207711_104227552 | 65 |
| 45 | 3300025945 | Ga0207679_10885125 | Ga0207679_108851252 | 65 |
| 46 | 3300025961 | Ga0207712_10447401 | Ga0207712_104474013 | 65 |
| 47 | 3300026088 | Ga0207641_10319476 | Ga0207641_103194763 | 65 |
| 48 | 3300026088 | Ga0207641_10571695 | Ga0207641_105716952 | 65 |
| 49 | 3300026116 | Ga0207674_10062761 | Ga0207674_100627613 | 65 |
| 50 | 3300028380 | Ga0268265_12107161 | Ga0268265_121071612 | 65 |
| 51 | 3300035083 | Ga0373926_0217316 | Ga0373926_0217316_463_672 | 65 |
| 52 | 3300035114 | Ga0373939_0495396 | Ga0373939_0495396_25_225 | 65 |
| 53 | 3300035116 | Ga0373945_0035271 | Ga0373945_0035271_1110_1319 | 65 |
| 54 | 3300035170 | Ga0373943_0036985 | Ga0373943_0036985_1171_1380 | 65 |
| 55 | 3300035171 | Ga0373946_0614479 | Ga0373946_0614479_242_451 | 65 |
| 56 | 3300035172 | Ga0373955_0117147 | Ga0373955_0117147_1165_1374 | 65 |
| 57 | 3300035410 | Ga0373924_0293802 | Ga0373924_0293802_279_488 | 65 |
| 58 | 3300035692 | Ga0373935_1057631 | Ga0373935_1057631_339_548 | 65 |
| 59 | 3300035725 | Ga0373947_0018266 | Ga0373947_0018266_2137_2346 | 65 |
| 60 | 3300036401 | Ga0373937_0105781 | Ga0373937_0105781_332_541 | 65 |
| 61 | 3300036401 | Ga0373937_0663831 | Ga0373937_0663831_373_582 | 65 |
| 62 | 3300037068 | Ga0373925_0460133 | Ga0373925_0460133_360_569 | 65 |
| 63 | 3300046463 | Ga0495653_0089085 | Ga0495653_0089085_1110_1319 | 65 |
| 64 | 3300046463 | Ga0495653_0159656 | Ga0495653_0159656_313_522 | 65 |
| 65 | 3300046511 | Ga0495608_0294871 | Ga0495608_0294871_642_851 | 65 |
| 66 | 3300046516 | Ga0495628_0401499 | Ga0495628_0401499_571_780 | 65 |
| 67 | 3300046517 | Ga0495630_0239054 | Ga0495630_0239054_836_1045 | 65 |
| 68 | 3300046535 | Ga0495586_0887621 | Ga0495586_0887621_148_357 | 65 |
| 69 | 3300046543 | Ga0495645_0315041 | Ga0495645_0315041_759_968 | 65 |
| 70 | 3300046559 | Ga0495667_0540001 | Ga0495667_0540001_261_470 | 65 |
| 71 | 3300046675 | Ga0495657_0314935 | Ga0495657_0314935_447_656 | 65 |
| 72 | 3300046680 | Ga0495646_0336580 | Ga0495646_0336580_167_376 | 65 |
| 73 | 3300046683 | Ga0495658_0195287 | Ga0495658_0195287_343_552 | 65 |
| 74 | 3300046689 | Ga0495613_0483883 | Ga0495613_0483883_291_500 | 65 |
| 75 | 3300047317 | Ga0495604_0115887 | Ga0495604_0115887_878_1087 | 65 |
| 76 | 3300047319 | Ga0495674_0481768 | Ga0495674_0481768_502_711 | 65 |
| 77 | 3300048910 | Ga0496107_0652246 | Ga0496107_0652246_487_693 | 65 |
| 78 | 3300048912 | Ga0496109_0224919 | Ga0496109_0224919_550_756 | 65 |
| 79 | 3300048913 | Ga0496110_0195598 | Ga0496110_0195598_872_1078 | 65 |
| 80 | 3300048914 | Ga0496111_0181555 | Ga0496111_0181555_615_821 | 65 |
| 81 | 3300053084 | Ga0495595_0015689 | Ga0495595_0015689_895_1104 | 65 |
| 82 | 3300053085 | Ga0495619_0138514 | Ga0495619_0138514_872_1081 | 65 |
| 83 | 3300054114 | Ga0501084_1703677 | Ga0501084_1703677_183_389 | 65 |
| 84 | 2088090002 | CNA_F6ESG4R02F99NE | CNA_00112610 | 66 |
| 85 | 3300002459 | JGI24751J29686_10080272 | JGI24751J29686_100802722 | 66 |
| 86 | 3300004799 | Ga0058863_11687864 | Ga0058863_116878642 | 66 |
| 87 | 3300004800 | Ga0058861_10070191 | Ga0058861_100701911 | 66 |
| 88 | 3300004803 | Ga0058862_12512468 | Ga0058862_125124682 | 66 |
| 89 | 3300004803 | Ga0058862_12835766 | Ga0058862_128357662 | 66 |
| 90 | 3300004803 | Ga0058862_12893714 | Ga0058862_128937144 | 66 |
| 91 | 3300005288 | Ga0065714_10329800 | Ga0065714_103298002 | 66 |
| 92 | 3300005290 | Ga0065712_10101699 | Ga0065712_101016993 | 66 |
| 93 | 3300005290 | Ga0065712_10269749 | Ga0065712_102697491 | 66 |
| 94 | 3300005290 | Ga0065712_10518856 | Ga0065712_105188561 | 66 |
| 95 | 3300005290 | Ga0065712_10605422 | Ga0065712_106054222 | 66 |
| 96 | 3300005290 | Ga0065712_10628472 | Ga0065712_106284722 | 66 |
| 97 | 3300005293 | Ga0065715_10520569 | Ga0065715_105205692 | 66 |
| 98 | 3300005295 | Ga0065707_10173975 | Ga0065707_101739753 | 66 |
| 99 | 3300005327 | Ga0070658_10302065 | Ga0070658_103020652 | 66 |
| 100 | 3300005327 | Ga0070658_11694789 | Ga0070658_116947891 | 66 |
| 101 | 3300005329 | Ga0070683_100261901 | Ga0070683_1002619013 | 66 |
| 102 | 3300005329 | Ga0070683_101286941 | Ga0070683_1012869411 | 66 |
| 103 | 3300005330 | Ga0070690_100665097 | Ga0070690_1006650971 | 66 |
| 104 | 3300005331 | Ga0070670_100278888 | Ga0070670_1002788882 | 66 |
| 105 | 3300005331 | Ga0070670_100596116 | Ga0070670_1005961163 | 66 |
| 106 | 3300005331 | Ga0070670_102197235 | Ga0070670_1021972352 | 66 |
| 107 | 3300005333 | Ga0070677_10104469 | Ga0070677_101044692 | 66 |
| 108 | 3300005333 | Ga0070677_10140954 | Ga0070677_101409543 | 66 |
| 109 | 3300005334 | Ga0068869_100139170 | Ga0068869_1001391701 | 66 |
| 110 | 3300005334 | Ga0068869_100271176 | Ga0068869_1002711763 | 66 |
| 111 | 3300005334 | Ga0068869_100338717 | Ga0068869_1003387173 | 66 |
| 112 | 3300005334 | Ga0068869_101174195 | Ga0068869_1011741951 | 66 |
| 113 | 3300005334 | Ga0068869_101488801 | Ga0068869_1014888012 | 66 |
| 114 | 3300005335 | Ga0070666_10501666 | Ga0070666_105016661 | 66 |
| 115 | 3300005335 | Ga0070666_10551035 | Ga0070666_105510351 | 66 |
| 116 | 3300005335 | Ga0070666_11123088 | Ga0070666_111230882 | 66 |
| 117 | 3300005336 | Ga0070680_100345010 | Ga0070680_1003450102 | 66 |
| 118 | 3300005337 | Ga0070682_100148242 | Ga0070682_1001482423 | 66 |
| 119 | 3300005338 | Ga0068868_100322874 | Ga0068868_1003228743 | 66 |
| 120 | 3300005339 | Ga0070660_100002987 | Ga0070660_1000029879 | 66 |
| 121 | 3300005339 | Ga0070660_100138512 | Ga0070660_1001385123 | 66 |
| 122 | 3300005340 | Ga0070689_100210129 | Ga0070689_1002101292 | 66 |
| 123 | 3300005341 | Ga0070691_10753841 | Ga0070691_107538412 | 66 |
| 124 | 3300005344 | Ga0070661_100460429 | Ga0070661_1004604291 | 66 |
| 125 | 3300005344 | Ga0070661_101595586 | Ga0070661_1015955862 | 66 |
| 126 | 3300005347 | Ga0070668_101574622 | Ga0070668_1015746221 | 66 |
| 127 | 3300005347 | Ga0070668_102121942 | Ga0070668_1021219422 | 66 |
| 128 | 3300005353 | Ga0070669_100266395 | Ga0070669_1002663952 | 66 |
| 129 | 3300005354 | Ga0070675_100315632 | Ga0070675_1003156323 | 66 |
| 130 | 3300005354 | Ga0070675_100503460 | Ga0070675_1005034602 | 66 |
| 131 | 3300005355 | Ga0070671_101544139 | Ga0070671_1015441392 | 66 |
| 132 | 3300005356 | Ga0070674_100046049 | Ga0070674_1000460497 | 66 |
| 133 | 3300005356 | Ga0070674_100078891 | Ga0070674_1000788913 | 66 |
| 134 | 3300005356 | Ga0070674_101067818 | Ga0070674_1010678182 | 66 |
| 135 | 3300005356 | Ga0070674_102019813 | Ga0070674_1020198131 | 66 |
| 136 | 3300005364 | Ga0070673_100003427 | Ga0070673_1000034277 | 66 |
| 137 | 3300005364 | Ga0070673_100117740 | Ga0070673_1001177403 | 66 |
| 138 | 3300005364 | Ga0070673_100950529 | Ga0070673_1009505292 | 66 |
| 139 | 3300005365 | Ga0070688_100408199 | Ga0070688_1004081992 | 66 |
| 140 | 3300005365 | Ga0070688_101438511 | Ga0070688_1014385112 | 66 |
| 141 | 3300005366 | Ga0070659_101495240 | Ga0070659_1014952401 | 66 |
| 142 | 3300005367 | Ga0070667_100168474 | Ga0070667_1001684743 | 66 |
| 143 | 3300005367 | Ga0070667_101014034 | Ga0070667_1010140342 | 66 |
| 144 | 3300005367 | Ga0070667_101310295 | Ga0070667_1013102951 | 66 |
| 145 | 3300005367 | Ga0070667_101786484 | Ga0070667_1017864842 | 66 |
| 146 | 3300005367 | Ga0070667_101815461 | Ga0070667_1018154612 | 66 |
| 147 | 3300005434 | Ga0070709_10020289 | Ga0070709_100202899 | 66 |
| 148 | 3300005436 | Ga0070713_101514279 | Ga0070713_1015142791 | 66 |
| 149 | 3300005437 | Ga0070710_10097350 | Ga0070710_100973503 | 66 |
| 150 | 3300005440 | Ga0070705_100732958 | Ga0070705_1007329582 | 66 |
| 151 | 3300005440 | Ga0070705_101120349 | Ga0070705_1011203492 | 66 |
| 152 | 3300005441 | Ga0070700_100548056 | Ga0070700_1005480562 | 66 |
| 153 | 3300005441 | Ga0070700_101148122 | Ga0070700_1011481221 | 66 |
| 154 | 3300005444 | Ga0070694_100871495 | Ga0070694_1008714952 | 66 |
| 155 | 3300005445 | Ga0070708_101240510 | Ga0070708_1012405102 | 66 |
| 156 | 3300005456 | Ga0070678_100233115 | Ga0070678_1002331152 | 66 |
| 157 | 3300005457 | Ga0070662_100851136 | Ga0070662_1008511362 | 66 |
| 158 | 3300005457 | Ga0070662_101626249 | Ga0070662_1016262491 | 66 |
| 159 | 3300005457 | Ga0070662_101945811 | Ga0070662_1019458112 | 66 |
| 160 | 3300005458 | Ga0070681_10019826 | Ga0070681_100198267 | 66 |
| 161 | 3300005459 | Ga0068867_100513996 | Ga0068867_1005139961 | 66 |
| 162 | 3300005459 | Ga0068867_101847949 | Ga0068867_1018479492 | 66 |
| 163 | 3300005466 | Ga0070685_10580950 | Ga0070685_105809502 | 66 |
| 164 | 3300005466 | Ga0070685_11308965 | Ga0070685_113089652 | 66 |
| 165 | 3300005471 | Ga0070698_101511185 | Ga0070698_1015111851 | 66 |
| 166 | 3300005518 | Ga0070699_100119032 | Ga0070699_1001190322 | 66 |
| 167 | 3300005518 | Ga0070699_101586749 | Ga0070699_1015867491 | 66 |
| 168 | 3300005518 | Ga0070699_101775577 | Ga0070699_1017755772 | 66 |
| 169 | 3300005530 | Ga0070679_100044653 | Ga0070679_1000446532 | 66 |
| 170 | 3300005530 | Ga0070679_100084074 | Ga0070679_1000840744 | 66 |
| 171 | 3300005535 | Ga0070684_100338991 | Ga0070684_1003389913 | 66 |
| 172 | 3300005535 | Ga0070684_100709529 | Ga0070684_1007095292 | 66 |
| 173 | 3300005535 | Ga0070684_102230004 | Ga0070684_1022300041 | 66 |
| 174 | 3300005536 | Ga0070697_100842893 | Ga0070697_1008428931 | 66 |
| 175 | 3300005539 | Ga0068853_100264579 | Ga0068853_1002645792 | 66 |
| 176 | 3300005543 | Ga0070672_100287420 | Ga0070672_1002874202 | 66 |
| 177 | 3300005543 | Ga0070672_100428160 | Ga0070672_1004281602 | 66 |
| 178 | 3300005544 | Ga0070686_100282478 | Ga0070686_1002824783 | 66 |
| 179 | 3300005544 | Ga0070686_100335256 | Ga0070686_1003352563 | 66 |
| 180 | 3300005545 | Ga0070695_100404437 | Ga0070695_1004044373 | 66 |
| 181 | 3300005546 | Ga0070696_100848751 | Ga0070696_1008487512 | 66 |
| 182 | 3300005546 | Ga0070696_101166463 | Ga0070696_1011664632 | 66 |
| 183 | 3300005548 | Ga0070665_100005447 | Ga0070665_1000054474 | 66 |
| 184 | 3300005548 | Ga0070665_100663567 | Ga0070665_1006635672 | 66 |
| 185 | 3300005549 | Ga0070704_101248001 | Ga0070704_1012480012 | 66 |
| 186 | 3300005549 | Ga0070704_101347523 | Ga0070704_1013475232 | 66 |
| 187 | 3300005563 | Ga0068855_100286434 | Ga0068855_1002864343 | 66 |
| 188 | 3300005563 | Ga0068855_100421940 | Ga0068855_1004219403 | 66 |
| 189 | 3300005563 | Ga0068855_100534530 | Ga0068855_1005345303 | 66 |
| 190 | 3300005563 | Ga0068855_100868726 | Ga0068855_1008687262 | 66 |
| 191 | 3300005563 | Ga0068855_101104655 | Ga0068855_1011046552 | 66 |
| 192 | 3300005564 | Ga0070664_100461940 | Ga0070664_1004619402 | 66 |
| 193 | 3300005564 | Ga0070664_100723900 | Ga0070664_1007239002 | 66 |
| 194 | 3300005564 | Ga0070664_100812333 | Ga0070664_1008123332 | 66 |
| 195 | 3300005564 | Ga0070664_100843581 | Ga0070664_1008435812 | 66 |
| 196 | 3300005564 | Ga0070664_101612142 | Ga0070664_1016121422 | 66 |
| 197 | 3300005577 | Ga0068857_101894243 | Ga0068857_1018942432 | 66 |
| 198 | 3300005578 | Ga0068854_100428672 | Ga0068854_1004286723 | 66 |
| 199 | 3300005578 | Ga0068854_101091286 | Ga0068854_1010912862 | 66 |
| 200 | 3300005578 | Ga0068854_101671245 | Ga0068854_1016712452 | 66 |
| 201 | 3300005578 | Ga0068854_102054371 | Ga0068854_1020543712 | 66 |
| 202 | 3300005614 | Ga0068856_100018557 | Ga0068856_1000185576 | 66 |
| 203 | 3300005615 | Ga0070702_100647573 | Ga0070702_1006475732 | 66 |
| 204 | 3300005615 | Ga0070702_101366398 | Ga0070702_1013663982 | 66 |
| 205 | 3300005616 | Ga0068852_100647787 | Ga0068852_1006477873 | 66 |
| 206 | 3300005616 | Ga0068852_102051610 | Ga0068852_1020516101 | 66 |
| 207 | 3300005616 | Ga0068852_102268577 | Ga0068852_1022685772 | 66 |
| 208 | 3300005617 | Ga0068859_101413220 | Ga0068859_1014132202 | 66 |
| 209 | 3300005617 | Ga0068859_102313179 | Ga0068859_1023131792 | 66 |
| 210 | 3300005618 | Ga0068864_100385694 | Ga0068864_1003856943 | 66 |
| 211 | 3300005618 | Ga0068864_100497372 | Ga0068864_1004973722 | 66 |
| 212 | 3300005618 | Ga0068864_101084216 | Ga0068864_1010842162 | 66 |
| 213 | 3300005718 | Ga0068866_10457970 | Ga0068866_104579702 | 66 |
| 214 | 3300005719 | Ga0068861_100196584 | Ga0068861_1001965843 | 66 |
| 215 | 3300005719 | Ga0068861_100326592 | Ga0068861_1003265921 | 66 |
| 216 | 3300005719 | Ga0068861_100451931 | Ga0068861_1004519312 | 66 |
| 217 | 3300005719 | Ga0068861_100496389 | Ga0068861_1004963892 | 66 |
| 218 | 3300005719 | Ga0068861_102301584 | Ga0068861_1023015842 | 66 |
| 219 | 3300005834 | Ga0068851_10998528 | Ga0068851_109985282 | 66 |
| 220 | 3300005840 | Ga0068870_10198737 | Ga0068870_101987372 | 66 |
| 221 | 3300005840 | Ga0068870_11290736 | Ga0068870_112907361 | 66 |
| 222 | 3300005841 | Ga0068863_100116322 | Ga0068863_1001163222 | 66 |
| 223 | 3300005841 | Ga0068863_101247544 | Ga0068863_1012475442 | 66 |
| 224 | 3300005842 | Ga0068858_100133765 | Ga0068858_1001337653 | 66 |
| 225 | 3300005842 | Ga0068858_100411153 | Ga0068858_1004111533 | 66 |
| 226 | 3300005842 | Ga0068858_101550906 | Ga0068858_1015509062 | 66 |
| 227 | 3300005843 | Ga0068860_100304719 | Ga0068860_1003047192 | 66 |
| 228 | 3300005843 | Ga0068860_100725428 | Ga0068860_1007254283 | 66 |
| 229 | 3300005843 | Ga0068860_101415446 | Ga0068860_1014154461 | 66 |
| 230 | 3300005843 | Ga0068860_101655613 | Ga0068860_1016556132 | 66 |
| 231 | 3300005844 | Ga0068862_100556118 | Ga0068862_1005561182 | 66 |
| 232 | 3300005844 | Ga0068862_101975256 | Ga0068862_1019752562 | 66 |
| 233 | 3300005844 | Ga0068862_102242425 | Ga0068862_1022424252 | 66 |
| 234 | 3300005844 | Ga0068862_102299841 | Ga0068862_1022998412 | 66 |
| 235 | 3300005937 | Ga0081455_10174261 | Ga0081455_101742612 | 66 |
| 236 | 3300005937 | Ga0081455_10833757 | Ga0081455_108337571 | 66 |
| 237 | 3300006163 | Ga0070715_10237715 | Ga0070715_102377153 | 66 |
| 238 | 3300006163 | Ga0070715_10935810 | Ga0070715_109358101 | 66 |
| 239 | 3300006173 | Ga0070716_100341366 | Ga0070716_1003413663 | 66 |
| 240 | 3300006178 | Ga0075367_10258480 | Ga0075367_102584802 | 66 |
| 241 | 3300006237 | Ga0097621_100020231 | Ga0097621_1000202312 | 66 |
| 242 | 3300006237 | Ga0097621_100118810 | Ga0097621_1001188103 | 66 |
| 243 | 3300006358 | Ga0068871_100006055 | Ga0068871_1000060558 | 66 |
| 244 | 3300006358 | Ga0068871_100460996 | Ga0068871_1004609962 | 66 |
| 245 | 3300006844 | Ga0075428_100312003 | Ga0075428_1003120033 | 66 |
| 246 | 3300006852 | Ga0075433_10128181 | Ga0075433_101281813 | 66 |
| 247 | 3300006852 | Ga0075433_11282772 | Ga0075433_112827722 | 66 |
| 248 | 3300006871 | Ga0075434_101943943 | Ga0075434_1019439432 | 66 |
| 249 | 3300006880 | Ga0075429_100522210 | Ga0075429_1005222101 | 66 |
| 250 | 3300006881 | Ga0068865_100006729 | Ga0068865_10000672916 | 66 |
| 251 | 3300006881 | Ga0068865_100391738 | Ga0068865_1003917382 | 66 |
| 252 | 3300006881 | Ga0068865_100715964 | Ga0068865_1007159642 | 66 |
| 253 | 3300006881 | Ga0068865_101055817 | Ga0068865_1010558172 | 66 |
| 254 | 3300006914 | Ga0075436_100028497 | Ga0075436_1000284978 | 66 |
| 255 | 3300006931 | Ga0097620_101413166 | Ga0097620_1014131662 | 66 |
| 256 | 3300006931 | Ga0097620_102312791 | Ga0097620_1023127912 | 66 |
| 257 | 3300007076 | Ga0075435_101236869 | Ga0075435_1012368692 | 66 |
| 258 | 3300009011 | Ga0105251_10210348 | Ga0105251_102103482 | 66 |
| 259 | 3300009093 | Ga0105240_10045226 | Ga0105240_100452268 | 66 |
| 260 | 3300009093 | Ga0105240_10177867 | Ga0105240_101778673 | 66 |
| 261 | 3300009093 | Ga0105240_10887187 | Ga0105240_108871872 | 66 |
| 262 | 3300009098 | Ga0105245_10607498 | Ga0105245_106074983 | 66 |
| 263 | 3300009098 | Ga0105245_10689778 | Ga0105245_106897782 | 66 |
| 264 | 3300009098 | Ga0105245_11313691 | Ga0105245_113136912 | 66 |
| 265 | 3300009098 | Ga0105245_12545687 | Ga0105245_125456872 | 66 |
| 266 | 3300009101 | Ga0105247_10004209 | Ga0105247_100042095 | 66 |
| 267 | 3300009147 | Ga0114129_10123569 | Ga0114129_101235695 | 66 |
| 268 | 3300009147 | Ga0114129_10150048 | Ga0114129_101500482 | 66 |
| 269 | 3300009147 | Ga0114129_11155727 | Ga0114129_111557271 | 66 |
| 270 | 3300009147 | Ga0114129_11235126 | Ga0114129_112351262 | 66 |
| 271 | 3300009147 | Ga0114129_12294442 | Ga0114129_122944422 | 66 |
| 272 | 3300009148 | Ga0105243_10245118 | Ga0105243_102451183 | 66 |
| 273 | 3300009148 | Ga0105243_10952956 | Ga0105243_109529562 | 66 |
| 274 | 3300009174 | Ga0105241_11270462 | Ga0105241_112704622 | 66 |
| 275 | 3300009174 | Ga0105241_11696682 | Ga0105241_116966822 | 66 |
| 276 | 3300009174 | Ga0105241_12533961 | Ga0105241_125339612 | 66 |
| 277 | 3300009176 | Ga0105242_10067271 | Ga0105242_100672712 | 66 |
| 278 | 3300009176 | Ga0105242_10177665 | Ga0105242_101776653 | 66 |
| 279 | 3300009176 | Ga0105242_10901770 | Ga0105242_109017702 | 66 |
| 280 | 3300009176 | Ga0105242_12782863 | Ga0105242_127828632 | 66 |
| 281 | 3300009177 | Ga0105248_10019507 | Ga0105248_100195079 | 66 |
| 282 | 3300009177 | Ga0105248_10224670 | Ga0105248_102246702 | 66 |
| 283 | 3300009177 | Ga0105248_10481300 | Ga0105248_104813003 | 66 |
| 284 | 3300009177 | Ga0105248_10719068 | Ga0105248_107190682 | 66 |
| 285 | 3300009177 | Ga0105248_10819264 | Ga0105248_108192641 | 66 |
| 286 | 3300009177 | Ga0105248_11783822 | Ga0105248_117838222 | 66 |
| 287 | 3300009177 | Ga0105248_13243032 | Ga0105248_132430322 | 66 |
| 288 | 3300009545 | Ga0105237_11729579 | Ga0105237_117295792 | 66 |
| 289 | 3300009551 | Ga0105238_10125557 | Ga0105238_101255573 | 66 |
| 290 | 3300009551 | Ga0105238_12725545 | Ga0105238_127255452 | 66 |
| 291 | 3300009553 | Ga0105249_10936999 | Ga0105249_109369992 | 66 |
| 292 | 3300009553 | Ga0105249_11617360 | Ga0105249_116173601 | 66 |
| 293 | 3300009553 | Ga0105249_12292786 | Ga0105249_122927861 | 66 |
| 294 | 3300009553 | Ga0105249_13304575 | Ga0105249_133045752 | 66 |
| 295 | 3300010159 | Ga0099796_10030103 | Ga0099796_100301034 | 66 |
| 296 | 3300010375 | Ga0105239_10725470 | Ga0105239_107254702 | 66 |
| 297 | 3300011119 | Ga0105246_10270358 | Ga0105246_102703583 | 66 |
| 298 | 3300011119 | Ga0105246_10667877 | Ga0105246_106678771 | 66 |
| 299 | 3300013105 | Ga0157369_11245679 | Ga0157369_112456792 | 66 |
| 300 | 3300013297 | Ga0157378_10363162 | Ga0157378_103631623 | 66 |
| 301 | 3300013297 | Ga0157378_11149159 | Ga0157378_111491592 | 66 |
| 302 | 3300013297 | Ga0157378_11186863 | Ga0157378_111868632 | 66 |
| 303 | 3300013297 | Ga0157378_12234604 | Ga0157378_122346042 | 66 |
| 304 | 3300013306 | Ga0163162_10519827 | Ga0163162_105198273 | 66 |
| 305 | 3300013306 | Ga0163162_11473787 | Ga0163162_114737872 | 66 |
| 306 | 3300013306 | Ga0163162_13287241 | Ga0163162_132872411 | 66 |
| 307 | 3300013308 | Ga0157375_10444566 | Ga0157375_104445663 | 66 |
| 308 | 3300013308 | Ga0157375_10766805 | Ga0157375_107668052 | 66 |
| 309 | 3300014325 | Ga0163163_10087285 | Ga0163163_100872854 | 66 |
| 310 | 3300014325 | Ga0163163_10548084 | Ga0163163_105480842 | 66 |
| 311 | 3300014325 | Ga0163163_10641362 | Ga0163163_106413622 | 66 |
| 312 | 3300014325 | Ga0163163_11731632 | Ga0163163_117316321 | 66 |
| 313 | 3300014326 | Ga0157380_10280688 | Ga0157380_102806884 | 66 |
| 314 | 3300014326 | Ga0157380_13426170 | Ga0157380_134261702 | 66 |
| 315 | 3300014326 | Ga0157380_13507926 | Ga0157380_135079262 | 66 |
| 316 | 3300014745 | Ga0157377_10660678 | Ga0157377_106606782 | 66 |
| 317 | 3300014968 | Ga0157379_11456189 | Ga0157379_114561892 | 66 |
| 318 | 3300014968 | Ga0157379_11748557 | Ga0157379_117485572 | 66 |
| 319 | 3300014968 | Ga0157379_12387208 | Ga0157379_123872081 | 66 |
| 320 | 3300014969 | Ga0157376_10414998 | Ga0157376_104149983 | 66 |
| 321 | 3300014969 | Ga0157376_10510102 | Ga0157376_105101023 | 66 |
| 322 | 3300014969 | Ga0157376_11266519 | Ga0157376_112665191 | 66 |
| 323 | 3300014969 | Ga0157376_12045711 | Ga0157376_120457112 | 66 |
| 324 | 3300017792 | Ga0163161_10812730 | Ga0163161_108127302 | 66 |
| 325 | 3300022467 | Ga0224712_10584166 | Ga0224712_105841662 | 66 |
| 326 | 3300025315 | Ga0207697_10232639 | Ga0207697_102326391 | 66 |
| 327 | 3300025893 | Ga0207682_10094553 | Ga0207682_100945533 | 66 |
| 328 | 3300025898 | Ga0207692_10181644 | Ga0207692_101816442 | 66 |
| 329 | 3300025898 | Ga0207692_11158308 | Ga0207692_111583082 | 66 |
| 330 | 3300025899 | Ga0207642_10258962 | Ga0207642_102589621 | 66 |
| 331 | 3300025901 | Ga0207688_10190402 | Ga0207688_101904022 | 66 |
| 332 | 3300025901 | Ga0207688_10559536 | Ga0207688_105595362 | 66 |
| 333 | 3300025901 | Ga0207688_10745755 | Ga0207688_107457552 | 66 |
| 334 | 3300025903 | Ga0207680_10942505 | Ga0207680_109425052 | 66 |
| 335 | 3300025905 | Ga0207685_10776622 | Ga0207685_107766222 | 66 |
| 336 | 3300025906 | Ga0207699_10014062 | Ga0207699_100140622 | 66 |
| 337 | 3300025907 | Ga0207645_10479675 | Ga0207645_104796752 | 66 |
| 338 | 3300025908 | Ga0207643_10090349 | Ga0207643_100903493 | 66 |
| 339 | 3300025909 | Ga0207705_10546213 | Ga0207705_105462132 | 66 |
| 340 | 3300025909 | Ga0207705_11076000 | Ga0207705_110760001 | 66 |
| 341 | 3300025911 | Ga0207654_10223831 | Ga0207654_102238313 | 66 |
| 342 | 3300025912 | Ga0207707_10042746 | Ga0207707_100427466 | 66 |
| 343 | 3300025912 | Ga0207707_10599424 | Ga0207707_105994242 | 66 |
| 344 | 3300025913 | Ga0207695_10084625 | Ga0207695_100846253 | 66 |
| 345 | 3300025913 | Ga0207695_10131709 | Ga0207695_101317093 | 66 |
| 346 | 3300025913 | Ga0207695_10350332 | Ga0207695_103503322 | 66 |
| 347 | 3300025917 | Ga0207660_10141452 | Ga0207660_101414522 | 66 |
| 348 | 3300025919 | Ga0207657_10013143 | Ga0207657_1001314312 | 66 |
| 349 | 3300025919 | Ga0207657_10149049 | Ga0207657_101490494 | 66 |
| 350 | 3300025920 | Ga0207649_10659408 | Ga0207649_106594081 | 66 |
| 351 | 3300025920 | Ga0207649_10910409 | Ga0207649_109104092 | 66 |
| 352 | 3300025921 | Ga0207652_10085259 | Ga0207652_100852592 | 66 |
| 353 | 3300025921 | Ga0207652_10607803 | Ga0207652_106078032 | 66 |
| 354 | 3300025923 | Ga0207681_10215274 | Ga0207681_102152743 | 66 |
| 355 | 3300025924 | Ga0207694_10150838 | Ga0207694_101508383 | 66 |
| 356 | 3300025924 | Ga0207694_10487438 | Ga0207694_104874382 | 66 |
| 357 | 3300025925 | Ga0207650_10193461 | Ga0207650_101934611 | 66 |
| 358 | 3300025925 | Ga0207650_10400909 | Ga0207650_104009092 | 66 |
| 359 | 3300025926 | Ga0207659_10308581 | Ga0207659_103085812 | 66 |
| 360 | 3300025926 | Ga0207659_10350045 | Ga0207659_103500453 | 66 |
| 361 | 3300025926 | Ga0207659_10525156 | Ga0207659_105251562 | 66 |
| 362 | 3300025926 | Ga0207659_10638716 | Ga0207659_106387162 | 66 |
| 363 | 3300025927 | Ga0207687_10329664 | Ga0207687_103296643 | 66 |
| 364 | 3300025927 | Ga0207687_10462116 | Ga0207687_104621162 | 66 |
| 365 | 3300025927 | Ga0207687_11437491 | Ga0207687_114374912 | 66 |
| 366 | 3300025928 | Ga0207700_11330332 | Ga0207700_113303322 | 66 |
| 367 | 3300025931 | Ga0207644_11009988 | Ga0207644_110099882 | 66 |
| 368 | 3300025932 | Ga0207690_10232957 | Ga0207690_102329573 | 66 |
| 369 | 3300025932 | Ga0207690_10727685 | Ga0207690_107276853 | 66 |
| 370 | 3300025933 | Ga0207706_10812443 | Ga0207706_108124432 | 66 |
| 371 | 3300025933 | Ga0207706_11353126 | Ga0207706_113531262 | 66 |
| 372 | 3300025934 | Ga0207686_10013361 | Ga0207686_100133611 | 66 |
| 373 | 3300025934 | Ga0207686_10519480 | Ga0207686_105194802 | 66 |
| 374 | 3300025935 | Ga0207709_11010645 | Ga0207709_110106452 | 66 |
| 375 | 3300025937 | Ga0207669_10392616 | Ga0207669_103926163 | 66 |
| 376 | 3300025937 | Ga0207669_10788056 | Ga0207669_107880562 | 66 |
| 377 | 3300025937 | Ga0207669_11819998 | Ga0207669_118199982 | 66 |
| 378 | 3300025938 | Ga0207704_10005828 | Ga0207704_100058283 | 66 |
| 379 | 3300025938 | Ga0207704_11306999 | Ga0207704_113069992 | 66 |
| 380 | 3300025939 | Ga0207665_11330151 | Ga0207665_113301512 | 66 |
| 381 | 3300025940 | Ga0207691_10197382 | Ga0207691_101973822 | 66 |
| 382 | 3300025940 | Ga0207691_10419050 | Ga0207691_104190503 | 66 |
| 383 | 3300025940 | Ga0207691_11004862 | Ga0207691_110048622 | 66 |
| 384 | 3300025941 | Ga0207711_10026433 | Ga0207711_100264338 | 66 |
| 385 | 3300025941 | Ga0207711_10480730 | Ga0207711_104807303 | 66 |
| 386 | 3300025941 | Ga0207711_10561479 | Ga0207711_105614793 | 66 |
| 387 | 3300025941 | Ga0207711_10746099 | Ga0207711_107460992 | 66 |
| 388 | 3300025941 | Ga0207711_11004973 | Ga0207711_110049731 | 66 |
| 389 | 3300025941 | Ga0207711_11650168 | Ga0207711_116501682 | 66 |
| 390 | 3300025942 | Ga0207689_10034411 | Ga0207689_100344112 | 66 |
| 391 | 3300025942 | Ga0207689_10062920 | Ga0207689_100629202 | 66 |
| 392 | 3300025942 | Ga0207689_10365682 | Ga0207689_103656823 | 66 |
| 393 | 3300025942 | Ga0207689_10618427 | Ga0207689_106184272 | 66 |
| 394 | 3300025942 | Ga0207689_10772295 | Ga0207689_107722952 | 66 |
| 395 | 3300025942 | Ga0207689_10891739 | Ga0207689_108917392 | 66 |
| 396 | 3300025945 | Ga0207679_10392851 | Ga0207679_103928512 | 66 |
| 397 | 3300025945 | Ga0207679_10395275 | Ga0207679_103952752 | 66 |
| 398 | 3300025945 | Ga0207679_10967676 | Ga0207679_109676762 | 66 |
| 399 | 3300025945 | Ga0207679_11684293 | Ga0207679_116842931 | 66 |
| 400 | 3300025949 | Ga0207667_10168529 | Ga0207667_101685293 | 66 |
| 401 | 3300025949 | Ga0207667_10380613 | Ga0207667_103806132 | 66 |
| 402 | 3300025949 | Ga0207667_11051211 | Ga0207667_110512112 | 66 |
| 403 | 3300025949 | Ga0207667_11569865 | Ga0207667_115698652 | 66 |
| 404 | 3300025960 | Ga0207651_10041000 | Ga0207651_100410002 | 66 |
| 405 | 3300025960 | Ga0207651_10110459 | Ga0207651_101104594 | 66 |
| 406 | 3300025960 | Ga0207651_12040288 | Ga0207651_120402882 | 66 |
| 407 | 3300025961 | Ga0207712_10979130 | Ga0207712_109791302 | 66 |
| 408 | 3300025961 | Ga0207712_11432289 | Ga0207712_114322892 | 66 |
| 409 | 3300025981 | Ga0207640_10114374 | Ga0207640_101143742 | 66 |
| 410 | 3300025981 | Ga0207640_11200014 | Ga0207640_112000142 | 66 |
| 411 | 3300025981 | Ga0207640_11814302 | Ga0207640_118143022 | 66 |
| 412 | 3300025986 | Ga0207658_10945183 | Ga0207658_109451832 | 66 |
| 413 | 3300026023 | Ga0207677_10266317 | Ga0207677_102663173 | 66 |
| 414 | 3300026023 | Ga0207677_10762861 | Ga0207677_107628612 | 66 |
| 415 | 3300026035 | Ga0207703_10116219 | Ga0207703_101162193 | 66 |
| 416 | 3300026035 | Ga0207703_11140074 | Ga0207703_111400741 | 66 |
| 417 | 3300026035 | Ga0207703_12206250 | Ga0207703_122062501 | 66 |
| 418 | 3300026041 | Ga0207639_11714702 | Ga0207639_117147022 | 66 |
| 419 | 3300026041 | Ga0207639_11730632 | Ga0207639_117306322 | 66 |
| 420 | 3300026067 | Ga0207678_10226816 | Ga0207678_102268162 | 66 |
| 421 | 3300026067 | Ga0207678_10382018 | Ga0207678_103820183 | 66 |
| 422 | 3300026075 | Ga0207708_10881091 | Ga0207708_108810912 | 66 |
| 423 | 3300026078 | Ga0207702_10262266 | Ga0207702_102622663 | 66 |
| 424 | 3300026078 | Ga0207702_12346875 | Ga0207702_123468752 | 66 |
| 425 | 3300026088 | Ga0207641_10538452 | Ga0207641_105384522 | 66 |
| 426 | 3300026088 | Ga0207641_10752171 | Ga0207641_107521712 | 66 |
| 427 | 3300026088 | Ga0207641_11010931 | Ga0207641_110109312 | 66 |
| 428 | 3300026088 | Ga0207641_11685763 | Ga0207641_116857632 | 66 |
| 429 | 3300026088 | Ga0207641_12543463 | Ga0207641_125434632 | 66 |
| 430 | 3300026089 | Ga0207648_11067706 | Ga0207648_110677062 | 66 |
| 431 | 3300026095 | Ga0207676_10069079 | Ga0207676_100690792 | 66 |
| 432 | 3300026095 | Ga0207676_10259868 | Ga0207676_102598683 | 66 |
| 433 | 3300026095 | Ga0207676_10990839 | Ga0207676_109908392 | 66 |
| 434 | 3300026116 | Ga0207674_10203527 | Ga0207674_102035274 | 66 |
| 435 | 3300026116 | Ga0207674_10741845 | Ga0207674_107418452 | 66 |
| 436 | 3300026116 | Ga0207674_12260899 | Ga0207674_122608992 | 66 |
| 437 | 3300026118 | Ga0207675_100036086 | Ga0207675_1000360865 | 66 |
| 438 | 3300026118 | Ga0207675_100588336 | Ga0207675_1005883362 | 66 |
| 439 | 3300026118 | Ga0207675_100703465 | Ga0207675_1007034652 | 66 |
| 440 | 3300026142 | Ga0207698_10803886 | Ga0207698_108038862 | 66 |
| 441 | 3300027876 | Ga0209974_10068780 | Ga0209974_100687803 | 66 |
| 442 | 3300027907 | Ga0207428_10107542 | Ga0207428_101075424 | 66 |
| 443 | 3300028379 | Ga0268266_10439711 | Ga0268266_104397112 | 66 |
| 444 | 3300028379 | Ga0268266_11584602 | Ga0268266_115846022 | 66 |
| 445 | 3300028379 | Ga0268266_11703262 | Ga0268266_117032622 | 66 |
| 446 | 3300028380 | Ga0268265_10374275 | Ga0268265_103742753 | 66 |
| 447 | 3300028380 | Ga0268265_12213937 | Ga0268265_122139372 | 66 |
| 448 | 3300028380 | Ga0268265_12311931 | Ga0268265_123119312 | 66 |
| 449 | 3300028381 | Ga0268264_10042810 | Ga0268264_100428105 | 66 |
| 450 | 3300028381 | Ga0268264_10630972 | Ga0268264_106309723 | 66 |
| 451 | 3300028381 | Ga0268264_10759201 | Ga0268264_107592012 | 66 |
| 452 | 3300028381 | Ga0268264_11352914 | Ga0268264_113529142 | 66 |
| 453 | 3300028381 | Ga0268264_11502035 | Ga0268264_115020352 | 66 |
| 454 | 3300031238 | Ga0265332_10048353 | Ga0265332_100483531 | 66 |
| 455 | 3300031548 | Ga0307408_100880662 | Ga0307408_1008806622 | 66 |
| 456 | 3300031711 | Ga0265314_10007579 | Ga0265314_100075794 | 66 |
| 457 | 3300031852 | Ga0307410_11006253 | Ga0307410_110062532 | 66 |
| 458 | 3300032002 | Ga0307416_100160347 | Ga0307416_1001603474 | 66 |
| 459 | 3300032005 | Ga0307411_11200009 | Ga0307411_112000092 | 66 |
| 460 | 3300035088 | Ga0373940_0119908 | Ga0373940_0119908_488_688 | 66 |
| 461 | 3300035089 | Ga0373944_0043759 | Ga0373944_0043759_997_1197 | 66 |
| 462 | 3300035089 | Ga0373944_0073733 | Ga0373944_0073733_329_535 | 66 |
| 463 | 3300035090 | Ga0373949_0033224 | Ga0373949_0033224_229_435 | 66 |
| 464 | 3300035090 | Ga0373949_0124773 | Ga0373949_0124773_139_342 | 66 |
| 465 | 3300035092 | Ga0373952_0078480 | Ga0373952_0078480_361_564 | 66 |
| 466 | 3300035112 | Ga0373932_0056975 | Ga0373932_0056975_96_299 | 66 |
| 467 | 3300035113 | Ga0373936_0066682 | Ga0373936_0066682_1118_1321 | 66 |
| 468 | 3300035113 | Ga0373936_0092396 | Ga0373936_0092396_1019_1219 | 66 |
| 469 | 3300035113 | Ga0373936_0429403 | Ga0373936_0429403_101_301 | 66 |
| 470 | 3300035115 | Ga0373941_0032565 | Ga0373941_0032565_398_601 | 66 |
| 471 | 3300035117 | Ga0373953_0044678 | Ga0373953_0044678_1061_1261 | 66 |
| 472 | 3300035117 | Ga0373953_0166198 | Ga0373953_0166198_525_725 | 66 |
| 473 | 3300035117 | Ga0373953_0357585 | Ga0373953_0357585_333_533 | 66 |
| 474 | 3300035119 | Ga0373956_0208787 | Ga0373956_0208787_612_812 | 66 |
| 475 | 3300035119 | Ga0373956_0318300 | Ga0373956_0318300_457_657 | 66 |
| 476 | 3300035119 | Ga0373956_0434951 | Ga0373956_0434951_108_308 | 66 |
| 477 | 3300035120 | Ga0373957_0393842 | Ga0373957_0393842_62_262 | 66 |
| 478 | 3300035121 | Ga0373960_0314377 | Ga0373960_0314377_237_443 | 66 |
| 479 | 3300035170 | Ga0373943_0227905 | Ga0373943_0227905_445_645 | 66 |
| 480 | 3300035171 | Ga0373946_0550365 | Ga0373946_0550365_350_556 | 66 |
| 481 | 3300035172 | Ga0373955_0059904 | Ga0373955_0059904_920_1120 | 66 |
| 482 | 3300035242 | Ga0373962_0020596 | Ga0373962_0020596_37_240 | 66 |
| 483 | 3300035242 | Ga0373962_0119812 | Ga0373962_0119812_426_632 | 66 |
| 484 | 3300035410 | Ga0373924_0284127 | Ga0373924_0284127_183_383 | 66 |
| 485 | 3300035692 | Ga0373935_0087624 | Ga0373935_0087624_968_1168 | 66 |
| 486 | 3300035692 | Ga0373935_0659096 | Ga0373935_0659096_315_521 | 66 |
| 487 | 3300035695 | Ga0373927_0785312 | Ga0373927_0785312_418_618 | 66 |
| 488 | 3300035724 | Ga0373933_0563395 | Ga0373933_0563395_91_291 | 66 |
| 489 | 3300035725 | Ga0373947_0085310 | Ga0373947_0085310_1194_1394 | 66 |
| 490 | 3300036401 | Ga0373937_0055553 | Ga0373937_0055553_848_1048 | 66 |
| 491 | 3300036401 | Ga0373937_0525359 | Ga0373937_0525359_344_544 | 66 |
| 492 | 3300036401 | Ga0373937_1423261 | Ga0373937_1423261_267_473 | 66 |
| 493 | 3300036401 | Ga0373937_1612530 | Ga0373937_1612530_253_453 | 66 |
| 494 | 3300036401 | Ga0373937_1632611 | Ga0373937_1632611_83_283 | 66 |
| 495 | 3300036401 | Ga0373937_1810046 | Ga0373937_1810046_123_329 | 66 |
| 496 | 3300037068 | Ga0373925_0160073 | Ga0373925_0160073_106_306 | 66 |
| 497 | 3300037068 | Ga0373925_0281546 | Ga0373925_0281546_37_237 | 66 |
| 498 | 3300037068 | Ga0373925_0346976 | Ga0373925_0346976_332_532 | 66 |
| 499 | 3300037068 | Ga0373925_0855660 | Ga0373925_0855660_417_617 | 66 |
| 500 | 3300037068 | Ga0373925_1189255 | Ga0373925_1189255_144_344 | 66 |
| 501 | 3300039453 | Ga0436362_0941488 | Ga0436362_0941488_556_762 | 66 |
| 502 | 3300041512 | Ga0451853_0176660 | Ga0451853_0176660_13_216 | 66 |
| 503 | 3300042461 | Ga0439460_0065210 | Ga0439460_0065210_687_890 | 66 |
| 504 | 3300044673 | Ga0453683_0712373 | Ga0453683_0712373_186_392 | 66 |
| 505 | 3300045051 | Ga0451576_0277902 | Ga0451576_0277902_965_1165 | 66 |
| 506 | 3300045976 | Ga0466967_1719151 | Ga0466967_1719151_366_572 | 66 |
| 507 | 3300046454 | Ga0495592_0386335 | Ga0495592_0386335_216_416 | 66 |
| 508 | 3300046455 | Ga0495603_0056649 | Ga0495603_0056649_1384_1584 | 66 |
| 509 | 3300046457 | Ga0495590_0221155 | Ga0495590_0221155_291_491 | 66 |
| 510 | 3300046459 | Ga0495629_0039618 | Ga0495629_0039618_406_612 | 66 |
| 511 | 3300046459 | Ga0495629_0108936 | Ga0495629_0108936_320_520 | 66 |
| 512 | 3300046459 | Ga0495629_0316991 | Ga0495629_0316991_716_916 | 66 |
| 513 | 3300046459 | Ga0495629_0690277 | Ga0495629_0690277_84_284 | 66 |
| 514 | 3300046459 | Ga0495629_0968157 | Ga0495629_0968157_231_434 | 66 |
| 515 | 3300046461 | Ga0495641_0068787 | Ga0495641_0068787_159_359 | 66 |
| 516 | 3300046463 | Ga0495653_0252550 | Ga0495653_0252550_90_290 | 66 |
| 517 | 3300046463 | Ga0495653_0492522 | Ga0495653_0492522_31_231 | 66 |
| 518 | 3300046472 | Ga0495580_0510654 | Ga0495580_0510654_404_604 | 66 |
| 519 | 3300046472 | Ga0495580_0597560 | Ga0495580_0597560_68_268 | 66 |
| 520 | 3300046473 | Ga0495582_0422807 | Ga0495582_0422807_556_756 | 66 |
| 521 | 3300046473 | Ga0495582_0514545 | Ga0495582_0514545_166_366 | 66 |
| 522 | 3300046475 | Ga0495639_0407678 | Ga0495639_0407678_466_666 | 66 |
| 523 | 3300046475 | Ga0495639_0513715 | Ga0495639_0513715_146_346 | 66 |
| 524 | 3300046476 | Ga0495662_0460798 | Ga0495662_0460798_338_538 | 66 |
| 525 | 3300046477 | Ga0495664_0138486 | Ga0495664_0138486_926_1126 | 66 |
| 526 | 3300046499 | Ga0495594_0551693 | Ga0495594_0551693_191_391 | 66 |
| 527 | 3300046499 | Ga0495594_0754485 | Ga0495594_0754485_217_417 | 66 |
| 528 | 3300046500 | Ga0495596_0301736 | Ga0495596_0301736_335_541 | 66 |
| 529 | 3300046512 | Ga0495610_0116527 | Ga0495610_0116527_46_246 | 66 |
| 530 | 3300046516 | Ga0495628_0162934 | Ga0495628_0162934_982_1182 | 66 |
| 531 | 3300046517 | Ga0495630_0318966 | Ga0495630_0318966_304_504 | 66 |
| 532 | 3300046517 | Ga0495630_0478384 | Ga0495630_0478384_248_448 | 66 |
| 533 | 3300046517 | Ga0495630_0659959 | Ga0495630_0659959_159_359 | 66 |
| 534 | 3300046525 | Ga0495663_0270249 | Ga0495663_0270249_282_485 | 66 |
| 535 | 3300046526 | Ga0495666_0192761 | Ga0495666_0192761_582_782 | 66 |
| 536 | 3300046528 | Ga0495642_0266488 | Ga0495642_0266488_183_383 | 66 |
| 537 | 3300046533 | Ga0495640_0030475 | Ga0495640_0030475_12_212 | 66 |
| 538 | 3300046535 | Ga0495586_0077462 | Ga0495586_0077462_1291_1491 | 66 |
| 539 | 3300046535 | Ga0495586_0632529 | Ga0495586_0632529_376_576 | 66 |
| 540 | 3300046539 | Ga0495621_0069184 | Ga0495621_0069184_386_589 | 66 |
| 541 | 3300046539 | Ga0495621_0209773 | Ga0495621_0209773_286_486 | 66 |
| 542 | 3300046539 | Ga0495621_0387659 | Ga0495621_0387659_267_473 | 66 |
| 543 | 3300046543 | Ga0495645_0004427 | Ga0495645_0004427_4029_4229 | 66 |
| 544 | 3300046559 | Ga0495667_0170548 | Ga0495667_0170548_737_937 | 66 |
| 545 | 3300046559 | Ga0495667_0352457 | Ga0495667_0352457_716_916 | 66 |
| 546 | 3300046559 | Ga0495667_0946690 | Ga0495667_0946690_149_349 | 66 |
| 547 | 3300046642 | Ga0495634_0323067 | Ga0495634_0323067_504_704 | 66 |
| 548 | 3300046642 | Ga0495634_0680230 | Ga0495634_0680230_327_527 | 66 |
| 549 | 3300046648 | Ga0495611_0179280 | Ga0495611_0179280_721_921 | 66 |
| 550 | 3300046663 | Ga0495635_0088954 | Ga0495635_0088954_166_366 | 66 |
| 551 | 3300046663 | Ga0495635_0452811 | Ga0495635_0452811_219_419 | 66 |
| 552 | 3300046663 | Ga0495635_0967834 | Ga0495635_0967834_22_222 | 66 |
| 553 | 3300046664 | Ga0495659_0233321 | Ga0495659_0233321_171_374 | 66 |
| 554 | 3300046681 | Ga0495647_0173683 | Ga0495647_0173683_278_478 | 66 |
| 555 | 3300046681 | Ga0495647_0182375 | Ga0495647_0182375_241_441 | 66 |
| 556 | 3300046681 | Ga0495647_0187512 | Ga0495647_0187512_26_226 | 66 |
| 557 | 3300046683 | Ga0495658_0063955 | Ga0495658_0063955_1307_1507 | 66 |
| 558 | 3300046683 | Ga0495658_0143499 | Ga0495658_0143499_1249_1449 | 66 |
| 559 | 3300046683 | Ga0495658_0276569 | Ga0495658_0276569_26_226 | 66 |
| 560 | 3300046683 | Ga0495658_0514264 | Ga0495658_0514264_350_550 | 66 |
| 561 | 3300046684 | Ga0495669_0043985 | Ga0495669_0043985_1019_1222 | 66 |
| 562 | 3300046689 | Ga0495613_0202812 | Ga0495613_0202812_112_312 | 66 |
| 563 | 3300046689 | Ga0495613_0468282 | Ga0495613_0468282_521_721 | 66 |
| 564 | 3300046689 | Ga0495613_0709851 | Ga0495613_0709851_100_300 | 66 |
| 565 | 3300046689 | Ga0495613_0749542 | Ga0495613_0749542_15_215 | 66 |
| 566 | 3300046690 | Ga0495624_0143899 | Ga0495624_0143899_1242_1448 | 66 |
| 567 | 3300046794 | Ga0495589_0369051 | Ga0495589_0369051_123_326 | 66 |
| 568 | 3300046809 | Ga0495600_0334896 | Ga0495600_0334896_35_235 | 66 |
| 569 | 3300047315 | Ga0495581_0230317 | Ga0495581_0230317_654_860 | 66 |
| 570 | 3300047315 | Ga0495581_0320979 | Ga0495581_0320979_306_506 | 66 |
| 571 | 3300047319 | Ga0495674_0111892 | Ga0495674_0111892_84_284 | 66 |
| 572 | 3300047319 | Ga0495674_0130151 | Ga0495674_0130151_971_1171 | 66 |
| 573 | 3300047320 | Ga0495672_0157192 | Ga0495672_0157192_633_833 | 66 |
| 574 | 3300047321 | Ga0495676_0801951 | Ga0495676_0801951_217_417 | 66 |
| 575 | 3300047322 | Ga0495680_0504547 | Ga0495680_0504547_611_811 | 66 |
| 576 | 3300047444 | Ga0495675_0369920 | Ga0495675_0369920_625_825 | 66 |
| 577 | 3300047445 | Ga0495677_0067254 | Ga0495677_0067254_893_1096 | 66 |
| 578 | 3300047471 | Ga0495684_0073724 | Ga0495684_0073724_547_747 | 66 |
| 579 | 3300047673 | Ga0495593_0553400 | Ga0495593_0553400_76_282 | 66 |
| 580 | 3300048088 | Ga0495602_0306123 | Ga0495602_0306123_725_925 | 66 |
| 581 | 3300048903 | Ga0496100_0682033 | Ga0496100_0682033_400_606 | 66 |
| 582 | 3300048904 | Ga0496101_0966544 | Ga0496101_0966544_216_422 | 66 |
| 583 | 3300048905 | Ga0496102_0198095 | Ga0496102_0198095_1253_1456 | 66 |
| 584 | 3300048907 | Ga0496104_0017385 | Ga0496104_0017385_4817_5017 | 66 |
| 585 | 3300048908 | Ga0496105_1392591 | Ga0496105_1392591_223_423 | 66 |
| 586 | 3300048909 | Ga0496106_0299493 | Ga0496106_0299493_756_959 | 66 |
| 587 | 3300048911 | Ga0496108_0011060 | Ga0496108_0011060_2001_2201 | 66 |
| 588 | 3300048912 | Ga0496109_0151382 | Ga0496109_0151382_443_646 | 66 |
| 589 | 3300048912 | Ga0496109_0191312 | Ga0496109_0191312_976_1176 | 66 |
| 590 | 3300048912 | Ga0496109_0204246 | Ga0496109_0204246_353_559 | 66 |
| 591 | 3300048913 | Ga0496110_0157481 | Ga0496110_0157481_1177_1383 | 66 |
| 592 | 3300048913 | Ga0496110_0399484 | Ga0496110_0399484_313_516 | 66 |
| 593 | 3300048915 | Ga0496112_0016237 | Ga0496112_0016237_6092_6292 | 66 |
| 594 | 3300048915 | Ga0496112_0205425 | Ga0496112_0205425_1192_1398 | 66 |
| 595 | 3300048915 | Ga0496112_0509564 | Ga0496112_0509564_525_728 | 66 |
| 596 | 3300048916 | Ga0496113_0032056 | Ga0496113_0032056_721_921 | 66 |
| 597 | 3300048916 | Ga0496113_1293943 | Ga0496113_1293943_210_413 | 66 |
| 598 | 3300048917 | Ga0496114_0013645 | Ga0496114_0013645_1507_1707 | 66 |
| 599 | 3300049460 | Ga0495682_0101315 | Ga0495682_0101315_638_838 | 66 |
| 600 | 3300049571 | Ga0501034_0077055 | Ga0501034_0077055_2459_2665 | 66 |
| 601 | 3300049571 | Ga0501034_0108508 | Ga0501034_0108508_1285_1488 | 66 |
| 602 | 3300049571 | Ga0501034_1039997 | Ga0501034_1039997_447_653 | 66 |
| 603 | 3300049572 | Ga0501036_0638071 | Ga0501036_0638071_298_501 | 66 |
| 604 | 3300049572 | Ga0501036_1046904 | Ga0501036_1046904_305_511 | 66 |
| 605 | 3300049573 | Ga0501037_0399894 | Ga0501037_0399894_675_881 | 66 |
| 606 | 3300049579 | Ga0501043_0067123 | Ga0501043_0067123_1237_1443 | 66 |
| 607 | 3300049581 | Ga0501047_0015370 | Ga0501047_0015370_6425_6631 | 66 |
| 608 | 3300049581 | Ga0501047_0399559 | Ga0501047_0399559_56_259 | 66 |
| 609 | 3300049584 | Ga0501068_0172060 | Ga0501068_0172060_474_677 | 66 |
| 610 | 3300049585 | Ga0501069_0373707 | Ga0501069_0373707_541_744 | 66 |
| 611 | 3300049742 | Ga0501080_0935207 | Ga0501080_0935207_258_464 | 66 |
| 612 | 3300049744 | Ga0501083_0137210 | Ga0501083_0137210_663_866 | 66 |
| 613 | 3300049744 | Ga0501083_0501650 | Ga0501083_0501650_450_653 | 66 |
| 614 | 3300049765 | Ga0501268_131814 | Ga0501268_131814_146_352 | 66 |
| 615 | 3300049822 | Ga0501035_1457144 | Ga0501035_1457144_202_408 | 66 |
| 616 | 3300049823 | Ga0501044_0003452 | Ga0501044_0003452_1156_1362 | 66 |
| 617 | 3300049823 | Ga0501044_0832038 | Ga0501044_0832038_100_306 | 66 |
| 618 | 3300050494 | nmdc:mga06z11_310287_c1 | nmdc:mga06z11_310287_c1_144_344 | 66 |
| 619 | 3300050507 | nmdc:mga05p37_119480_c1 | nmdc:mga05p37_119480_c1_1313_1513 | 66 |
| 620 | 3300050507 | nmdc:mga05p37_1513211_c1 | nmdc:mga05p37_1513211_c1_245_445 | 66 |
| 621 | 3300050507 | nmdc:mga05p37_1745505_c1 | nmdc:mga05p37_1745505_c1_103_306 | 66 |
| 622 | 3300050507 | nmdc:mga05p37_47027_c1 | nmdc:mga05p37_47027_c1_390_593 | 66 |
| 623 | 3300050508 | nmdc:mga09592_112102_c1 | nmdc:mga09592_112102_c1_1360_1563 | 66 |
| 624 | 3300050511 | nmdc:mga08y16_1578794_c1 | nmdc:mga08y16_1578794_c1_283_483 | 66 |
| 625 | 3300050511 | nmdc:mga08y16_95418_c1 | nmdc:mga08y16_95418_c1_2195_2401 | 66 |
| 626 | 3300050512 | nmdc:mga0n895_1012336_c1 | nmdc:mga0n895_1012336_c1_332_535 | 66 |
| 627 | 3300050512 | nmdc:mga0n895_1652621_c1 | nmdc:mga0n895_1652621_c1_123_323 | 66 |
| 628 | 3300050512 | nmdc:mga0n895_1721021_c1 | nmdc:mga0n895_1721021_c1_276_482 | 66 |
| 629 | 3300050512 | nmdc:mga0n895_2113049_c1 | nmdc:mga0n895_2113049_c1_96_299 | 66 |
| 630 | 3300050512 | nmdc:mga0n895_675524_c1 | nmdc:mga0n895_675524_c1_62_274 | 66 |
| 631 | 3300050513 | nmdc:mga0rr50_1096711_c1 | nmdc:mga0rr50_1096711_c1_196_399 | 66 |
| 632 | 3300050513 | nmdc:mga0rr50_1228000_c1 | nmdc:mga0rr50_1228000_c1_382_582 | 66 |
| 633 | 3300050514 | nmdc:mga08x19_811162_c1 | nmdc:mga08x19_811162_c1_395_601 | 66 |
| 634 | 3300050515 | nmdc:mga0a205_798332_c1 | nmdc:mga0a205_798332_c1_533_736 | 66 |
| 635 | 3300050515 | nmdc:mga0a205_98384_c1 | nmdc:mga0a205_98384_c1_2150_2353 | 66 |
| 636 | 3300053077 | Ga0495601_0179517 | Ga0495601_0179517_612_812 | 66 |
| 637 | 3300053084 | Ga0495595_0247835 | Ga0495595_0247835_643_843 | 66 |
| 638 | 3300053084 | Ga0495595_0315265 | Ga0495595_0315265_278_484 | 66 |
| 639 | 3300053085 | Ga0495619_0044291 | Ga0495619_0044291_2628_2828 | 66 |
| 640 | 3300053085 | Ga0495619_0247047 | Ga0495619_0247047_644_844 | 66 |
| 641 | 3300053085 | Ga0495619_0463495 | Ga0495619_0463495_520_720 | 66 |
| 642 | 3300053134 | Ga0500658_0026256 | Ga0500658_0026256_508_711 | 66 |
| 643 | 3300053134 | Ga0500658_0304386 | Ga0500658_0304386_131_331 | 66 |
| 644 | 3300059506 | Ga0587085_107945 | Ga0587085_107945_245_451 | 66 |
| 645 | 3300060353 | Ga0501082_0257595 | Ga0501082_0257595_1144_1347 | 66 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mrf-assembly1.cif.gz_U | structure of the yeast mitochondrial ribosome - class c | 0.9319 | 11 | 66 |
| 6fxc-assembly1.cif.gz_AX | the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus | 0.9317 | 11 | 66 |
| 5hl7-assembly1.cif.gz_W | the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin | 0.9273 | 11 | 66 |
| 7nhn-assembly1.cif.gz_3 | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9263 | 13 | 66 |
| 4wf9-assembly1.cif.gz_W | the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with telithromycin | 0.9183 | 10 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vw4U00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9286 | 11 | 66 | 3.30.1390.20 |
| 5hl7W00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9273 | 11 | 66 | 3.30.1390.20 |
| 4wfbW00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9257 | 11 | 66 | 3.30.1390.20 |
| af_B6SIL2_19_102_3.30.1390.20 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9253 | 11 | 66 | 3.30.1390.20 |
| af_C0H5I4_95_195_3.30.1390.20 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9241 | 14 | 64 | 3.30.1390.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0FPQ4-F1-model_v4 | Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL15; Large ribosomal subunit protein uL30] | 0.9907 | 12 | 66 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-C7LKI6-F1-model_v4 | Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS5; Large ribosomal subunit protein uL30] | 0.9708 | 12 | 66 |
GO:0003735
GO:0006412 GO:0015934 GO:0015935 GO:0019843 |
| AF-A0A6L7YVA9-F1-model_v4 | 50S ribosomal protein L30 | 0.9383 | 11 | 66 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2M8DUU5-F1-model_v4 | Large ribosomal subunit protein uL30 | 0.9358 | 12 | 66 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A6M4GZS5-F1-model_v4 | Large ribosomal subunit protein uL30 | 0.9357 | 12 | 66 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar