F472103

General Info

Members Datasets Scaffolds Average Seq Length
645 299 645 67

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_102121942|Ga0070668_1021219422
Length 78
Sequence VDNTVAQSNNTMANERTDSKGSGTMKVTLLRSPIGFNRNQLAVVKSLGLRRIRHTVEIKDTPAMRGMVHKVRHLVEVE

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 3.41
Rhizosphere 95.81
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F6ESG4R02F99NE 2088090002 Bacteria 519
2 JGI24751J29686_10002990 3300002459 Bacteria 3413
3 JGI24751J29686_10080272 3300002459 Bacteria 676
4 Ga0058863_11687864 3300004799 Unclassified 507
5 Ga0058861_10070191 3300004800 Bacteria 1718
6 Ga0058862_12512468 3300004803 Bacteria 861
7 Ga0058862_12835766 3300004803 Bacteria 1387
8 Ga0058862_12893714 3300004803 Bacteria 1913
9 Ga0065714_10329800 3300005288 Bacteria 594
10 Ga0065712_10071314 3300005290 Bacteria 5345
11 Ga0065712_10101699 3300005290 Bacteria 2027
12 Ga0065712_10269749 3300005290 Bacteria 911
13 Ga0065712_10518856 3300005290 Bacteria 604
14 Ga0065712_10605422 3300005290 Bacteria 588
15 Ga0065712_10628472 3300005290 Bacteria 577
16 Ga0065715_10422444 3300005293 Bacteria 856
17 Ga0065715_10520569 3300005293 Bacteria 764
18 Ga0065707_10173975 3300005295 Bacteria 1464
19 Ga0070658_10302065 3300005327 Bacteria 1365
20 Ga0070658_11694789 3300005327 Bacteria 547
21 Ga0070683_100261901 3300005329 Bacteria 1645
22 Ga0070683_101286941 3300005329 Bacteria 703
23 Ga0070690_100665097 3300005330 Bacteria 797
24 Ga0070670_100050949 3300005331 Bacteria 3557
25 Ga0070670_100278888 3300005331 Bacteria 1459
26 Ga0070670_100596116 3300005331 Bacteria 988
27 Ga0070670_100911954 3300005331 Bacteria 797
28 Ga0070670_102197235 3300005331 Bacteria 508
29 Ga0070677_10104469 3300005333 Bacteria 1255
30 Ga0070677_10140954 3300005333 Bacteria 1112
31 Ga0068869_100139170 3300005334 Bacteria 1873
32 Ga0068869_100271176 3300005334 Bacteria 1361
33 Ga0068869_100338717 3300005334 Bacteria 1223
34 Ga0068869_101174195 3300005334 Bacteria 674
35 Ga0068869_101488801 3300005334 Bacteria 601
36 Ga0070666_10501666 3300005335 Bacteria 880
37 Ga0070666_10551035 3300005335 Bacteria 839
38 Ga0070666_11123088 3300005335 Bacteria 585
39 Ga0070680_100345010 3300005336 Bacteria 1266
40 Ga0070682_100148242 3300005337 Bacteria 1607
41 Ga0068868_100322874 3300005338 Bacteria 1315
42 Ga0070660_100002987 3300005339 Bacteria 11642
43 Ga0070660_100138512 3300005339 Bacteria 1951
44 Ga0070689_100210129 3300005340 Bacteria 1592
45 Ga0070689_101793862 3300005340 Unclassified 559
46 Ga0070691_10753841 3300005341 Bacteria 589
47 Ga0070661_100460429 3300005344 Bacteria 1013
48 Ga0070661_101595586 3300005344 Bacteria 552
49 Ga0070668_101574622 3300005347 Bacteria 602
50 Ga0070668_102121942 3300005347 Bacteria 519
51 Ga0070669_100266395 3300005353 Bacteria 1369
52 Ga0070675_100315632 3300005354 Bacteria 1380
53 Ga0070675_100503460 3300005354 Bacteria 1091
54 Ga0070671_100435498 3300005355 Bacteria 1124
55 Ga0070671_101544139 3300005355 Bacteria 588
56 Ga0070674_100046049 3300005356 Bacteria 2982
57 Ga0070674_100078891 3300005356 Bacteria 2347
58 Ga0070674_101067818 3300005356 Bacteria 712
59 Ga0070674_102019813 3300005356 Bacteria 525
60 Ga0070673_100003427 3300005364 Bacteria 9877
61 Ga0070673_100117740 3300005364 Bacteria 2211
62 Ga0070673_100650339 3300005364 Bacteria 965
63 Ga0070673_100950529 3300005364 Bacteria 798
64 Ga0070688_100408199 3300005365 Bacteria 1007
65 Ga0070688_100489627 3300005365 Bacteria 926
66 Ga0070688_100656809 3300005365 Bacteria 808
67 Ga0070688_101438511 3300005365 Bacteria 559
68 Ga0070659_101495240 3300005366 Bacteria 602
69 Ga0070667_100168474 3300005367 Bacteria 1932
70 Ga0070667_100423262 3300005367 Bacteria 1214
71 Ga0070667_101014034 3300005367 Bacteria 775
72 Ga0070667_101310295 3300005367 Bacteria 679
73 Ga0070667_101786484 3300005367 Bacteria 579
74 Ga0070667_101815461 3300005367 Bacteria 574
75 Ga0070709_10020289 3300005434 Bacteria 3854
76 Ga0070713_101514279 3300005436 Unclassified 651
77 Ga0070710_10097350 3300005437 Bacteria 1746
78 Ga0070705_100732958 3300005440 Bacteria 780
79 Ga0070705_101120349 3300005440 Bacteria 645
80 Ga0070700_100548056 3300005441 Bacteria 898
81 Ga0070700_101074592 3300005441 Bacteria 666
82 Ga0070700_101148122 3300005441 Bacteria 646
83 Ga0070694_100871495 3300005444 Bacteria 742
84 Ga0070708_101240510 3300005445 Bacteria 697
85 Ga0070678_100233115 3300005456 Bacteria 1536
86 Ga0070662_100851136 3300005457 Bacteria 776
87 Ga0070662_101626249 3300005457 Bacteria 558
88 Ga0070662_101945811 3300005457 Bacteria 508
89 Ga0070681_10019826 3300005458 Bacteria 6735
90 Ga0068867_100513996 3300005459 Bacteria 1031
91 Ga0068867_101847949 3300005459 Bacteria 569
92 Ga0070685_10580950 3300005466 Bacteria 804
93 Ga0070685_11308965 3300005466 Bacteria 554
94 Ga0070698_101511185 3300005471 Bacteria 623
95 Ga0070699_100119032 3300005518 Bacteria 2322
96 Ga0070699_100164340 3300005518 Bacteria 1966
97 Ga0070699_101586749 3300005518 Bacteria 600
98 Ga0070699_101775577 3300005518 Bacteria 565
99 Ga0070679_100044653 3300005530 Bacteria 4415
100 Ga0070679_100084074 3300005530 Bacteria 3171
101 Ga0070684_100338991 3300005535 Bacteria 1382
102 Ga0070684_100709529 3300005535 Bacteria 938
103 Ga0070684_102230004 3300005535 Bacteria 517
104 Ga0070697_100842893 3300005536 Bacteria 812
105 Ga0068853_100264579 3300005539 Bacteria 1582
106 Ga0070672_100287420 3300005543 Bacteria 1392
107 Ga0070672_100428160 3300005543 Bacteria 1137
108 Ga0070686_100282478 3300005544 Bacteria 1225
109 Ga0070686_100335256 3300005544 Bacteria 1132
110 Ga0070695_100404437 3300005545 Bacteria 1036
111 Ga0070696_100848751 3300005546 Bacteria 755
112 Ga0070696_101166463 3300005546 Bacteria 650
113 Ga0070665_100005447 3300005548 Bacteria 13122
114 Ga0070665_100663567 3300005548 Bacteria 1056
115 Ga0070704_101248001 3300005549 Bacteria 679
116 Ga0070704_101347523 3300005549 Bacteria 654
117 Ga0068855_100286434 3300005563 Bacteria 1827
118 Ga0068855_100421940 3300005563 Bacteria 1459
119 Ga0068855_100534530 3300005563 Bacteria 1271
120 Ga0068855_100868726 3300005563 Bacteria 955
121 Ga0068855_101104655 3300005563 Bacteria 829
122 Ga0070664_100461940 3300005564 Bacteria 1166
123 Ga0070664_100723900 3300005564 Bacteria 928
124 Ga0070664_100812333 3300005564 Bacteria 875
125 Ga0070664_100843581 3300005564 Bacteria 858
126 Ga0070664_101612142 3300005564 Bacteria 615
127 Ga0070664_101695089 3300005564 Unclassified 599
128 Ga0068857_101894243 3300005577 Bacteria 584
129 Ga0068854_100428672 3300005578 Bacteria 1100
130 Ga0068854_101091286 3300005578 Bacteria 711
131 Ga0068854_101671245 3300005578 Bacteria 582
132 Ga0068854_102054371 3300005578 Bacteria 527
133 Ga0068856_100018557 3300005614 Bacteria 6740
134 Ga0070702_100647573 3300005615 Bacteria 799
135 Ga0070702_101366398 3300005615 Bacteria 578
136 Ga0068852_100647787 3300005616 Bacteria 1064
137 Ga0068852_102051610 3300005616 Bacteria 594
138 Ga0068852_102268577 3300005616 Bacteria 564
139 Ga0068859_100573752 3300005617 Bacteria 1222
140 Ga0068859_101413220 3300005617 Bacteria 767
141 Ga0068859_102313179 3300005617 Bacteria 593
142 Ga0068864_100385694 3300005618 Bacteria 1329
143 Ga0068864_100497372 3300005618 Bacteria 1172
144 Ga0068864_100580014 3300005618 Bacteria 1086
145 Ga0068864_101084216 3300005618 Bacteria 797
146 Ga0068866_10457970 3300005718 Bacteria 836
147 Ga0068861_100196584 3300005719 Bacteria 1690
148 Ga0068861_100326592 3300005719 Bacteria 1338
149 Ga0068861_100451931 3300005719 Bacteria 1151
150 Ga0068861_100496389 3300005719 Bacteria 1102
151 Ga0068861_102301584 3300005719 Bacteria 541
152 Ga0068851_10998528 3300005834 Bacteria 528
153 Ga0068870_10198737 3300005840 Bacteria 1214
154 Ga0068870_11290736 3300005840 Bacteria 531
155 Ga0068863_100116322 3300005841 Bacteria 2548
156 Ga0068863_100127685 3300005841 Bacteria 2427
157 Ga0068863_101247544 3300005841 Bacteria 750
158 Ga0068858_100133765 3300005842 Bacteria 2326
159 Ga0068858_100411153 3300005842 Bacteria 1300
160 Ga0068858_101550906 3300005842 Bacteria 653
161 Ga0068860_100304719 3300005843 Bacteria 1561
162 Ga0068860_100344425 3300005843 Bacteria 1466
163 Ga0068860_100725428 3300005843 Bacteria 1004
164 Ga0068860_101415446 3300005843 Bacteria 716
165 Ga0068860_101655613 3300005843 Bacteria 662
166 Ga0068862_100130660 3300005844 Bacteria 2221
167 Ga0068862_100556118 3300005844 Bacteria 1096
168 Ga0068862_101632664 3300005844 Unclassified 652
169 Ga0068862_101975256 3300005844 Bacteria 594
170 Ga0068862_102242035 3300005844 Bacteria 558
171 Ga0068862_102242425 3300005844 Bacteria 558
172 Ga0068862_102299841 3300005844 Bacteria 551
173 Ga0081455_10174261 3300005937 Bacteria 1635
174 Ga0081455_10833757 3300005937 Unclassified 577
175 Ga0070715_10237715 3300006163 Bacteria 946
176 Ga0070715_10935810 3300006163 Unclassified 536
177 Ga0070716_100341366 3300006173 Bacteria 1057
178 Ga0075367_10258480 3300006178 Bacteria 1093
179 Ga0097621_100020231 3300006237 Bacteria 5126
180 Ga0097621_100118810 3300006237 Bacteria 2241
181 Ga0097621_100147924 3300006237 Bacteria 2013
182 Ga0068871_100006055 3300006358 Bacteria 8509
183 Ga0068871_100148240 3300006358 Bacteria 2000
184 Ga0068871_100460996 3300006358 Bacteria 1141
185 Ga0075428_100312003 3300006844 Bacteria 1690
186 Ga0075428_102132995 3300006844 Unclassified 579
187 Ga0075433_10128181 3300006852 Bacteria 2254
188 Ga0075433_11282772 3300006852 Bacteria 635
189 Ga0075434_101943943 3300006871 Bacteria 594
190 Ga0075429_100522210 3300006880 Bacteria 1040
191 Ga0068865_100006729 3300006881 Bacteria 7032
192 Ga0068865_100391738 3300006881 Bacteria 1136
193 Ga0068865_100715964 3300006881 Bacteria 857
194 Ga0068865_101055817 3300006881 Bacteria 714
195 Ga0075436_100028497 3300006914 Bacteria 3842
196 Ga0097620_100573707 3300006931 Bacteria 1222
197 Ga0097620_101413166 3300006931 Bacteria 767
198 Ga0097620_102312791 3300006931 Bacteria 593
199 Ga0075435_101236869 3300007076 Bacteria 653
200 Ga0105251_10210348 3300009011 Bacteria 876
201 Ga0105240_10045226 3300009093 Bacteria 5587
202 Ga0105240_10177867 3300009093 Bacteria 2514
203 Ga0105240_10887187 3300009093 Bacteria 960
204 Ga0105245_10607498 3300009098 Bacteria 1121
205 Ga0105245_10689778 3300009098 Bacteria 1054
206 Ga0105245_11313691 3300009098 Bacteria 772
207 Ga0105245_12152927 3300009098 Bacteria 611
208 Ga0105245_12545687 3300009098 Unclassified 565
209 Ga0105247_10004209 3300009101 Bacteria 9230
210 Ga0114129_10123569 3300009147 Bacteria 3560
211 Ga0114129_10150048 3300009147 Bacteria 3190
212 Ga0114129_11155727 3300009147 Bacteria 966
213 Ga0114129_11235126 3300009147 Bacteria 929
214 Ga0114129_12294442 3300009147 Bacteria 648
215 Ga0105243_10245118 3300009148 Bacteria 1597
216 Ga0105243_10952956 3300009148 Bacteria 857
217 Ga0105241_11270462 3300009174 Bacteria 700
218 Ga0105241_11696682 3300009174 Bacteria 614
219 Ga0105241_12533961 3300009174 Unclassified 514
220 Ga0105242_10067271 3300009176 Bacteria 2962
221 Ga0105242_10177665 3300009176 Bacteria 1876
222 Ga0105242_10901770 3300009176 Bacteria 884
223 Ga0105242_12782863 3300009176 Bacteria 539
224 Ga0105248_10013460 3300009177 Bacteria 9007
225 Ga0105248_10019507 3300009177 Bacteria 7503
226 Ga0105248_10224670 3300009177 Bacteria 2114
227 Ga0105248_10448915 3300009177 Bacteria 1453
228 Ga0105248_10481300 3300009177 Bacteria 1399
229 Ga0105248_10719068 3300009177 Bacteria 1127
230 Ga0105248_10819264 3300009177 Bacteria 1051
231 Ga0105248_11783822 3300009177 Bacteria 698
232 Ga0105248_13243032 3300009177 Bacteria 517
233 Ga0105237_11729579 3300009545 Bacteria 633
234 Ga0105238_10125557 3300009551 Bacteria 2545
235 Ga0105238_12725545 3300009551 Bacteria 531
236 Ga0105249_10205139 3300009553 Bacteria 1931
237 Ga0105249_10936999 3300009553 Bacteria 934
238 Ga0105249_11617360 3300009553 Bacteria 720
239 Ga0105249_12292786 3300009553 Bacteria 613
240 Ga0105249_13304575 3300009553 Bacteria 519
241 Ga0099796_10030103 3300010159 Bacteria 1758
242 Ga0105239_10725470 3300010375 Bacteria 1137
243 Ga0105246_10270358 3300011119 Bacteria 1358
244 Ga0105246_10667877 3300011119 Bacteria 907
245 Ga0105246_10811883 3300011119 Bacteria 831
246 Ga0157369_11245679 3300013105 Bacteria 759
247 Ga0157378_10363162 3300013297 Bacteria 1417
248 Ga0157378_11149159 3300013297 Bacteria 815
249 Ga0157378_11186863 3300013297 Bacteria 802
250 Ga0157378_12234604 3300013297 Bacteria 598
251 Ga0163162_10519827 3300013306 Bacteria 1320
252 Ga0163162_11473787 3300013306 Bacteria 775
253 Ga0163162_13114052 3300013306 Bacteria 532
254 Ga0163162_13287241 3300013306 Bacteria 518
255 Ga0163162_13325897 3300013306 Bacteria 514
256 Ga0157375_10444566 3300013308 Bacteria 1462
257 Ga0157375_10766805 3300013308 Bacteria 1115
258 Ga0157375_12472611 3300013308 Unclassified 620
259 Ga0163163_10087285 3300014325 Bacteria 3130
260 Ga0163163_10319094 3300014325 Bacteria 1607
261 Ga0163163_10548084 3300014325 Bacteria 1219
262 Ga0163163_10641362 3300014325 Bacteria 1126
263 Ga0163163_11731632 3300014325 Bacteria 686
264 Ga0157380_10280688 3300014326 Bacteria 1524
265 Ga0157380_13426170 3300014326 Bacteria 508
266 Ga0157380_13507926 3300014326 Unclassified 502
267 Ga0157377_10660678 3300014745 Bacteria 754
268 Ga0157379_10356802 3300014968 Bacteria 1339
269 Ga0157379_11456189 3300014968 Bacteria 665
270 Ga0157379_11748557 3300014968 Bacteria 610
271 Ga0157379_12387208 3300014968 Bacteria 528
272 Ga0157376_10414998 3300014969 Bacteria 1305
273 Ga0157376_10510102 3300014969 Bacteria 1183
274 Ga0157376_11266519 3300014969 Bacteria 767
275 Ga0157376_11434349 3300014969 Bacteria 722
276 Ga0157376_12045711 3300014969 Bacteria 611
277 Ga0163161_10812730 3300017792 Bacteria 786
278 Ga0224712_10584166 3300022467 Unclassified 545
279 Ga0207697_10232639 3300025315 Bacteria 814
280 Ga0207682_10094553 3300025893 Bacteria 1300
281 Ga0207692_10181644 3300025898 Bacteria 1226
282 Ga0207692_11158308 3300025898 Bacteria 513
283 Ga0207642_10258962 3300025899 Bacteria 991
284 Ga0207688_10190402 3300025901 Bacteria 1227
285 Ga0207688_10559536 3300025901 Bacteria 719
286 Ga0207688_10745755 3300025901 Bacteria 620
287 Ga0207680_10942505 3300025903 Bacteria 619
288 Ga0207685_10776622 3300025905 Bacteria 526
289 Ga0207699_10014062 3300025906 Bacteria 4113
290 Ga0207645_10479675 3300025907 Bacteria 841
291 Ga0207643_10090349 3300025908 Bacteria 1785
292 Ga0207705_10546213 3300025909 Bacteria 901
293 Ga0207705_11076000 3300025909 Bacteria 620
294 Ga0207654_10223831 3300025911 Bacteria 1249
295 Ga0207707_10042746 3300025912 Bacteria 3954
296 Ga0207707_10599424 3300025912 Bacteria 933
297 Ga0207695_10084625 3300025913 Bacteria 3202
298 Ga0207695_10131709 3300025913 Bacteria 2458
299 Ga0207695_10350332 3300025913 Bacteria 1364
300 Ga0207660_10141452 3300025917 Bacteria 1840
301 Ga0207657_10013143 3300025919 Bacteria 8130
302 Ga0207657_10149049 3300025919 Bacteria 1906
303 Ga0207649_10659408 3300025920 Bacteria 809
304 Ga0207649_10910409 3300025920 Bacteria 690
305 Ga0207652_10085259 3300025921 Bacteria 2768
306 Ga0207652_10607803 3300025921 Bacteria 980
307 Ga0207681_10215274 3300025923 Bacteria 1483
308 Ga0207694_10150838 3300025924 Bacteria 1873
309 Ga0207694_10487438 3300025924 Bacteria 1031
310 Ga0207650_10063849 3300025925 Bacteria 2755
311 Ga0207650_10193461 3300025925 Bacteria 1626
312 Ga0207650_10400909 3300025925 Bacteria 1135
313 Ga0207650_10731305 3300025925 Bacteria 837
314 Ga0207659_10308581 3300025926 Bacteria 1302
315 Ga0207659_10350045 3300025926 Bacteria 1225
316 Ga0207659_10525156 3300025926 Bacteria 1004
317 Ga0207659_10638716 3300025926 Bacteria 909
318 Ga0207687_10329664 3300025927 Bacteria 1238
319 Ga0207687_10462116 3300025927 Bacteria 1054
320 Ga0207687_11437491 3300025927 Unclassified 592
321 Ga0207700_11330332 3300025928 Unclassified 640
322 Ga0207644_11009988 3300025931 Bacteria 698
323 Ga0207690_10232957 3300025932 Bacteria 1415
324 Ga0207690_10727685 3300025932 Bacteria 817
325 Ga0207706_10812443 3300025933 Bacteria 794
326 Ga0207706_11353126 3300025933 Bacteria 586
327 Ga0207686_10013361 3300025934 Bacteria 4541
328 Ga0207686_10519480 3300025934 Bacteria 926
329 Ga0207709_11010645 3300025935 Bacteria 680
330 Ga0207669_10392616 3300025937 Bacteria 1084
331 Ga0207669_10788056 3300025937 Bacteria 787
332 Ga0207669_11819998 3300025937 Unclassified 520
333 Ga0207704_10005828 3300025938 Bacteria 5701
334 Ga0207704_11306999 3300025938 Bacteria 620
335 Ga0207665_11330151 3300025939 Bacteria 573
336 Ga0207691_10197382 3300025940 Bacteria 1752
337 Ga0207691_10419050 3300025940 Bacteria 1141
338 Ga0207691_11004862 3300025940 Bacteria 696
339 Ga0207711_10026433 3300025941 Bacteria 4870
340 Ga0207711_10136539 3300025941 Bacteria 2203
341 Ga0207711_10422755 3300025941 Bacteria 1239
342 Ga0207711_10480730 3300025941 Bacteria 1157
343 Ga0207711_10561479 3300025941 Bacteria 1065
344 Ga0207711_10746099 3300025941 Bacteria 912
345 Ga0207711_11004973 3300025941 Bacteria 774
346 Ga0207711_11650168 3300025941 Bacteria 584
347 Ga0207689_10034411 3300025942 Bacteria 4209
348 Ga0207689_10062920 3300025942 Bacteria 3052
349 Ga0207689_10365682 3300025942 Bacteria 1200
350 Ga0207689_10618427 3300025942 Bacteria 912
351 Ga0207689_10772295 3300025942 Bacteria 811
352 Ga0207689_10891739 3300025942 Bacteria 750
353 Ga0207679_10392851 3300025945 Bacteria 1218
354 Ga0207679_10395275 3300025945 Bacteria 1215
355 Ga0207679_10885125 3300025945 Bacteria 816
356 Ga0207679_10967676 3300025945 Bacteria 780
357 Ga0207679_11684293 3300025945 Bacteria 580
358 Ga0207667_10168529 3300025949 Bacteria 2251
359 Ga0207667_10380613 3300025949 Bacteria 1438
360 Ga0207667_11051211 3300025949 Bacteria 799
361 Ga0207667_11569865 3300025949 Bacteria 627
362 Ga0207651_10041000 3300025960 Bacteria 3069
363 Ga0207651_10110459 3300025960 Bacteria 2062
364 Ga0207651_12040288 3300025960 Bacteria 515
365 Ga0207712_10447401 3300025961 Bacteria 1095
366 Ga0207712_10979130 3300025961 Bacteria 750
367 Ga0207712_11432289 3300025961 Bacteria 618
368 Ga0207640_10114374 3300025981 Bacteria 1920
369 Ga0207640_11200014 3300025981 Bacteria 675
370 Ga0207640_11814302 3300025981 Bacteria 551
371 Ga0207658_10945183 3300025986 Bacteria 786
372 Ga0207677_10266317 3300026023 Bacteria 1399
373 Ga0207677_10762861 3300026023 Bacteria 863
374 Ga0207703_10116219 3300026035 Bacteria 2290
375 Ga0207703_11140074 3300026035 Bacteria 749
376 Ga0207703_12206250 3300026035 Bacteria 527
377 Ga0207639_11714702 3300026041 Bacteria 589
378 Ga0207639_11730632 3300026041 Bacteria 586
379 Ga0207678_10226816 3300026067 Bacteria 1599
380 Ga0207678_10382018 3300026067 Bacteria 1218
381 Ga0207708_10881091 3300026075 Bacteria 774
382 Ga0207708_10948384 3300026075 Bacteria 746
383 Ga0207702_10262266 3300026078 Bacteria 1627
384 Ga0207702_12346875 3300026078 Bacteria 521
385 Ga0207641_10319476 3300026088 Bacteria 1472
386 Ga0207641_10538452 3300026088 Bacteria 1137
387 Ga0207641_10571695 3300026088 Bacteria 1104
388 Ga0207641_10752171 3300026088 Bacteria 962
389 Ga0207641_11010931 3300026088 Bacteria 828
390 Ga0207641_11685763 3300026088 Bacteria 636
391 Ga0207641_12543463 3300026088 Bacteria 510
392 Ga0207648_11067706 3300026089 Bacteria 757
393 Ga0207676_10069079 3300026095 Bacteria 2828
394 Ga0207676_10259868 3300026095 Bacteria 1567
395 Ga0207676_10990839 3300026095 Bacteria 828
396 Ga0207674_10062761 3300026116 Bacteria 3752
397 Ga0207674_10203527 3300026116 Bacteria 1929
398 Ga0207674_10741845 3300026116 Bacteria 948
399 Ga0207674_12260899 3300026116 Bacteria 506
400 Ga0207675_100036086 3300026118 Bacteria 4611
401 Ga0207675_100588336 3300026118 Bacteria 1115
402 Ga0207675_100703465 3300026118 Bacteria 1020
403 Ga0207675_102402739 3300026118 Bacteria 539
404 Ga0207698_10803886 3300026142 Bacteria 943
405 Ga0209974_10068780 3300027876 Bacteria 1206
406 Ga0207428_10107542 3300027907 Bacteria 2149
407 Ga0268266_10439711 3300028379 Bacteria 1238
408 Ga0268266_11584602 3300028379 Bacteria 630
409 Ga0268266_11703262 3300028379 Unclassified 606
410 Ga0268265_10374275 3300028380 Bacteria 1308
411 Ga0268265_12107161 3300028380 Bacteria 571
412 Ga0268265_12213937 3300028380 Bacteria 557
413 Ga0268265_12311931 3300028380 Unclassified 544
414 Ga0268264_10042810 3300028381 Bacteria 3749
415 Ga0268264_10630972 3300028381 Bacteria 1059
416 Ga0268264_10759201 3300028381 Bacteria 967
417 Ga0268264_11352914 3300028381 Bacteria 722
418 Ga0268264_11502035 3300028381 Bacteria 684
419 Ga0265332_10048353 3300031238 Bacteria 1830
420 Ga0307408_100880662 3300031548 Bacteria 818
421 Ga0265314_10007579 3300031711 Bacteria 9400
422 Ga0307410_11006253 3300031852 Bacteria 719
423 Ga0307416_100160347 3300032002 Bacteria 2078
424 Ga0307411_11200009 3300032005 Bacteria 688
425 Ga0373926_0217316 3300035083 Bacteria 737
426 Ga0373940_0119908 3300035088 Bacteria 815
427 Ga0373944_0043759 3300035089 Bacteria 1392
428 Ga0373944_0073733 3300035089 Bacteria 1116
429 Ga0373949_0033224 3300035090 Bacteria 1239
430 Ga0373949_0124773 3300035090 Bacteria 726
431 Ga0373952_0078480 3300035092 Bacteria 839
432 Ga0373932_0056975 3300035112 Bacteria 1177
433 Ga0373936_0066682 3300035113 Bacteria 1478
434 Ga0373936_0092396 3300035113 Bacteria 1270
435 Ga0373936_0429403 3300035113 Bacteria 609
436 Ga0373939_0495396 3300035114 Bacteria 521
437 Ga0373941_0032565 3300035115 Bacteria 1561
438 Ga0373945_0035271 3300035116 Bacteria 1787
439 Ga0373953_0044678 3300035117 Bacteria 1772
440 Ga0373953_0166198 3300035117 Bacteria 949
441 Ga0373953_0357585 3300035117 Bacteria 640
442 Ga0373956_0208787 3300035119 Bacteria 926
443 Ga0373956_0318300 3300035119 Bacteria 741
444 Ga0373956_0434951 3300035119 Bacteria 626
445 Ga0373957_0393842 3300035120 Bacteria 595
446 Ga0373960_0314377 3300035121 Bacteria 586
447 Ga0373943_0036985 3300035170 Bacteria 2341
448 Ga0373943_0227905 3300035170 Bacteria 1040
449 Ga0373946_0550365 3300035171 Bacteria 595
450 Ga0373946_0614479 3300035171 Bacteria 564
451 Ga0373955_0059904 3300035172 Bacteria 2098
452 Ga0373955_0117147 3300035172 Bacteria 1545
453 Ga0373962_0020596 3300035242 Bacteria 1733
454 Ga0373962_0119812 3300035242 Bacteria 838
455 Ga0373924_0284127 3300035410 Bacteria 734
456 Ga0373924_0293802 3300035410 Bacteria 721
457 Ga0373935_0087624 3300035692 Bacteria 2033
458 Ga0373935_0659096 3300035692 Bacteria 768
459 Ga0373935_1057631 3300035692 Bacteria 603
460 Ga0373927_0785312 3300035695 Bacteria 629
461 Ga0373933_0563395 3300035724 Bacteria 748
462 Ga0373947_0018266 3300035725 Bacteria 4036
463 Ga0373947_0085310 3300035725 Bacteria 1961
464 Ga0373937_0055553 3300036401 Bacteria 3635
465 Ga0373937_0105781 3300036401 Bacteria 2615
466 Ga0373937_0525359 3300036401 Bacteria 1124
467 Ga0373937_0663831 3300036401 Bacteria 988
468 Ga0373937_1423261 3300036401 Bacteria 641
469 Ga0373937_1612530 3300036401 Bacteria 596
470 Ga0373937_1632611 3300036401 Bacteria 592
471 Ga0373937_1810046 3300036401 Bacteria 557
472 Ga0373925_0160073 3300037068 Bacteria 1773
473 Ga0373925_0281546 3300037068 Bacteria 1339
474 Ga0373925_0346976 3300037068 Bacteria 1205
475 Ga0373925_0460133 3300037068 Bacteria 1042
476 Ga0373925_0855660 3300037068 Bacteria 749
477 Ga0373925_1189255 3300037068 Bacteria 627
478 Ga0436362_0941488 3300039453 Bacteria 849
479 Ga0451853_0176660 3300041512 Bacteria 599
480 Ga0439460_0065210 3300042461 Bacteria 1119
481 Ga0453683_0712373 3300044673 Bacteria 658
482 Ga0451576_0277902 3300045051 Bacteria 1751
483 Ga0466967_1719151 3300045976 Bacteria 625
484 Ga0495592_0386335 3300046454 Bacteria 890
485 Ga0495603_0056649 3300046455 Bacteria 2320
486 Ga0495590_0221155 3300046457 Bacteria 699
487 Ga0495629_0039618 3300046459 Bacteria 3316
488 Ga0495629_0108936 3300046459 Bacteria 1932
489 Ga0495629_0316991 3300046459 Bacteria 1066
490 Ga0495629_0690277 3300046459 Bacteria 678
491 Ga0495629_0968157 3300046459 Bacteria 555
492 Ga0495641_0068787 3300046461 Bacteria 1592
493 Ga0495653_0089085 3300046463 Bacteria 2262
494 Ga0495653_0159656 3300046463 Bacteria 1566
495 Ga0495653_0252550 3300046463 Bacteria 1170
496 Ga0495653_0492522 3300046463 Bacteria 765
497 Ga0495580_0510654 3300046472 Bacteria 802
498 Ga0495580_0597560 3300046472 Bacteria 729
499 Ga0495582_0422807 3300046473 Bacteria 769
500 Ga0495582_0514545 3300046473 Bacteria 692
501 Ga0495639_0407678 3300046475 Bacteria 687
502 Ga0495639_0513715 3300046475 Bacteria 612
503 Ga0495662_0460798 3300046476 Bacteria 624
504 Ga0495664_0138486 3300046477 Bacteria 1475
505 Ga0495594_0551693 3300046499 Unclassified 654
506 Ga0495594_0754485 3300046499 Bacteria 549
507 Ga0495596_0301736 3300046500 Bacteria 623
508 Ga0495608_0294871 3300046511 Bacteria 1005
509 Ga0495610_0116527 3300046512 Bacteria 1177
510 Ga0495628_0162934 3300046516 Bacteria 1694
511 Ga0495628_0401499 3300046516 Bacteria 1001
512 Ga0495630_0239054 3300046517 Bacteria 1388
513 Ga0495630_0318966 3300046517 Bacteria 1188
514 Ga0495630_0478384 3300046517 Bacteria 955
515 Ga0495630_0659959 3300046517 Bacteria 801
516 Ga0495663_0270249 3300046525 Bacteria 607
517 Ga0495666_0192761 3300046526 Bacteria 939
518 Ga0495642_0266488 3300046528 Bacteria 750
519 Ga0495640_0030475 3300046533 Bacteria 3862
520 Ga0495586_0077462 3300046535 Bacteria 1823
521 Ga0495586_0632529 3300046535 Bacteria 618
522 Ga0495586_0887621 3300046535 Bacteria 514
523 Ga0495621_0069184 3300046539 Bacteria 1297
524 Ga0495621_0209773 3300046539 Bacteria 786
525 Ga0495621_0387659 3300046539 Bacteria 591
526 Ga0495645_0004427 3300046543 Bacteria 9593
527 Ga0495645_0315041 3300046543 Bacteria 1018
528 Ga0495667_0170548 3300046559 Bacteria 1398
529 Ga0495667_0352457 3300046559 Bacteria 930
530 Ga0495667_0540001 3300046559 Bacteria 729
531 Ga0495667_0946690 3300046559 Bacteria 527
532 Ga0495634_0323067 3300046642 Bacteria 929
533 Ga0495634_0680230 3300046642 Bacteria 593
534 Ga0495611_0179280 3300046648 Bacteria 990
535 Ga0495635_0088954 3300046663 Bacteria 2113
536 Ga0495635_0452811 3300046663 Bacteria 848
537 Ga0495635_0967834 3300046663 Bacteria 543
538 Ga0495659_0233321 3300046664 Bacteria 763
539 Ga0495657_0314935 3300046675 Bacteria 931
540 Ga0495646_0336580 3300046680 Bacteria 793
541 Ga0495647_0173683 3300046681 Bacteria 934
542 Ga0495647_0182375 3300046681 Bacteria 914
543 Ga0495647_0187512 3300046681 Bacteria 902
544 Ga0495658_0063955 3300046683 Bacteria 2118
545 Ga0495658_0143499 3300046683 Bacteria 1462
546 Ga0495658_0195287 3300046683 Bacteria 1260
547 Ga0495658_0276569 3300046683 Bacteria 1059
548 Ga0495658_0514264 3300046683 Bacteria 766
549 Ga0495669_0043985 3300046684 Bacteria 1989
550 Ga0495613_0202812 3300046689 Bacteria 1398
551 Ga0495613_0468282 3300046689 Bacteria 852
552 Ga0495613_0483883 3300046689 Bacteria 835
553 Ga0495613_0709851 3300046689 Bacteria 661
554 Ga0495613_0749542 3300046689 Bacteria 640
555 Ga0495624_0143899 3300046690 Bacteria 1460
556 Ga0495589_0369051 3300046794 Bacteria 660
557 Ga0495600_0334896 3300046809 Bacteria 950
558 Ga0495581_0230317 3300047315 Bacteria 1084
559 Ga0495581_0320979 3300047315 Bacteria 905
560 Ga0495604_0115887 3300047317 Bacteria 1946
561 Ga0495674_0111892 3300047319 Bacteria 2314
562 Ga0495674_0130151 3300047319 Bacteria 2120
563 Ga0495674_0481768 3300047319 Bacteria 994
564 Ga0495672_0157192 3300047320 Bacteria 1173
565 Ga0495676_0801951 3300047321 Bacteria 606
566 Ga0495680_0504547 3300047322 Bacteria 821
567 Ga0495675_0369920 3300047444 Bacteria 840
568 Ga0495677_0067254 3300047445 Bacteria 1333
569 Ga0495684_0073724 3300047471 Bacteria 2593
570 Ga0495593_0553400 3300047673 Bacteria 577
571 Ga0495602_0306123 3300048088 Bacteria 1161
572 Ga0496100_0682033 3300048903 Bacteria 801
573 Ga0496101_0966544 3300048904 Bacteria 670
574 Ga0496102_0198095 3300048905 Bacteria 1893
575 Ga0496104_0017385 3300048907 Bacteria 6549
576 Ga0496105_1392591 3300048908 Bacteria 508
577 Ga0496106_0299493 3300048909 Bacteria 1289
578 Ga0496107_0652246 3300048910 Bacteria 776
579 Ga0496108_0011060 3300048911 Bacteria 7328
580 Ga0496109_0151382 3300048912 Bacteria 2172
581 Ga0496109_0191312 3300048912 Bacteria 1923
582 Ga0496109_0204246 3300048912 Bacteria 1858
583 Ga0496109_0224919 3300048912 Bacteria 1765
584 Ga0496110_0157481 3300048913 Bacteria 2058
585 Ga0496110_0195598 3300048913 Bacteria 1836
586 Ga0496110_0399484 3300048913 Bacteria 1253
587 Ga0496111_0181555 3300048914 Bacteria 1564
588 Ga0496112_0016237 3300048915 Bacteria 6967
589 Ga0496112_0205425 3300048915 Bacteria 1928
590 Ga0496112_0509564 3300048915 Bacteria 1138
591 Ga0496113_0032056 3300048916 Bacteria 3817
592 Ga0496113_1293943 3300048916 Bacteria 567
593 Ga0496114_0013645 3300048917 Bacteria 6514
594 Ga0495682_0101315 3300049460 Bacteria 1033
595 Ga0501034_0077055 3300049571 Bacteria 3340
596 Ga0501034_0108508 3300049571 Bacteria 2767
597 Ga0501034_1039997 3300049571 Bacteria 702
598 Ga0501036_0638071 3300049572 Bacteria 882
599 Ga0501036_1046904 3300049572 Bacteria 667
600 Ga0501037_0399894 3300049573 Bacteria 942
601 Ga0501043_0067123 3300049579 Bacteria 2817
602 Ga0501047_0015370 3300049581 Bacteria 7290
603 Ga0501047_0399559 3300049581 Bacteria 1207
604 Ga0501068_0172060 3300049584 Bacteria 1367
605 Ga0501069_0373707 3300049585 Bacteria 842
606 Ga0501080_0935207 3300049742 Bacteria 754
607 Ga0501083_0137210 3300049744 Bacteria 1602
608 Ga0501083_0501650 3300049744 Bacteria 790
609 Ga0501268_131814 3300049765 Bacteria 563
610 Ga0501035_1457144 3300049822 Bacteria 523
611 Ga0501044_0003452 3300049823 Bacteria 17800
612 Ga0501044_0832038 3300049823 Bacteria 801
613 nmdc:mga06z11_310287_c1 3300050494 Bacteria 939
614 nmdc:mga05p37_119480_c1 3300050507 Bacteria 3238
615 nmdc:mga05p37_1513211_c1 3300050507 Bacteria 667
616 nmdc:mga05p37_1745505_c1 3300050507 Bacteria 604
617 nmdc:mga05p37_47027_c1 3300050507 Bacteria 5306
618 nmdc:mga09592_112102_c1 3300050508 Bacteria 2340
619 nmdc:mga08y16_1578794_c1 3300050511 Bacteria 614
620 nmdc:mga08y16_95418_c1 3300050511 Bacteria 3098
621 nmdc:mga0n895_1012336_c1 3300050512 Bacteria 811
622 nmdc:mga0n895_1652621_c1 3300050512 Bacteria 604
623 nmdc:mga0n895_1721021_c1 3300050512 Bacteria 589
624 nmdc:mga0n895_2113049_c1 3300050512 Bacteria 519
625 nmdc:mga0n895_675524_c1 3300050512 Bacteria 1030
626 nmdc:mga0rr50_1096711_c1 3300050513 Bacteria 677
627 nmdc:mga0rr50_1228000_c1 3300050513 Bacteria 636
628 nmdc:mga08x19_811162_c1 3300050514 Bacteria 665
629 nmdc:mga0a205_798332_c1 3300050515 Bacteria 792
630 nmdc:mga0a205_98384_c1 3300050515 Bacteria 2824
631 Ga0495601_0179517 3300053077 Bacteria 1384
632 Ga0495595_0015689 3300053084 Bacteria 3233
633 Ga0495595_0247835 3300053084 Bacteria 892
634 Ga0495595_0315265 3300053084 Bacteria 787
635 Ga0495619_0044291 3300053085 Bacteria 2921
636 Ga0495619_0138514 3300053085 Bacteria 1674
637 Ga0495619_0247047 3300053085 Bacteria 1236
638 Ga0495619_0463495 3300053085 Bacteria 873
639 Ga0500658_0026256 3300053134 Bacteria 2243
640 Ga0500658_0304386 3300053134 Bacteria 733
641 Ga0501084_1272833 3300054114 Unclassified 617
642 Ga0501084_1703677 3300054114 Bacteria 527
643 Ga0587085_107945 3300059506 Unclassified 596
644 Ga0501082_0257595 3300060353 Bacteria 1518
645 Ga0501082_1348514 3300060353 Unclassified 623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026075 Ga0207708_10948384 Ga0207708_109483842 55
2 3300005844 Ga0068862_100130660 Ga0068862_1001306603 59
3 3300009098 Ga0105245_12152927 Ga0105245_121529271 59
4 3300026118 Ga0207675_102402739 Ga0207675_1024027392 59
5 3300005367 Ga0070667_100423262 Ga0070667_1004232621 60
6 3300005441 Ga0070700_101074592 Ga0070700_1010745922 60
7 3300054114 Ga0501084_1272833 Ga0501084_1272833_271_480 63
8 3300060353 Ga0501082_1348514 Ga0501082_1348514_376_585 63
9 3300005518 Ga0070699_100164340 Ga0070699_1001643402 64
10 3300002459 JGI24751J29686_10002990 JGI24751J29686_100029903 65
11 3300005290 Ga0065712_10071314 Ga0065712_100713147 65
12 3300005293 Ga0065715_10422444 Ga0065715_104224442 65
13 3300005331 Ga0070670_100050949 Ga0070670_1000509495 65
14 3300005331 Ga0070670_100911954 Ga0070670_1009119542 65
15 3300005340 Ga0070689_101793862 Ga0070689_1017938622 65
16 3300005355 Ga0070671_100435498 Ga0070671_1004354983 65
17 3300005364 Ga0070673_100650339 Ga0070673_1006503392 65
18 3300005365 Ga0070688_100489627 Ga0070688_1004896272 65
19 3300005365 Ga0070688_100656809 Ga0070688_1006568092 65
20 3300005564 Ga0070664_101695089 Ga0070664_1016950892 65
21 3300005617 Ga0068859_100573752 Ga0068859_1005737523 65
22 3300005618 Ga0068864_100580014 Ga0068864_1005800143 65
23 3300005841 Ga0068863_100127685 Ga0068863_1001276853 65
24 3300005843 Ga0068860_100344425 Ga0068860_1003444253 65
25 3300005844 Ga0068862_101632664 Ga0068862_1016326642 65
26 3300005844 Ga0068862_102242035 Ga0068862_1022420352 65
27 3300006237 Ga0097621_100147924 Ga0097621_1001479243 65
28 3300006358 Ga0068871_100148240 Ga0068871_1001482402 65
29 3300006844 Ga0075428_102132995 Ga0075428_1021329952 65
30 3300006931 Ga0097620_100573707 Ga0097620_1005737073 65
31 3300009177 Ga0105248_10013460 Ga0105248_100134609 65
32 3300009177 Ga0105248_10448915 Ga0105248_104489152 65
33 3300009553 Ga0105249_10205139 Ga0105249_102051392 65
34 3300011119 Ga0105246_10811883 Ga0105246_108118831 65
35 3300013306 Ga0163162_13114052 Ga0163162_131140521 65
36 3300013306 Ga0163162_13325897 Ga0163162_133258972 65
37 3300013308 Ga0157375_12472611 Ga0157375_124726112 65
38 3300014325 Ga0163163_10319094 Ga0163163_103190943 65
39 3300014968 Ga0157379_10356802 Ga0157379_103568022 65
40 3300014969 Ga0157376_11434349 Ga0157376_114343492 65
41 3300025925 Ga0207650_10063849 Ga0207650_100638495 65
42 3300025925 Ga0207650_10731305 Ga0207650_107313052 65
43 3300025941 Ga0207711_10136539 Ga0207711_101365394 65
44 3300025941 Ga0207711_10422755 Ga0207711_104227552 65
45 3300025945 Ga0207679_10885125 Ga0207679_108851252 65
46 3300025961 Ga0207712_10447401 Ga0207712_104474013 65
47 3300026088 Ga0207641_10319476 Ga0207641_103194763 65
48 3300026088 Ga0207641_10571695 Ga0207641_105716952 65
49 3300026116 Ga0207674_10062761 Ga0207674_100627613 65
50 3300028380 Ga0268265_12107161 Ga0268265_121071612 65
51 3300035083 Ga0373926_0217316 Ga0373926_0217316_463_672 65
52 3300035114 Ga0373939_0495396 Ga0373939_0495396_25_225 65
53 3300035116 Ga0373945_0035271 Ga0373945_0035271_1110_1319 65
54 3300035170 Ga0373943_0036985 Ga0373943_0036985_1171_1380 65
55 3300035171 Ga0373946_0614479 Ga0373946_0614479_242_451 65
56 3300035172 Ga0373955_0117147 Ga0373955_0117147_1165_1374 65
57 3300035410 Ga0373924_0293802 Ga0373924_0293802_279_488 65
58 3300035692 Ga0373935_1057631 Ga0373935_1057631_339_548 65
59 3300035725 Ga0373947_0018266 Ga0373947_0018266_2137_2346 65
60 3300036401 Ga0373937_0105781 Ga0373937_0105781_332_541 65
61 3300036401 Ga0373937_0663831 Ga0373937_0663831_373_582 65
62 3300037068 Ga0373925_0460133 Ga0373925_0460133_360_569 65
63 3300046463 Ga0495653_0089085 Ga0495653_0089085_1110_1319 65
64 3300046463 Ga0495653_0159656 Ga0495653_0159656_313_522 65
65 3300046511 Ga0495608_0294871 Ga0495608_0294871_642_851 65
66 3300046516 Ga0495628_0401499 Ga0495628_0401499_571_780 65
67 3300046517 Ga0495630_0239054 Ga0495630_0239054_836_1045 65
68 3300046535 Ga0495586_0887621 Ga0495586_0887621_148_357 65
69 3300046543 Ga0495645_0315041 Ga0495645_0315041_759_968 65
70 3300046559 Ga0495667_0540001 Ga0495667_0540001_261_470 65
71 3300046675 Ga0495657_0314935 Ga0495657_0314935_447_656 65
72 3300046680 Ga0495646_0336580 Ga0495646_0336580_167_376 65
73 3300046683 Ga0495658_0195287 Ga0495658_0195287_343_552 65
74 3300046689 Ga0495613_0483883 Ga0495613_0483883_291_500 65
75 3300047317 Ga0495604_0115887 Ga0495604_0115887_878_1087 65
76 3300047319 Ga0495674_0481768 Ga0495674_0481768_502_711 65
77 3300048910 Ga0496107_0652246 Ga0496107_0652246_487_693 65
78 3300048912 Ga0496109_0224919 Ga0496109_0224919_550_756 65
79 3300048913 Ga0496110_0195598 Ga0496110_0195598_872_1078 65
80 3300048914 Ga0496111_0181555 Ga0496111_0181555_615_821 65
81 3300053084 Ga0495595_0015689 Ga0495595_0015689_895_1104 65
82 3300053085 Ga0495619_0138514 Ga0495619_0138514_872_1081 65
83 3300054114 Ga0501084_1703677 Ga0501084_1703677_183_389 65
84 2088090002 CNA_F6ESG4R02F99NE CNA_00112610 66
85 3300002459 JGI24751J29686_10080272 JGI24751J29686_100802722 66
86 3300004799 Ga0058863_11687864 Ga0058863_116878642 66
87 3300004800 Ga0058861_10070191 Ga0058861_100701911 66
88 3300004803 Ga0058862_12512468 Ga0058862_125124682 66
89 3300004803 Ga0058862_12835766 Ga0058862_128357662 66
90 3300004803 Ga0058862_12893714 Ga0058862_128937144 66
91 3300005288 Ga0065714_10329800 Ga0065714_103298002 66
92 3300005290 Ga0065712_10101699 Ga0065712_101016993 66
93 3300005290 Ga0065712_10269749 Ga0065712_102697491 66
94 3300005290 Ga0065712_10518856 Ga0065712_105188561 66
95 3300005290 Ga0065712_10605422 Ga0065712_106054222 66
96 3300005290 Ga0065712_10628472 Ga0065712_106284722 66
97 3300005293 Ga0065715_10520569 Ga0065715_105205692 66
98 3300005295 Ga0065707_10173975 Ga0065707_101739753 66
99 3300005327 Ga0070658_10302065 Ga0070658_103020652 66
100 3300005327 Ga0070658_11694789 Ga0070658_116947891 66
101 3300005329 Ga0070683_100261901 Ga0070683_1002619013 66
102 3300005329 Ga0070683_101286941 Ga0070683_1012869411 66
103 3300005330 Ga0070690_100665097 Ga0070690_1006650971 66
104 3300005331 Ga0070670_100278888 Ga0070670_1002788882 66
105 3300005331 Ga0070670_100596116 Ga0070670_1005961163 66
106 3300005331 Ga0070670_102197235 Ga0070670_1021972352 66
107 3300005333 Ga0070677_10104469 Ga0070677_101044692 66
108 3300005333 Ga0070677_10140954 Ga0070677_101409543 66
109 3300005334 Ga0068869_100139170 Ga0068869_1001391701 66
110 3300005334 Ga0068869_100271176 Ga0068869_1002711763 66
111 3300005334 Ga0068869_100338717 Ga0068869_1003387173 66
112 3300005334 Ga0068869_101174195 Ga0068869_1011741951 66
113 3300005334 Ga0068869_101488801 Ga0068869_1014888012 66
114 3300005335 Ga0070666_10501666 Ga0070666_105016661 66
115 3300005335 Ga0070666_10551035 Ga0070666_105510351 66
116 3300005335 Ga0070666_11123088 Ga0070666_111230882 66
117 3300005336 Ga0070680_100345010 Ga0070680_1003450102 66
118 3300005337 Ga0070682_100148242 Ga0070682_1001482423 66
119 3300005338 Ga0068868_100322874 Ga0068868_1003228743 66
120 3300005339 Ga0070660_100002987 Ga0070660_1000029879 66
121 3300005339 Ga0070660_100138512 Ga0070660_1001385123 66
122 3300005340 Ga0070689_100210129 Ga0070689_1002101292 66
123 3300005341 Ga0070691_10753841 Ga0070691_107538412 66
124 3300005344 Ga0070661_100460429 Ga0070661_1004604291 66
125 3300005344 Ga0070661_101595586 Ga0070661_1015955862 66
126 3300005347 Ga0070668_101574622 Ga0070668_1015746221 66
127 3300005347 Ga0070668_102121942 Ga0070668_1021219422 66
128 3300005353 Ga0070669_100266395 Ga0070669_1002663952 66
129 3300005354 Ga0070675_100315632 Ga0070675_1003156323 66
130 3300005354 Ga0070675_100503460 Ga0070675_1005034602 66
131 3300005355 Ga0070671_101544139 Ga0070671_1015441392 66
132 3300005356 Ga0070674_100046049 Ga0070674_1000460497 66
133 3300005356 Ga0070674_100078891 Ga0070674_1000788913 66
134 3300005356 Ga0070674_101067818 Ga0070674_1010678182 66
135 3300005356 Ga0070674_102019813 Ga0070674_1020198131 66
136 3300005364 Ga0070673_100003427 Ga0070673_1000034277 66
137 3300005364 Ga0070673_100117740 Ga0070673_1001177403 66
138 3300005364 Ga0070673_100950529 Ga0070673_1009505292 66
139 3300005365 Ga0070688_100408199 Ga0070688_1004081992 66
140 3300005365 Ga0070688_101438511 Ga0070688_1014385112 66
141 3300005366 Ga0070659_101495240 Ga0070659_1014952401 66
142 3300005367 Ga0070667_100168474 Ga0070667_1001684743 66
143 3300005367 Ga0070667_101014034 Ga0070667_1010140342 66
144 3300005367 Ga0070667_101310295 Ga0070667_1013102951 66
145 3300005367 Ga0070667_101786484 Ga0070667_1017864842 66
146 3300005367 Ga0070667_101815461 Ga0070667_1018154612 66
147 3300005434 Ga0070709_10020289 Ga0070709_100202899 66
148 3300005436 Ga0070713_101514279 Ga0070713_1015142791 66
149 3300005437 Ga0070710_10097350 Ga0070710_100973503 66
150 3300005440 Ga0070705_100732958 Ga0070705_1007329582 66
151 3300005440 Ga0070705_101120349 Ga0070705_1011203492 66
152 3300005441 Ga0070700_100548056 Ga0070700_1005480562 66
153 3300005441 Ga0070700_101148122 Ga0070700_1011481221 66
154 3300005444 Ga0070694_100871495 Ga0070694_1008714952 66
155 3300005445 Ga0070708_101240510 Ga0070708_1012405102 66
156 3300005456 Ga0070678_100233115 Ga0070678_1002331152 66
157 3300005457 Ga0070662_100851136 Ga0070662_1008511362 66
158 3300005457 Ga0070662_101626249 Ga0070662_1016262491 66
159 3300005457 Ga0070662_101945811 Ga0070662_1019458112 66
160 3300005458 Ga0070681_10019826 Ga0070681_100198267 66
161 3300005459 Ga0068867_100513996 Ga0068867_1005139961 66
162 3300005459 Ga0068867_101847949 Ga0068867_1018479492 66
163 3300005466 Ga0070685_10580950 Ga0070685_105809502 66
164 3300005466 Ga0070685_11308965 Ga0070685_113089652 66
165 3300005471 Ga0070698_101511185 Ga0070698_1015111851 66
166 3300005518 Ga0070699_100119032 Ga0070699_1001190322 66
167 3300005518 Ga0070699_101586749 Ga0070699_1015867491 66
168 3300005518 Ga0070699_101775577 Ga0070699_1017755772 66
169 3300005530 Ga0070679_100044653 Ga0070679_1000446532 66
170 3300005530 Ga0070679_100084074 Ga0070679_1000840744 66
171 3300005535 Ga0070684_100338991 Ga0070684_1003389913 66
172 3300005535 Ga0070684_100709529 Ga0070684_1007095292 66
173 3300005535 Ga0070684_102230004 Ga0070684_1022300041 66
174 3300005536 Ga0070697_100842893 Ga0070697_1008428931 66
175 3300005539 Ga0068853_100264579 Ga0068853_1002645792 66
176 3300005543 Ga0070672_100287420 Ga0070672_1002874202 66
177 3300005543 Ga0070672_100428160 Ga0070672_1004281602 66
178 3300005544 Ga0070686_100282478 Ga0070686_1002824783 66
179 3300005544 Ga0070686_100335256 Ga0070686_1003352563 66
180 3300005545 Ga0070695_100404437 Ga0070695_1004044373 66
181 3300005546 Ga0070696_100848751 Ga0070696_1008487512 66
182 3300005546 Ga0070696_101166463 Ga0070696_1011664632 66
183 3300005548 Ga0070665_100005447 Ga0070665_1000054474 66
184 3300005548 Ga0070665_100663567 Ga0070665_1006635672 66
185 3300005549 Ga0070704_101248001 Ga0070704_1012480012 66
186 3300005549 Ga0070704_101347523 Ga0070704_1013475232 66
187 3300005563 Ga0068855_100286434 Ga0068855_1002864343 66
188 3300005563 Ga0068855_100421940 Ga0068855_1004219403 66
189 3300005563 Ga0068855_100534530 Ga0068855_1005345303 66
190 3300005563 Ga0068855_100868726 Ga0068855_1008687262 66
191 3300005563 Ga0068855_101104655 Ga0068855_1011046552 66
192 3300005564 Ga0070664_100461940 Ga0070664_1004619402 66
193 3300005564 Ga0070664_100723900 Ga0070664_1007239002 66
194 3300005564 Ga0070664_100812333 Ga0070664_1008123332 66
195 3300005564 Ga0070664_100843581 Ga0070664_1008435812 66
196 3300005564 Ga0070664_101612142 Ga0070664_1016121422 66
197 3300005577 Ga0068857_101894243 Ga0068857_1018942432 66
198 3300005578 Ga0068854_100428672 Ga0068854_1004286723 66
199 3300005578 Ga0068854_101091286 Ga0068854_1010912862 66
200 3300005578 Ga0068854_101671245 Ga0068854_1016712452 66
201 3300005578 Ga0068854_102054371 Ga0068854_1020543712 66
202 3300005614 Ga0068856_100018557 Ga0068856_1000185576 66
203 3300005615 Ga0070702_100647573 Ga0070702_1006475732 66
204 3300005615 Ga0070702_101366398 Ga0070702_1013663982 66
205 3300005616 Ga0068852_100647787 Ga0068852_1006477873 66
206 3300005616 Ga0068852_102051610 Ga0068852_1020516101 66
207 3300005616 Ga0068852_102268577 Ga0068852_1022685772 66
208 3300005617 Ga0068859_101413220 Ga0068859_1014132202 66
209 3300005617 Ga0068859_102313179 Ga0068859_1023131792 66
210 3300005618 Ga0068864_100385694 Ga0068864_1003856943 66
211 3300005618 Ga0068864_100497372 Ga0068864_1004973722 66
212 3300005618 Ga0068864_101084216 Ga0068864_1010842162 66
213 3300005718 Ga0068866_10457970 Ga0068866_104579702 66
214 3300005719 Ga0068861_100196584 Ga0068861_1001965843 66
215 3300005719 Ga0068861_100326592 Ga0068861_1003265921 66
216 3300005719 Ga0068861_100451931 Ga0068861_1004519312 66
217 3300005719 Ga0068861_100496389 Ga0068861_1004963892 66
218 3300005719 Ga0068861_102301584 Ga0068861_1023015842 66
219 3300005834 Ga0068851_10998528 Ga0068851_109985282 66
220 3300005840 Ga0068870_10198737 Ga0068870_101987372 66
221 3300005840 Ga0068870_11290736 Ga0068870_112907361 66
222 3300005841 Ga0068863_100116322 Ga0068863_1001163222 66
223 3300005841 Ga0068863_101247544 Ga0068863_1012475442 66
224 3300005842 Ga0068858_100133765 Ga0068858_1001337653 66
225 3300005842 Ga0068858_100411153 Ga0068858_1004111533 66
226 3300005842 Ga0068858_101550906 Ga0068858_1015509062 66
227 3300005843 Ga0068860_100304719 Ga0068860_1003047192 66
228 3300005843 Ga0068860_100725428 Ga0068860_1007254283 66
229 3300005843 Ga0068860_101415446 Ga0068860_1014154461 66
230 3300005843 Ga0068860_101655613 Ga0068860_1016556132 66
231 3300005844 Ga0068862_100556118 Ga0068862_1005561182 66
232 3300005844 Ga0068862_101975256 Ga0068862_1019752562 66
233 3300005844 Ga0068862_102242425 Ga0068862_1022424252 66
234 3300005844 Ga0068862_102299841 Ga0068862_1022998412 66
235 3300005937 Ga0081455_10174261 Ga0081455_101742612 66
236 3300005937 Ga0081455_10833757 Ga0081455_108337571 66
237 3300006163 Ga0070715_10237715 Ga0070715_102377153 66
238 3300006163 Ga0070715_10935810 Ga0070715_109358101 66
239 3300006173 Ga0070716_100341366 Ga0070716_1003413663 66
240 3300006178 Ga0075367_10258480 Ga0075367_102584802 66
241 3300006237 Ga0097621_100020231 Ga0097621_1000202312 66
242 3300006237 Ga0097621_100118810 Ga0097621_1001188103 66
243 3300006358 Ga0068871_100006055 Ga0068871_1000060558 66
244 3300006358 Ga0068871_100460996 Ga0068871_1004609962 66
245 3300006844 Ga0075428_100312003 Ga0075428_1003120033 66
246 3300006852 Ga0075433_10128181 Ga0075433_101281813 66
247 3300006852 Ga0075433_11282772 Ga0075433_112827722 66
248 3300006871 Ga0075434_101943943 Ga0075434_1019439432 66
249 3300006880 Ga0075429_100522210 Ga0075429_1005222101 66
250 3300006881 Ga0068865_100006729 Ga0068865_10000672916 66
251 3300006881 Ga0068865_100391738 Ga0068865_1003917382 66
252 3300006881 Ga0068865_100715964 Ga0068865_1007159642 66
253 3300006881 Ga0068865_101055817 Ga0068865_1010558172 66
254 3300006914 Ga0075436_100028497 Ga0075436_1000284978 66
255 3300006931 Ga0097620_101413166 Ga0097620_1014131662 66
256 3300006931 Ga0097620_102312791 Ga0097620_1023127912 66
257 3300007076 Ga0075435_101236869 Ga0075435_1012368692 66
258 3300009011 Ga0105251_10210348 Ga0105251_102103482 66
259 3300009093 Ga0105240_10045226 Ga0105240_100452268 66
260 3300009093 Ga0105240_10177867 Ga0105240_101778673 66
261 3300009093 Ga0105240_10887187 Ga0105240_108871872 66
262 3300009098 Ga0105245_10607498 Ga0105245_106074983 66
263 3300009098 Ga0105245_10689778 Ga0105245_106897782 66
264 3300009098 Ga0105245_11313691 Ga0105245_113136912 66
265 3300009098 Ga0105245_12545687 Ga0105245_125456872 66
266 3300009101 Ga0105247_10004209 Ga0105247_100042095 66
267 3300009147 Ga0114129_10123569 Ga0114129_101235695 66
268 3300009147 Ga0114129_10150048 Ga0114129_101500482 66
269 3300009147 Ga0114129_11155727 Ga0114129_111557271 66
270 3300009147 Ga0114129_11235126 Ga0114129_112351262 66
271 3300009147 Ga0114129_12294442 Ga0114129_122944422 66
272 3300009148 Ga0105243_10245118 Ga0105243_102451183 66
273 3300009148 Ga0105243_10952956 Ga0105243_109529562 66
274 3300009174 Ga0105241_11270462 Ga0105241_112704622 66
275 3300009174 Ga0105241_11696682 Ga0105241_116966822 66
276 3300009174 Ga0105241_12533961 Ga0105241_125339612 66
277 3300009176 Ga0105242_10067271 Ga0105242_100672712 66
278 3300009176 Ga0105242_10177665 Ga0105242_101776653 66
279 3300009176 Ga0105242_10901770 Ga0105242_109017702 66
280 3300009176 Ga0105242_12782863 Ga0105242_127828632 66
281 3300009177 Ga0105248_10019507 Ga0105248_100195079 66
282 3300009177 Ga0105248_10224670 Ga0105248_102246702 66
283 3300009177 Ga0105248_10481300 Ga0105248_104813003 66
284 3300009177 Ga0105248_10719068 Ga0105248_107190682 66
285 3300009177 Ga0105248_10819264 Ga0105248_108192641 66
286 3300009177 Ga0105248_11783822 Ga0105248_117838222 66
287 3300009177 Ga0105248_13243032 Ga0105248_132430322 66
288 3300009545 Ga0105237_11729579 Ga0105237_117295792 66
289 3300009551 Ga0105238_10125557 Ga0105238_101255573 66
290 3300009551 Ga0105238_12725545 Ga0105238_127255452 66
291 3300009553 Ga0105249_10936999 Ga0105249_109369992 66
292 3300009553 Ga0105249_11617360 Ga0105249_116173601 66
293 3300009553 Ga0105249_12292786 Ga0105249_122927861 66
294 3300009553 Ga0105249_13304575 Ga0105249_133045752 66
295 3300010159 Ga0099796_10030103 Ga0099796_100301034 66
296 3300010375 Ga0105239_10725470 Ga0105239_107254702 66
297 3300011119 Ga0105246_10270358 Ga0105246_102703583 66
298 3300011119 Ga0105246_10667877 Ga0105246_106678771 66
299 3300013105 Ga0157369_11245679 Ga0157369_112456792 66
300 3300013297 Ga0157378_10363162 Ga0157378_103631623 66
301 3300013297 Ga0157378_11149159 Ga0157378_111491592 66
302 3300013297 Ga0157378_11186863 Ga0157378_111868632 66
303 3300013297 Ga0157378_12234604 Ga0157378_122346042 66
304 3300013306 Ga0163162_10519827 Ga0163162_105198273 66
305 3300013306 Ga0163162_11473787 Ga0163162_114737872 66
306 3300013306 Ga0163162_13287241 Ga0163162_132872411 66
307 3300013308 Ga0157375_10444566 Ga0157375_104445663 66
308 3300013308 Ga0157375_10766805 Ga0157375_107668052 66
309 3300014325 Ga0163163_10087285 Ga0163163_100872854 66
310 3300014325 Ga0163163_10548084 Ga0163163_105480842 66
311 3300014325 Ga0163163_10641362 Ga0163163_106413622 66
312 3300014325 Ga0163163_11731632 Ga0163163_117316321 66
313 3300014326 Ga0157380_10280688 Ga0157380_102806884 66
314 3300014326 Ga0157380_13426170 Ga0157380_134261702 66
315 3300014326 Ga0157380_13507926 Ga0157380_135079262 66
316 3300014745 Ga0157377_10660678 Ga0157377_106606782 66
317 3300014968 Ga0157379_11456189 Ga0157379_114561892 66
318 3300014968 Ga0157379_11748557 Ga0157379_117485572 66
319 3300014968 Ga0157379_12387208 Ga0157379_123872081 66
320 3300014969 Ga0157376_10414998 Ga0157376_104149983 66
321 3300014969 Ga0157376_10510102 Ga0157376_105101023 66
322 3300014969 Ga0157376_11266519 Ga0157376_112665191 66
323 3300014969 Ga0157376_12045711 Ga0157376_120457112 66
324 3300017792 Ga0163161_10812730 Ga0163161_108127302 66
325 3300022467 Ga0224712_10584166 Ga0224712_105841662 66
326 3300025315 Ga0207697_10232639 Ga0207697_102326391 66
327 3300025893 Ga0207682_10094553 Ga0207682_100945533 66
328 3300025898 Ga0207692_10181644 Ga0207692_101816442 66
329 3300025898 Ga0207692_11158308 Ga0207692_111583082 66
330 3300025899 Ga0207642_10258962 Ga0207642_102589621 66
331 3300025901 Ga0207688_10190402 Ga0207688_101904022 66
332 3300025901 Ga0207688_10559536 Ga0207688_105595362 66
333 3300025901 Ga0207688_10745755 Ga0207688_107457552 66
334 3300025903 Ga0207680_10942505 Ga0207680_109425052 66
335 3300025905 Ga0207685_10776622 Ga0207685_107766222 66
336 3300025906 Ga0207699_10014062 Ga0207699_100140622 66
337 3300025907 Ga0207645_10479675 Ga0207645_104796752 66
338 3300025908 Ga0207643_10090349 Ga0207643_100903493 66
339 3300025909 Ga0207705_10546213 Ga0207705_105462132 66
340 3300025909 Ga0207705_11076000 Ga0207705_110760001 66
341 3300025911 Ga0207654_10223831 Ga0207654_102238313 66
342 3300025912 Ga0207707_10042746 Ga0207707_100427466 66
343 3300025912 Ga0207707_10599424 Ga0207707_105994242 66
344 3300025913 Ga0207695_10084625 Ga0207695_100846253 66
345 3300025913 Ga0207695_10131709 Ga0207695_101317093 66
346 3300025913 Ga0207695_10350332 Ga0207695_103503322 66
347 3300025917 Ga0207660_10141452 Ga0207660_101414522 66
348 3300025919 Ga0207657_10013143 Ga0207657_1001314312 66
349 3300025919 Ga0207657_10149049 Ga0207657_101490494 66
350 3300025920 Ga0207649_10659408 Ga0207649_106594081 66
351 3300025920 Ga0207649_10910409 Ga0207649_109104092 66
352 3300025921 Ga0207652_10085259 Ga0207652_100852592 66
353 3300025921 Ga0207652_10607803 Ga0207652_106078032 66
354 3300025923 Ga0207681_10215274 Ga0207681_102152743 66
355 3300025924 Ga0207694_10150838 Ga0207694_101508383 66
356 3300025924 Ga0207694_10487438 Ga0207694_104874382 66
357 3300025925 Ga0207650_10193461 Ga0207650_101934611 66
358 3300025925 Ga0207650_10400909 Ga0207650_104009092 66
359 3300025926 Ga0207659_10308581 Ga0207659_103085812 66
360 3300025926 Ga0207659_10350045 Ga0207659_103500453 66
361 3300025926 Ga0207659_10525156 Ga0207659_105251562 66
362 3300025926 Ga0207659_10638716 Ga0207659_106387162 66
363 3300025927 Ga0207687_10329664 Ga0207687_103296643 66
364 3300025927 Ga0207687_10462116 Ga0207687_104621162 66
365 3300025927 Ga0207687_11437491 Ga0207687_114374912 66
366 3300025928 Ga0207700_11330332 Ga0207700_113303322 66
367 3300025931 Ga0207644_11009988 Ga0207644_110099882 66
368 3300025932 Ga0207690_10232957 Ga0207690_102329573 66
369 3300025932 Ga0207690_10727685 Ga0207690_107276853 66
370 3300025933 Ga0207706_10812443 Ga0207706_108124432 66
371 3300025933 Ga0207706_11353126 Ga0207706_113531262 66
372 3300025934 Ga0207686_10013361 Ga0207686_100133611 66
373 3300025934 Ga0207686_10519480 Ga0207686_105194802 66
374 3300025935 Ga0207709_11010645 Ga0207709_110106452 66
375 3300025937 Ga0207669_10392616 Ga0207669_103926163 66
376 3300025937 Ga0207669_10788056 Ga0207669_107880562 66
377 3300025937 Ga0207669_11819998 Ga0207669_118199982 66
378 3300025938 Ga0207704_10005828 Ga0207704_100058283 66
379 3300025938 Ga0207704_11306999 Ga0207704_113069992 66
380 3300025939 Ga0207665_11330151 Ga0207665_113301512 66
381 3300025940 Ga0207691_10197382 Ga0207691_101973822 66
382 3300025940 Ga0207691_10419050 Ga0207691_104190503 66
383 3300025940 Ga0207691_11004862 Ga0207691_110048622 66
384 3300025941 Ga0207711_10026433 Ga0207711_100264338 66
385 3300025941 Ga0207711_10480730 Ga0207711_104807303 66
386 3300025941 Ga0207711_10561479 Ga0207711_105614793 66
387 3300025941 Ga0207711_10746099 Ga0207711_107460992 66
388 3300025941 Ga0207711_11004973 Ga0207711_110049731 66
389 3300025941 Ga0207711_11650168 Ga0207711_116501682 66
390 3300025942 Ga0207689_10034411 Ga0207689_100344112 66
391 3300025942 Ga0207689_10062920 Ga0207689_100629202 66
392 3300025942 Ga0207689_10365682 Ga0207689_103656823 66
393 3300025942 Ga0207689_10618427 Ga0207689_106184272 66
394 3300025942 Ga0207689_10772295 Ga0207689_107722952 66
395 3300025942 Ga0207689_10891739 Ga0207689_108917392 66
396 3300025945 Ga0207679_10392851 Ga0207679_103928512 66
397 3300025945 Ga0207679_10395275 Ga0207679_103952752 66
398 3300025945 Ga0207679_10967676 Ga0207679_109676762 66
399 3300025945 Ga0207679_11684293 Ga0207679_116842931 66
400 3300025949 Ga0207667_10168529 Ga0207667_101685293 66
401 3300025949 Ga0207667_10380613 Ga0207667_103806132 66
402 3300025949 Ga0207667_11051211 Ga0207667_110512112 66
403 3300025949 Ga0207667_11569865 Ga0207667_115698652 66
404 3300025960 Ga0207651_10041000 Ga0207651_100410002 66
405 3300025960 Ga0207651_10110459 Ga0207651_101104594 66
406 3300025960 Ga0207651_12040288 Ga0207651_120402882 66
407 3300025961 Ga0207712_10979130 Ga0207712_109791302 66
408 3300025961 Ga0207712_11432289 Ga0207712_114322892 66
409 3300025981 Ga0207640_10114374 Ga0207640_101143742 66
410 3300025981 Ga0207640_11200014 Ga0207640_112000142 66
411 3300025981 Ga0207640_11814302 Ga0207640_118143022 66
412 3300025986 Ga0207658_10945183 Ga0207658_109451832 66
413 3300026023 Ga0207677_10266317 Ga0207677_102663173 66
414 3300026023 Ga0207677_10762861 Ga0207677_107628612 66
415 3300026035 Ga0207703_10116219 Ga0207703_101162193 66
416 3300026035 Ga0207703_11140074 Ga0207703_111400741 66
417 3300026035 Ga0207703_12206250 Ga0207703_122062501 66
418 3300026041 Ga0207639_11714702 Ga0207639_117147022 66
419 3300026041 Ga0207639_11730632 Ga0207639_117306322 66
420 3300026067 Ga0207678_10226816 Ga0207678_102268162 66
421 3300026067 Ga0207678_10382018 Ga0207678_103820183 66
422 3300026075 Ga0207708_10881091 Ga0207708_108810912 66
423 3300026078 Ga0207702_10262266 Ga0207702_102622663 66
424 3300026078 Ga0207702_12346875 Ga0207702_123468752 66
425 3300026088 Ga0207641_10538452 Ga0207641_105384522 66
426 3300026088 Ga0207641_10752171 Ga0207641_107521712 66
427 3300026088 Ga0207641_11010931 Ga0207641_110109312 66
428 3300026088 Ga0207641_11685763 Ga0207641_116857632 66
429 3300026088 Ga0207641_12543463 Ga0207641_125434632 66
430 3300026089 Ga0207648_11067706 Ga0207648_110677062 66
431 3300026095 Ga0207676_10069079 Ga0207676_100690792 66
432 3300026095 Ga0207676_10259868 Ga0207676_102598683 66
433 3300026095 Ga0207676_10990839 Ga0207676_109908392 66
434 3300026116 Ga0207674_10203527 Ga0207674_102035274 66
435 3300026116 Ga0207674_10741845 Ga0207674_107418452 66
436 3300026116 Ga0207674_12260899 Ga0207674_122608992 66
437 3300026118 Ga0207675_100036086 Ga0207675_1000360865 66
438 3300026118 Ga0207675_100588336 Ga0207675_1005883362 66
439 3300026118 Ga0207675_100703465 Ga0207675_1007034652 66
440 3300026142 Ga0207698_10803886 Ga0207698_108038862 66
441 3300027876 Ga0209974_10068780 Ga0209974_100687803 66
442 3300027907 Ga0207428_10107542 Ga0207428_101075424 66
443 3300028379 Ga0268266_10439711 Ga0268266_104397112 66
444 3300028379 Ga0268266_11584602 Ga0268266_115846022 66
445 3300028379 Ga0268266_11703262 Ga0268266_117032622 66
446 3300028380 Ga0268265_10374275 Ga0268265_103742753 66
447 3300028380 Ga0268265_12213937 Ga0268265_122139372 66
448 3300028380 Ga0268265_12311931 Ga0268265_123119312 66
449 3300028381 Ga0268264_10042810 Ga0268264_100428105 66
450 3300028381 Ga0268264_10630972 Ga0268264_106309723 66
451 3300028381 Ga0268264_10759201 Ga0268264_107592012 66
452 3300028381 Ga0268264_11352914 Ga0268264_113529142 66
453 3300028381 Ga0268264_11502035 Ga0268264_115020352 66
454 3300031238 Ga0265332_10048353 Ga0265332_100483531 66
455 3300031548 Ga0307408_100880662 Ga0307408_1008806622 66
456 3300031711 Ga0265314_10007579 Ga0265314_100075794 66
457 3300031852 Ga0307410_11006253 Ga0307410_110062532 66
458 3300032002 Ga0307416_100160347 Ga0307416_1001603474 66
459 3300032005 Ga0307411_11200009 Ga0307411_112000092 66
460 3300035088 Ga0373940_0119908 Ga0373940_0119908_488_688 66
461 3300035089 Ga0373944_0043759 Ga0373944_0043759_997_1197 66
462 3300035089 Ga0373944_0073733 Ga0373944_0073733_329_535 66
463 3300035090 Ga0373949_0033224 Ga0373949_0033224_229_435 66
464 3300035090 Ga0373949_0124773 Ga0373949_0124773_139_342 66
465 3300035092 Ga0373952_0078480 Ga0373952_0078480_361_564 66
466 3300035112 Ga0373932_0056975 Ga0373932_0056975_96_299 66
467 3300035113 Ga0373936_0066682 Ga0373936_0066682_1118_1321 66
468 3300035113 Ga0373936_0092396 Ga0373936_0092396_1019_1219 66
469 3300035113 Ga0373936_0429403 Ga0373936_0429403_101_301 66
470 3300035115 Ga0373941_0032565 Ga0373941_0032565_398_601 66
471 3300035117 Ga0373953_0044678 Ga0373953_0044678_1061_1261 66
472 3300035117 Ga0373953_0166198 Ga0373953_0166198_525_725 66
473 3300035117 Ga0373953_0357585 Ga0373953_0357585_333_533 66
474 3300035119 Ga0373956_0208787 Ga0373956_0208787_612_812 66
475 3300035119 Ga0373956_0318300 Ga0373956_0318300_457_657 66
476 3300035119 Ga0373956_0434951 Ga0373956_0434951_108_308 66
477 3300035120 Ga0373957_0393842 Ga0373957_0393842_62_262 66
478 3300035121 Ga0373960_0314377 Ga0373960_0314377_237_443 66
479 3300035170 Ga0373943_0227905 Ga0373943_0227905_445_645 66
480 3300035171 Ga0373946_0550365 Ga0373946_0550365_350_556 66
481 3300035172 Ga0373955_0059904 Ga0373955_0059904_920_1120 66
482 3300035242 Ga0373962_0020596 Ga0373962_0020596_37_240 66
483 3300035242 Ga0373962_0119812 Ga0373962_0119812_426_632 66
484 3300035410 Ga0373924_0284127 Ga0373924_0284127_183_383 66
485 3300035692 Ga0373935_0087624 Ga0373935_0087624_968_1168 66
486 3300035692 Ga0373935_0659096 Ga0373935_0659096_315_521 66
487 3300035695 Ga0373927_0785312 Ga0373927_0785312_418_618 66
488 3300035724 Ga0373933_0563395 Ga0373933_0563395_91_291 66
489 3300035725 Ga0373947_0085310 Ga0373947_0085310_1194_1394 66
490 3300036401 Ga0373937_0055553 Ga0373937_0055553_848_1048 66
491 3300036401 Ga0373937_0525359 Ga0373937_0525359_344_544 66
492 3300036401 Ga0373937_1423261 Ga0373937_1423261_267_473 66
493 3300036401 Ga0373937_1612530 Ga0373937_1612530_253_453 66
494 3300036401 Ga0373937_1632611 Ga0373937_1632611_83_283 66
495 3300036401 Ga0373937_1810046 Ga0373937_1810046_123_329 66
496 3300037068 Ga0373925_0160073 Ga0373925_0160073_106_306 66
497 3300037068 Ga0373925_0281546 Ga0373925_0281546_37_237 66
498 3300037068 Ga0373925_0346976 Ga0373925_0346976_332_532 66
499 3300037068 Ga0373925_0855660 Ga0373925_0855660_417_617 66
500 3300037068 Ga0373925_1189255 Ga0373925_1189255_144_344 66
501 3300039453 Ga0436362_0941488 Ga0436362_0941488_556_762 66
502 3300041512 Ga0451853_0176660 Ga0451853_0176660_13_216 66
503 3300042461 Ga0439460_0065210 Ga0439460_0065210_687_890 66
504 3300044673 Ga0453683_0712373 Ga0453683_0712373_186_392 66
505 3300045051 Ga0451576_0277902 Ga0451576_0277902_965_1165 66
506 3300045976 Ga0466967_1719151 Ga0466967_1719151_366_572 66
507 3300046454 Ga0495592_0386335 Ga0495592_0386335_216_416 66
508 3300046455 Ga0495603_0056649 Ga0495603_0056649_1384_1584 66
509 3300046457 Ga0495590_0221155 Ga0495590_0221155_291_491 66
510 3300046459 Ga0495629_0039618 Ga0495629_0039618_406_612 66
511 3300046459 Ga0495629_0108936 Ga0495629_0108936_320_520 66
512 3300046459 Ga0495629_0316991 Ga0495629_0316991_716_916 66
513 3300046459 Ga0495629_0690277 Ga0495629_0690277_84_284 66
514 3300046459 Ga0495629_0968157 Ga0495629_0968157_231_434 66
515 3300046461 Ga0495641_0068787 Ga0495641_0068787_159_359 66
516 3300046463 Ga0495653_0252550 Ga0495653_0252550_90_290 66
517 3300046463 Ga0495653_0492522 Ga0495653_0492522_31_231 66
518 3300046472 Ga0495580_0510654 Ga0495580_0510654_404_604 66
519 3300046472 Ga0495580_0597560 Ga0495580_0597560_68_268 66
520 3300046473 Ga0495582_0422807 Ga0495582_0422807_556_756 66
521 3300046473 Ga0495582_0514545 Ga0495582_0514545_166_366 66
522 3300046475 Ga0495639_0407678 Ga0495639_0407678_466_666 66
523 3300046475 Ga0495639_0513715 Ga0495639_0513715_146_346 66
524 3300046476 Ga0495662_0460798 Ga0495662_0460798_338_538 66
525 3300046477 Ga0495664_0138486 Ga0495664_0138486_926_1126 66
526 3300046499 Ga0495594_0551693 Ga0495594_0551693_191_391 66
527 3300046499 Ga0495594_0754485 Ga0495594_0754485_217_417 66
528 3300046500 Ga0495596_0301736 Ga0495596_0301736_335_541 66
529 3300046512 Ga0495610_0116527 Ga0495610_0116527_46_246 66
530 3300046516 Ga0495628_0162934 Ga0495628_0162934_982_1182 66
531 3300046517 Ga0495630_0318966 Ga0495630_0318966_304_504 66
532 3300046517 Ga0495630_0478384 Ga0495630_0478384_248_448 66
533 3300046517 Ga0495630_0659959 Ga0495630_0659959_159_359 66
534 3300046525 Ga0495663_0270249 Ga0495663_0270249_282_485 66
535 3300046526 Ga0495666_0192761 Ga0495666_0192761_582_782 66
536 3300046528 Ga0495642_0266488 Ga0495642_0266488_183_383 66
537 3300046533 Ga0495640_0030475 Ga0495640_0030475_12_212 66
538 3300046535 Ga0495586_0077462 Ga0495586_0077462_1291_1491 66
539 3300046535 Ga0495586_0632529 Ga0495586_0632529_376_576 66
540 3300046539 Ga0495621_0069184 Ga0495621_0069184_386_589 66
541 3300046539 Ga0495621_0209773 Ga0495621_0209773_286_486 66
542 3300046539 Ga0495621_0387659 Ga0495621_0387659_267_473 66
543 3300046543 Ga0495645_0004427 Ga0495645_0004427_4029_4229 66
544 3300046559 Ga0495667_0170548 Ga0495667_0170548_737_937 66
545 3300046559 Ga0495667_0352457 Ga0495667_0352457_716_916 66
546 3300046559 Ga0495667_0946690 Ga0495667_0946690_149_349 66
547 3300046642 Ga0495634_0323067 Ga0495634_0323067_504_704 66
548 3300046642 Ga0495634_0680230 Ga0495634_0680230_327_527 66
549 3300046648 Ga0495611_0179280 Ga0495611_0179280_721_921 66
550 3300046663 Ga0495635_0088954 Ga0495635_0088954_166_366 66
551 3300046663 Ga0495635_0452811 Ga0495635_0452811_219_419 66
552 3300046663 Ga0495635_0967834 Ga0495635_0967834_22_222 66
553 3300046664 Ga0495659_0233321 Ga0495659_0233321_171_374 66
554 3300046681 Ga0495647_0173683 Ga0495647_0173683_278_478 66
555 3300046681 Ga0495647_0182375 Ga0495647_0182375_241_441 66
556 3300046681 Ga0495647_0187512 Ga0495647_0187512_26_226 66
557 3300046683 Ga0495658_0063955 Ga0495658_0063955_1307_1507 66
558 3300046683 Ga0495658_0143499 Ga0495658_0143499_1249_1449 66
559 3300046683 Ga0495658_0276569 Ga0495658_0276569_26_226 66
560 3300046683 Ga0495658_0514264 Ga0495658_0514264_350_550 66
561 3300046684 Ga0495669_0043985 Ga0495669_0043985_1019_1222 66
562 3300046689 Ga0495613_0202812 Ga0495613_0202812_112_312 66
563 3300046689 Ga0495613_0468282 Ga0495613_0468282_521_721 66
564 3300046689 Ga0495613_0709851 Ga0495613_0709851_100_300 66
565 3300046689 Ga0495613_0749542 Ga0495613_0749542_15_215 66
566 3300046690 Ga0495624_0143899 Ga0495624_0143899_1242_1448 66
567 3300046794 Ga0495589_0369051 Ga0495589_0369051_123_326 66
568 3300046809 Ga0495600_0334896 Ga0495600_0334896_35_235 66
569 3300047315 Ga0495581_0230317 Ga0495581_0230317_654_860 66
570 3300047315 Ga0495581_0320979 Ga0495581_0320979_306_506 66
571 3300047319 Ga0495674_0111892 Ga0495674_0111892_84_284 66
572 3300047319 Ga0495674_0130151 Ga0495674_0130151_971_1171 66
573 3300047320 Ga0495672_0157192 Ga0495672_0157192_633_833 66
574 3300047321 Ga0495676_0801951 Ga0495676_0801951_217_417 66
575 3300047322 Ga0495680_0504547 Ga0495680_0504547_611_811 66
576 3300047444 Ga0495675_0369920 Ga0495675_0369920_625_825 66
577 3300047445 Ga0495677_0067254 Ga0495677_0067254_893_1096 66
578 3300047471 Ga0495684_0073724 Ga0495684_0073724_547_747 66
579 3300047673 Ga0495593_0553400 Ga0495593_0553400_76_282 66
580 3300048088 Ga0495602_0306123 Ga0495602_0306123_725_925 66
581 3300048903 Ga0496100_0682033 Ga0496100_0682033_400_606 66
582 3300048904 Ga0496101_0966544 Ga0496101_0966544_216_422 66
583 3300048905 Ga0496102_0198095 Ga0496102_0198095_1253_1456 66
584 3300048907 Ga0496104_0017385 Ga0496104_0017385_4817_5017 66
585 3300048908 Ga0496105_1392591 Ga0496105_1392591_223_423 66
586 3300048909 Ga0496106_0299493 Ga0496106_0299493_756_959 66
587 3300048911 Ga0496108_0011060 Ga0496108_0011060_2001_2201 66
588 3300048912 Ga0496109_0151382 Ga0496109_0151382_443_646 66
589 3300048912 Ga0496109_0191312 Ga0496109_0191312_976_1176 66
590 3300048912 Ga0496109_0204246 Ga0496109_0204246_353_559 66
591 3300048913 Ga0496110_0157481 Ga0496110_0157481_1177_1383 66
592 3300048913 Ga0496110_0399484 Ga0496110_0399484_313_516 66
593 3300048915 Ga0496112_0016237 Ga0496112_0016237_6092_6292 66
594 3300048915 Ga0496112_0205425 Ga0496112_0205425_1192_1398 66
595 3300048915 Ga0496112_0509564 Ga0496112_0509564_525_728 66
596 3300048916 Ga0496113_0032056 Ga0496113_0032056_721_921 66
597 3300048916 Ga0496113_1293943 Ga0496113_1293943_210_413 66
598 3300048917 Ga0496114_0013645 Ga0496114_0013645_1507_1707 66
599 3300049460 Ga0495682_0101315 Ga0495682_0101315_638_838 66
600 3300049571 Ga0501034_0077055 Ga0501034_0077055_2459_2665 66
601 3300049571 Ga0501034_0108508 Ga0501034_0108508_1285_1488 66
602 3300049571 Ga0501034_1039997 Ga0501034_1039997_447_653 66
603 3300049572 Ga0501036_0638071 Ga0501036_0638071_298_501 66
604 3300049572 Ga0501036_1046904 Ga0501036_1046904_305_511 66
605 3300049573 Ga0501037_0399894 Ga0501037_0399894_675_881 66
606 3300049579 Ga0501043_0067123 Ga0501043_0067123_1237_1443 66
607 3300049581 Ga0501047_0015370 Ga0501047_0015370_6425_6631 66
608 3300049581 Ga0501047_0399559 Ga0501047_0399559_56_259 66
609 3300049584 Ga0501068_0172060 Ga0501068_0172060_474_677 66
610 3300049585 Ga0501069_0373707 Ga0501069_0373707_541_744 66
611 3300049742 Ga0501080_0935207 Ga0501080_0935207_258_464 66
612 3300049744 Ga0501083_0137210 Ga0501083_0137210_663_866 66
613 3300049744 Ga0501083_0501650 Ga0501083_0501650_450_653 66
614 3300049765 Ga0501268_131814 Ga0501268_131814_146_352 66
615 3300049822 Ga0501035_1457144 Ga0501035_1457144_202_408 66
616 3300049823 Ga0501044_0003452 Ga0501044_0003452_1156_1362 66
617 3300049823 Ga0501044_0832038 Ga0501044_0832038_100_306 66
618 3300050494 nmdc:mga06z11_310287_c1 nmdc:mga06z11_310287_c1_144_344 66
619 3300050507 nmdc:mga05p37_119480_c1 nmdc:mga05p37_119480_c1_1313_1513 66
620 3300050507 nmdc:mga05p37_1513211_c1 nmdc:mga05p37_1513211_c1_245_445 66
621 3300050507 nmdc:mga05p37_1745505_c1 nmdc:mga05p37_1745505_c1_103_306 66
622 3300050507 nmdc:mga05p37_47027_c1 nmdc:mga05p37_47027_c1_390_593 66
623 3300050508 nmdc:mga09592_112102_c1 nmdc:mga09592_112102_c1_1360_1563 66
624 3300050511 nmdc:mga08y16_1578794_c1 nmdc:mga08y16_1578794_c1_283_483 66
625 3300050511 nmdc:mga08y16_95418_c1 nmdc:mga08y16_95418_c1_2195_2401 66
626 3300050512 nmdc:mga0n895_1012336_c1 nmdc:mga0n895_1012336_c1_332_535 66
627 3300050512 nmdc:mga0n895_1652621_c1 nmdc:mga0n895_1652621_c1_123_323 66
628 3300050512 nmdc:mga0n895_1721021_c1 nmdc:mga0n895_1721021_c1_276_482 66
629 3300050512 nmdc:mga0n895_2113049_c1 nmdc:mga0n895_2113049_c1_96_299 66
630 3300050512 nmdc:mga0n895_675524_c1 nmdc:mga0n895_675524_c1_62_274 66
631 3300050513 nmdc:mga0rr50_1096711_c1 nmdc:mga0rr50_1096711_c1_196_399 66
632 3300050513 nmdc:mga0rr50_1228000_c1 nmdc:mga0rr50_1228000_c1_382_582 66
633 3300050514 nmdc:mga08x19_811162_c1 nmdc:mga08x19_811162_c1_395_601 66
634 3300050515 nmdc:mga0a205_798332_c1 nmdc:mga0a205_798332_c1_533_736 66
635 3300050515 nmdc:mga0a205_98384_c1 nmdc:mga0a205_98384_c1_2150_2353 66
636 3300053077 Ga0495601_0179517 Ga0495601_0179517_612_812 66
637 3300053084 Ga0495595_0247835 Ga0495595_0247835_643_843 66
638 3300053084 Ga0495595_0315265 Ga0495595_0315265_278_484 66
639 3300053085 Ga0495619_0044291 Ga0495619_0044291_2628_2828 66
640 3300053085 Ga0495619_0247047 Ga0495619_0247047_644_844 66
641 3300053085 Ga0495619_0463495 Ga0495619_0463495_520_720 66
642 3300053134 Ga0500658_0026256 Ga0500658_0026256_508_711 66
643 3300053134 Ga0500658_0304386 Ga0500658_0304386_131_331 66
644 3300059506 Ga0587085_107945 Ga0587085_107945_245_451 66
645 3300060353 Ga0501082_0257595 Ga0501082_0257595_1144_1347 66

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

25

75

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mrf-assembly1.cif.gz_U structure of the yeast mitochondrial ribosome - class c 0.9319 11 66
6fxc-assembly1.cif.gz_AX the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus 0.9317 11 66
5hl7-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin 0.9273 11 66
7nhn-assembly1.cif.gz_3 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9263 13 66
4wf9-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with telithromycin 0.9183 10 66
ID Description Score Start End Superfamily
1vw4U00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9286 11 66 3.30.1390.20
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9273 11 66 3.30.1390.20
4wfbW00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9257 11 66 3.30.1390.20
af_B6SIL2_19_102_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9253 11 66 3.30.1390.20
af_C0H5I4_95_195_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9241 14 64 3.30.1390.20
ID Description Score Start End GO Terms
AF-A0A3D0FPQ4-F1-model_v4 Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL15; Large ribosomal subunit protein uL30] 0.9907 12 66 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-C7LKI6-F1-model_v4 Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS5; Large ribosomal subunit protein uL30] 0.9708 12 66 GO:0003735
GO:0006412
GO:0015934
GO:0015935
GO:0019843
AF-A0A6L7YVA9-F1-model_v4 50S ribosomal protein L30 0.9383 11 66 GO:0003735
GO:0006412
GO:0022625
AF-A0A2M8DUU5-F1-model_v4 Large ribosomal subunit protein uL30 0.9358 12 66 GO:0003735
GO:0006412
GO:0022625
AF-A0A6M4GZS5-F1-model_v4 Large ribosomal subunit protein uL30 0.9357 12 66 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
87.03 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map