F472102

General Info

Members Datasets Scaffolds Average Seq Length
645 314 1290 324

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100003395|Ga0070680_1000033953
Length 393
Sequence MQQVLTRVTPDVRPTITDAMIAFYRQPLTHLIPSLMLATQQPVILTSARLAYRGLLLQYNDDSVFQGAAMRAVLCKEWGGPEKLVVGDVPSPPLREGAVRIRVHAAGVNFADLLLIAGQYQEKPAFPFIPGAEAAGEVIEAGAGVTGFKPGDRVMALAGLGAFAEEAVVDAPRLLRIPDSMDFAAAAGFPVAYGTSHGALEWRARLQPGEWLLVTGAAGGVGLTAVEIGKAMGARVIACAGSAEKLAVAQQHGADHLIDYSREDLRERVKEMTGGRGADVIYDPVGGDVFDACLRSIAWGGRIIIIGFAAGRISQIPGNIVLVKNIDVIGFYWGSYQKHKPELLSSSFGQLFRWFEEGKLRPHVSHRLPLAQAVEALKLVQERKSTGKVVMEM

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
220 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
308 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
309 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
313 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
314 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.31
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.34
Nodule 0
Rhizoplane 5.12
Rhizosphere 88.53
Stem 0
Stem Tuber 0
Unclassified 4.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100003395 3300005336 Bacteria 11887
2 Ga0065715_10101630 3300005293 Bacteria 3184
3 Ga0070658_10005362 3300005327 Bacteria 10414
4 Ga0070690_100001060 3300005330 Bacteria 14113
5 Ga0070690_100055759 3300005330 Bacteria 2532
6 Ga0070670_100000038 3300005331 Bacteria 153333
7 Ga0068869_100025251 3300005334 Bacteria 4124
8 Ga0070666_10000210 3300005335 Bacteria 40037
9 Ga0070680_100002348 3300005336 Bacteria 13971
10 Ga0070680_100056977 3300005336 Bacteria 3194
11 Ga0070680_100162564 3300005336 Unclassified 1876
12 Ga0070682_100001240 3300005337 Bacteria 14513
13 Ga0068868_100216092 3300005338 Bacteria 1604
14 Ga0068868_100237975 3300005338 Unclassified 1529
15 Ga0068868_100253513 3300005338 Bacteria 1482
16 Ga0070660_100108852 3300005339 Bacteria 2203
17 Ga0070689_100114670 3300005340 Bacteria 2147
18 Ga0070691_10003177 3300005341 Bacteria 7360
19 Ga0070691_10081834 3300005341 Bacteria 1582
20 Ga0070687_100000784 3300005343 Bacteria 10558
21 Ga0070668_100000038 3300005347 Bacteria 79714
22 Ga0070668_100191764 3300005347 Bacteria 1674
23 Ga0070668_100335851 3300005347 Bacteria 1276
24 Ga0070669_100000037 3300005353 Bacteria 136220
25 Ga0070669_100123089 3300005353 Bacteria 1981
26 Ga0070675_100125223 3300005354 Bacteria 2186
27 Ga0070675_100487986 3300005354 Bacteria 1109
28 Ga0070674_100315458 3300005356 Bacteria 1251
29 Ga0070674_100333849 3300005356 Bacteria 1219
30 Ga0070673_100061560 3300005364 Bacteria 2978
31 Ga0070673_100223661 3300005364 Bacteria 1630
32 Ga0070659_100062621 3300005366 Bacteria 2941
33 Ga0070667_100000106 3300005367 Bacteria 106516
34 Ga0070709_10000723 3300005434 Bacteria 18673
35 Ga0070709_10229489 3300005434 Bacteria 1328
36 Ga0070714_100020273 3300005435 Bacteria 5426
37 Ga0070714_100317541 3300005435 Bacteria 1456
38 Ga0070713_100000017 3300005436 Bacteria 120503
39 Ga0070713_100274794 3300005436 Bacteria 1544
40 Ga0070710_10033203 3300005437 Bacteria 2801
41 Ga0070701_10175822 3300005438 Bacteria 1250
42 Ga0070711_100113211 3300005439 Bacteria 1995
43 Ga0070711_100210536 3300005439 Bacteria 1505
44 Ga0070711_100341492 3300005439 Unclassified 1201
45 Ga0070705_100005956 3300005440 Bacteria 5962
46 Ga0070705_100021330 3300005440 Bacteria 3444
47 Ga0070705_100216406 3300005440 Bacteria 1324
48 Ga0070700_100064037 3300005441 Bacteria 2327
49 Ga0070694_100001660 3300005444 Bacteria 13091
50 Ga0070694_100006131 3300005444 Bacteria 7294
51 Ga0070694_100202182 3300005444 Bacteria 1481
52 Ga0070708_100000635 3300005445 Bacteria 26516
53 Ga0070708_100074136 3300005445 Bacteria 3069
54 Ga0070663_100227518 3300005455 Bacteria 1467
55 Ga0070678_100148489 3300005456 Unclassified 1885
56 Ga0070681_10000014 3300005458 Bacteria 132528
57 Ga0070681_10003411 3300005458 Bacteria 14880
58 Ga0070681_10249446 3300005458 Bacteria 1688
59 Ga0070681_10327744 3300005458 Bacteria 1441
60 Ga0068867_100016612 3300005459 Bacteria 5226
61 Ga0070706_100004301 3300005467 Bacteria 13795
62 Ga0070706_100046046 3300005467 Bacteria 4027
63 Ga0070706_100052829 3300005467 Bacteria 3750
64 Ga0070706_100076147 3300005467 Bacteria 3105
65 Ga0070707_100000387 3300005468 Bacteria 43320
66 Ga0070707_100012569 3300005468 Bacteria 7907
67 Ga0070707_100083972 3300005468 Bacteria 3077
68 Ga0070707_100120066 3300005468 Bacteria 2552
69 Ga0070698_100154868 3300005471 Bacteria 2237
70 Ga0070698_100407772 3300005471 Bacteria 1293
71 Ga0070699_100001243 3300005518 Bacteria 23487
72 Ga0070699_100005487 3300005518 Bacteria 11118
73 Ga0070699_100064778 3300005518 Bacteria 3170
74 Ga0070699_100130219 3300005518 Bacteria 2218
75 Ga0070699_100289292 3300005518 Bacteria 1469
76 Ga0070679_100000496 3300005530 Bacteria 33512
77 Ga0070679_100001405 3300005530 Bacteria 21255
78 Ga0070679_100005116 3300005530 Bacteria 12118
79 Ga0070679_100106828 3300005530 Bacteria 2785
80 Ga0070679_100285145 3300005530 Bacteria 1603
81 Ga0070697_100000949 3300005536 Bacteria 21843
82 Ga0070697_100008129 3300005536 Bacteria 8186
83 Ga0070697_100016148 3300005536 Bacteria 5871
84 Ga0070697_100117598 3300005536 Bacteria 2220
85 Ga0068853_100003305 3300005539 Bacteria 12335
86 Ga0068853_100005537 3300005539 Bacteria 9905
87 Ga0068853_100277208 3300005539 Unclassified 1545
88 Ga0070672_100166208 3300005543 Bacteria 1833
89 Ga0070672_100206959 3300005543 Bacteria 1642
90 Ga0070686_100072033 3300005544 Bacteria 2264
91 Ga0070695_100216490 3300005545 Unclassified 1378
92 Ga0070696_100008140 3300005546 Bacteria 7014
93 Ga0070693_100005975 3300005547 Bacteria 5884
94 Ga0070665_100002235 3300005548 Bacteria 21578
95 Ga0070665_100014039 3300005548 Bacteria 8052
96 Ga0070665_100015345 3300005548 Bacteria 7693
97 Ga0070665_100035555 3300005548 Bacteria 5010
98 Ga0070665_100044611 3300005548 Bacteria 4452
99 Ga0070704_100014466 3300005549 Bacteria 4931
100 Ga0070704_100090619 3300005549 Bacteria 2278
101 Ga0070704_100395600 3300005549 Bacteria 1178
102 Ga0068855_100000752 3300005563 Bacteria 39805
103 Ga0068855_100035251 3300005563 Bacteria 5960
104 Ga0068855_100210513 3300005563 Bacteria 2185
105 Ga0068855_100288659 3300005563 Bacteria 1819
106 Ga0068857_100000172 3300005577 Bacteria 40867
107 Ga0068857_100057146 3300005577 Bacteria 3463
108 Ga0068854_100035402 3300005578 Bacteria 3494
109 Ga0068854_100196627 3300005578 Unclassified 1583
110 Ga0068854_100270109 3300005578 Bacteria 1365
111 Ga0068856_100002580 3300005614 Bacteria 18659
112 Ga0068856_100013564 3300005614 Bacteria 7889
113 Ga0068856_100117163 3300005614 Bacteria 2664
114 Ga0068859_100017838 3300005617 Bacteria 7136
115 Ga0068864_100000065 3300005618 Bacteria 118170
116 Ga0068864_100099345 3300005618 Bacteria 2578
117 Ga0068866_10013092 3300005718 Bacteria 3630
118 Ga0068861_100345806 3300005719 Bacteria 1303
119 Ga0068861_100446720 3300005719 Bacteria 1158
120 Ga0068870_10072410 3300005840 Bacteria 1883
121 Ga0068863_100019017 3300005841 Bacteria 6574
122 Ga0068863_100175683 3300005841 Bacteria 2055
123 Ga0068863_100396364 3300005841 Bacteria 1349
124 Ga0068858_100099677 3300005842 Bacteria 2709
125 Ga0068860_100000191 3300005843 Bacteria 97369
126 Ga0068860_100054428 3300005843 Bacteria 3804
127 Ga0068860_100059953 3300005843 Bacteria 3617
128 Ga0068860_100062177 3300005843 Bacteria 3548
129 Ga0068860_100139132 3300005843 Unclassified 2332
130 Ga0068860_100305522 3300005843 Bacteria 1559
131 Ga0068862_100000937 3300005844 Bacteria 28107
132 Ga0068862_100058409 3300005844 Bacteria 3309
133 Ga0068862_100063270 3300005844 Bacteria 3184
134 Ga0081455_10001681 3300005937 Bacteria 26830
135 Ga0081455_10009127 3300005937 Bacteria 10230
136 Ga0081538_10033150 3300005981 Bacteria 3444
137 Ga0081538_10052506 3300005981 Bacteria 2435
138 Ga0081540_1081264 3300005983 Unclassified 1458
139 Ga0081539_10004342 3300005985 Bacteria 15809
140 Ga0070717_10067153 3300006028 Bacteria 2983
141 Ga0070717_10249446 3300006028 Bacteria 1568
142 Ga0070717_10416296 3300006028 Bacteria 1208
143 Ga0075365_10209616 3300006038 Bacteria 1366
144 Ga0075363_100135504 3300006048 Bacteria 1383
145 Ga0070716_100110828 3300006173 Bacteria 1700
146 Ga0070712_100002031 3300006175 Bacteria 12401
147 Ga0070712_100181250 3300006175 Bacteria 1641
148 Ga0075362_10005570 3300006177 Bacteria 4622
149 Ga0075362_10006343 3300006177 Bacteria 4405
150 Ga0075362_10044318 3300006177 Bacteria 1972
151 Ga0075362_10083473 3300006177 Bacteria 1475
152 Ga0075367_10059635 3300006178 Bacteria 2273
153 Ga0075369_10000101 3300006186 Bacteria 23049
154 Ga0075366_10000880 3300006195 Bacteria 14505
155 Ga0075366_10060297 3300006195 Bacteria 2254
156 Ga0075370_10077325 3300006353 Bacteria 1910
157 Ga0075370_10086779 3300006353 Bacteria 1803
158 Ga0068871_100021796 3300006358 Bacteria 4931
159 Ga0075428_100123077 3300006844 Unclassified 2823
160 Ga0075430_100182230 3300006846 Unclassified 1747
161 Ga0075430_100184364 3300006846 Bacteria 1735
162 Ga0075431_100009092 3300006847 Bacteria 9962
163 Ga0075431_100107725 3300006847 Unclassified 2875
164 Ga0075431_100264436 3300006847 Bacteria 1745
165 Ga0075431_100632825 3300006847 Bacteria 1051
166 Ga0075433_10182608 3300006852 Bacteria 1867
167 Ga0075433_10417876 3300006852 Unclassified 1183
168 Ga0075434_100016993 3300006871 Bacteria 7000
169 Ga0075434_100026958 3300006871 Bacteria 5638
170 Ga0075434_100057403 3300006871 Bacteria 3868
171 Ga0075434_100375053 3300006871 Bacteria 1444
172 Ga0075429_100005130 3300006880 Bacteria 11264
173 Ga0075429_100077108 3300006880 Bacteria 2903
174 Ga0075429_100197028 3300006880 Bacteria 1764
175 Ga0075429_100279496 3300006880 Bacteria 1462
176 Ga0075429_100292083 3300006880 Bacteria 1427
177 Ga0075436_100000298 3300006914 Bacteria 31645
178 Ga0075436_100002439 3300006914 Bacteria 12812
179 Ga0075436_100055822 3300006914 Unclassified 2728
180 Ga0075436_100087543 3300006914 Bacteria 2163
181 Ga0097620_100017837 3300006931 Bacteria 7136
182 Ga0075435_100009236 3300007076 Bacteria 7123
183 Ga0075435_100017319 3300007076 Bacteria 5452
184 Ga0075435_100319733 3300007076 Bacteria 1328
185 Ga0075435_100409962 3300007076 Bacteria 1166
186 Ga0099794_10045519 3300007265 Bacteria 2100
187 Ga0105240_10093516 3300009093 Bacteria 3669
188 Ga0105240_10389043 3300009093 Bacteria 1573
189 Ga0111539_10073592 3300009094 Bacteria 4028
190 Ga0105247_10014721 3300009101 Bacteria 4688
191 Ga0105247_10156157 3300009101 Bacteria 1507
192 Ga0114129_10069547 3300009147 Bacteria 4907
193 Ga0114129_10171223 3300009147 Unclassified 2960
194 Ga0114129_10323904 3300009147 Bacteria 2048
195 Ga0114129_10333125 3300009147 Bacteria 2015
196 Ga0114129_10368994 3300009147 Bacteria 1898
197 Ga0114129_10677394 3300009147 Bacteria 1328
198 Ga0114129_10884837 3300009147 Bacteria 1133
199 Ga0105243_10001313 3300009148 Bacteria 22196
200 Ga0105243_10050046 3300009148 Bacteria 3299
201 Ga0105243_10073897 3300009148 Bacteria 2764
202 Ga0105243_10112443 3300009148 Bacteria 2281
203 Ga0105243_10630448 3300009148 Bacteria 1036
204 Ga0105241_10034927 3300009174 Bacteria 3781
205 Ga0105241_10103013 3300009174 Bacteria 2272
206 Ga0105241_10113657 3300009174 Bacteria 2171
207 Ga0105242_10000997 3300009176 Bacteria 22197
208 Ga0105242_10087273 3300009176 Bacteria 2619
209 Ga0105248_10023170 3300009177 Bacteria 6895
210 Ga0105248_10026936 3300009177 Bacteria 6392
211 Ga0105248_10034077 3300009177 Bacteria 5691
212 Ga0105248_10140424 3300009177 Bacteria 2725
213 Ga0105248_10634678 3300009177 Bacteria 1205
214 Ga0105237_10079293 3300009545 Bacteria 3274
215 Ga0105238_10001268 3300009551 Bacteria 25404
216 Ga0105249_10000713 3300009553 Bacteria 30197
217 Ga0105249_10007835 3300009553 Bacteria 9300
218 Ga0105249_10021811 3300009553 Bacteria 5735
219 Ga0105249_10029600 3300009553 Bacteria 4947
220 Ga0105249_10217062 3300009553 Bacteria 1880
221 Ga0105249_10244130 3300009553 Bacteria 1777
222 Ga0105249_10389531 3300009553 Bacteria 1421
223 Ga0105239_10208928 3300010375 Bacteria 2188
224 Ga0105246_10075310 3300011119 Bacteria 2389
225 Ga0157373_10037182 3300013100 Bacteria 3491
226 Ga0157370_10005235 3300013104 Bacteria 14591
227 Ga0157370_10330061 3300013104 Unclassified 1407
228 Ga0157369_10067378 3300013105 Bacteria 3849
229 Ga0157369_10091691 3300013105 Bacteria 3243
230 Ga0157374_10106322 3300013296 Bacteria 2696
231 Ga0157378_10167836 3300013297 Bacteria 2057
232 Ga0157378_10235573 3300013297 Bacteria 1746
233 Ga0163162_10365993 3300013306 Bacteria 1575
234 Ga0157372_10001645 3300013307 Bacteria 24280
235 Ga0157375_10078934 3300013308 Bacteria 3326
236 Ga0157375_10161289 3300013308 Bacteria 2384
237 Ga0157375_10305983 3300013308 Bacteria 1753
238 Ga0157375_10521310 3300013308 Bacteria 1352
239 Ga0163163_10012424 3300014325 Bacteria 7758
240 Ga0163163_10015321 3300014325 Bacteria 7086
241 Ga0157380_10145742 3300014326 Bacteria 2040
242 Ga0157379_10010717 3300014968 Bacteria 7987
243 Ga0157379_10013271 3300014968 Bacteria 7215
244 Ga0157379_10025453 3300014968 Bacteria 5256
245 Ga0157379_10034275 3300014968 Bacteria 4525
246 Ga0157379_10063817 3300014968 Bacteria 3292
247 Ga0157379_10325270 3300014968 Bacteria 1404
248 Ga0157379_10339687 3300014968 Bacteria 1373
249 Ga0157376_10024774 3300014969 Bacteria 4717
250 Ga0206354_11615725 3300020081 Bacteria 3281
251 Ga0206353_10127440 3300020082 Bacteria 5474
252 Ga0213876_10123276 3300021384 Bacteria 1377
253 Ga0207426_1021340 3300025302 Bacteria 2239
254 Ga0207426_1025343 3300025302 Bacteria 1998
255 Ga0207692_10142974 3300025898 Bacteria 1362
256 Ga0207642_10109589 3300025899 Bacteria 1403
257 Ga0207710_10008655 3300025900 Bacteria 4291
258 Ga0207680_10001475 3300025903 Bacteria 11138
259 Ga0207699_10000117 3300025906 Bacteria 56016
260 Ga0207699_10068719 3300025906 Bacteria 2158
261 Ga0207699_10121957 3300025906 Bacteria 1687
262 Ga0207645_10152494 3300025907 Bacteria 1509
263 Ga0207705_10002117 3300025909 Bacteria 15420
264 Ga0207684_10033753 3300025910 Bacteria 4352
265 Ga0207684_10106321 3300025910 Bacteria 2400
266 Ga0207684_10175254 3300025910 Bacteria 1849
267 Ga0207684_10177551 3300025910 Bacteria 1836
268 Ga0207654_10169904 3300025911 Bacteria 1415
269 Ga0207654_10197325 3300025911 Bacteria 1323
270 Ga0207654_10217302 3300025911 Bacteria 1266
271 Ga0207707_10000001 3300025912 Bacteria 1212482
272 Ga0207707_10000899 3300025912 Bacteria 29030
273 Ga0207707_10002876 3300025912 Bacteria 15374
274 Ga0207707_10011252 3300025912 Bacteria 7788
275 Ga0207707_10273189 3300025912 Bacteria 1465
276 Ga0207707_10277525 3300025912 Bacteria 1452
277 Ga0207695_10150923 3300025913 Bacteria 2263
278 Ga0207695_10256388 3300025913 Bacteria 1648
279 Ga0207671_10036040 3300025914 Bacteria 3669
280 Ga0207671_10100873 3300025914 Bacteria 2186
281 Ga0207693_10000129 3300025915 Bacteria 67940
282 Ga0207693_10000331 3300025915 Bacteria 43711
283 Ga0207663_10018830 3300025916 Bacteria 3878
284 Ga0207660_10000228 3300025917 Bacteria 36209
285 Ga0207660_10001870 3300025917 Bacteria 14028
286 Ga0207660_10044659 3300025917 Bacteria 3118
287 Ga0207660_10091691 3300025917 Bacteria 2254
288 Ga0207662_10004619 3300025918 Bacteria 7262
289 Ga0207662_10010817 3300025918 Bacteria 5042
290 Ga0207652_10000094 3300025921 Bacteria 98207
291 Ga0207652_10001011 3300025921 Bacteria 25919
292 Ga0207652_10006913 3300025921 Bacteria 9138
293 Ga0207652_10122415 3300025921 Unclassified 2315
294 Ga0207652_10196209 3300025921 Bacteria 1816
295 Ga0207646_10000140 3300025922 Bacteria 98858
296 Ga0207646_10078319 3300025922 Bacteria 2955
297 Ga0207646_10092062 3300025922 Bacteria 2714
298 Ga0207646_10097167 3300025922 Bacteria 2639
299 Ga0207646_10141533 3300025922 Bacteria 2167
300 Ga0207646_10429630 3300025922 Bacteria 1192
301 Ga0207681_10000015 3300025923 Bacteria 352892
302 Ga0207681_10154147 3300025923 Bacteria 1725
303 Ga0207694_10026794 3300025924 Bacteria 4388
304 Ga0207650_10000032 3300025925 Bacteria 229538
305 Ga0207700_10000034 3300025928 Bacteria 120519
306 Ga0207700_10008470 3300025928 Bacteria 6375
307 Ga0207700_10067940 3300025928 Bacteria 2730
308 Ga0207664_10013472 3300025929 Bacteria 5870
309 Ga0207664_10256346 3300025929 Bacteria 1528
310 Ga0207644_10040778 3300025931 Bacteria 3282
311 Ga0207644_10398868 3300025931 Bacteria 1124
312 Ga0207690_10090185 3300025932 Bacteria 2163
313 Ga0207690_10231667 3300025932 Bacteria 1418
314 Ga0207686_10000208 3300025934 Bacteria 44632
315 Ga0207709_10000029 3300025935 Bacteria 333327
316 Ga0207709_10203361 3300025935 Bacteria 1416
317 Ga0207670_10083868 3300025936 Bacteria 2236
318 Ga0207669_10235713 3300025937 Bacteria 1353
319 Ga0207665_10060643 3300025939 Bacteria 2562
320 Ga0207665_10062885 3300025939 Bacteria 2519
321 Ga0207691_10095277 3300025940 Bacteria 2662
322 Ga0207711_10017820 3300025941 Bacteria 5900
323 Ga0207711_10041220 3300025941 Bacteria 3931
324 Ga0207711_10461310 3300025941 Bacteria 1183
325 Ga0207689_10005287 3300025942 Bacteria 11567
326 Ga0207667_10000116 3300025949 Bacteria 128218
327 Ga0207667_10015722 3300025949 Bacteria 8582
328 Ga0207667_10437311 3300025949 Bacteria 1330
329 Ga0207651_10073743 3300025960 Bacteria 2428
330 Ga0207651_10127657 3300025960 Bacteria 1941
331 Ga0207651_10167391 3300025960 Bacteria 1730
332 Ga0207712_10000804 3300025961 Bacteria 23112
333 Ga0207712_10011410 3300025961 Bacteria 5661
334 Ga0207712_10034890 3300025961 Bacteria 3412
335 Ga0207712_10136508 3300025961 Bacteria 1876
336 Ga0207668_10000369 3300025972 Bacteria 28641
337 Ga0207640_10031532 3300025981 Bacteria 3276
338 Ga0207640_10033861 3300025981 Bacteria 3183
339 Ga0207640_10049108 3300025981 Unclassified 2730
340 Ga0207658_10000339 3300025986 Bacteria 46897
341 Ga0207677_10191398 3300026023 Bacteria 1618
342 Ga0207703_10538609 3300026035 Bacteria 1100
343 Ga0207639_10013585 3300026041 Bacteria 5705
344 Ga0207639_10060493 3300026041 Bacteria 2922
345 Ga0207708_10063497 3300026075 Bacteria 2821
346 Ga0207702_10002207 3300026078 Bacteria 18662
347 Ga0207702_10017121 3300026078 Bacteria 5995
348 Ga0207641_10001336 3300026088 Bacteria 24406
349 Ga0207648_10030793 3300026089 Bacteria 4749
350 Ga0207648_10068221 3300026089 Bacteria 3099
351 Ga0207648_10292162 3300026089 Bacteria 1460
352 Ga0207676_10001012 3300026095 Bacteria 21574
353 Ga0207676_10408737 3300026095 Bacteria 1270
354 Ga0207674_10000365 3300026116 Bacteria 58777
355 Ga0207674_10028116 3300026116 Bacteria 5938
356 Ga0207674_10048537 3300026116 Bacteria 4344
357 Ga0207675_100003240 3300026118 Bacteria 15957
358 Ga0207675_100170498 3300026118 Unclassified 2080
359 Ga0207675_100205082 3300026118 Bacteria 1894
360 Ga0207428_10002980 3300027907 Bacteria 16729
361 Ga0268266_10003163 3300028379 Bacteria 16709
362 Ga0268266_10007293 3300028379 Bacteria 9998
363 Ga0268266_10131604 3300028379 Bacteria 2238
364 Ga0268266_10208559 3300028379 Bacteria 1791
365 Ga0268266_10498724 3300028379 Bacteria 1162
366 Ga0268265_10005169 3300028380 Bacteria 8940
367 Ga0268265_10018212 3300028380 Bacteria 4864
368 Ga0268265_10109946 3300028380 Bacteria 2248
369 Ga0268264_10000266 3300028381 Bacteria 92216
370 Ga0268264_10037874 3300028381 Bacteria 3978
371 Ga0268264_10228465 3300028381 Bacteria 1717
372 Ga0268264_10251513 3300028381 Bacteria 1642
373 Ga0268264_10252488 3300028381 Bacteria 1639
374 Ga0268264_10411314 3300028381 Bacteria 1302
375 Ga0265318_10001108 3300028577 Bacteria 16911
376 Ga0265338_10047237 3300028800 Bacteria 3934
377 Ga0265338_10087264 3300028800 Bacteria 2593
378 Ga0265324_10025954 3300029957 Bacteria 2074
379 Ga0265330_10013929 3300031235 Bacteria 3738
380 Ga0265332_10000666 3300031238 Bacteria 22220
381 Ga0265328_10001346 3300031239 Bacteria 11341
382 Ga0265328_10010152 3300031239 Bacteria 3802
383 Ga0265320_10001230 3300031240 Bacteria 18812
384 Ga0265320_10009541 3300031240 Bacteria 5846
385 Ga0265325_10000060 3300031241 Bacteria 75733
386 Ga0265325_10005798 3300031241 Bacteria 7571
387 Ga0265325_10074558 3300031241 Bacteria 1697
388 Ga0265329_10009562 3300031242 Bacteria 3607
389 Ga0265340_10007571 3300031247 Bacteria 5892
390 Ga0265339_10000448 3300031249 Bacteria 32326
391 Ga0265339_10007388 3300031249 Bacteria 7109
392 Ga0265331_10000300 3300031250 Bacteria 53937
393 Ga0265331_10000393 3300031250 Bacteria 45046
394 Ga0265331_10024221 3300031250 Bacteria 3073
395 Ga0265331_10037103 3300031250 Bacteria 2388
396 Ga0265316_10005705 3300031344 Bacteria 12035
397 Ga0265316_10034065 3300031344 Bacteria 4140
398 Ga0265316_10261696 3300031344 Bacteria 1268
399 Ga0307509_10000062 3300031507 Bacteria 143809
400 Ga0265313_10001837 3300031595 Bacteria 19362
401 Ga0265313_10061367 3300031595 Bacteria 1760
402 Ga0265313_10108318 3300031595 Bacteria 1224
403 Ga0307508_10074541 3300031616 Bacteria 2970
404 Ga0265314_10006388 3300031711 Bacteria 10445
405 Ga0265314_10034434 3300031711 Bacteria 3702
406 Ga0265342_10003783 3300031712 Bacteria 12205
407 Ga0307516_10000539 3300031730 Bacteria 50564
408 Ga0307413_10151149 3300031824 Bacteria 1618
409 Ga0307412_10018559 3300031911 Bacteria 4189
410 Ga0307414_10137808 3300032004 Bacteria 1905
411 Ga0307411_10018385 3300032005 Bacteria 4008
412 Ga0307415_100354363 3300032126 Bacteria 1237
413 Ga0373929_0006961 3300035085 Bacteria 2055
414 Ga0373929_0021329 3300035085 Bacteria 1313
415 Ga0373940_0019806 3300035088 Bacteria 1703
416 Ga0373944_0042820 3300035089 Bacteria 1405
417 Ga0373923_0031731 3300035111 Bacteria 2131
418 Ga0373923_0032380 3300035111 Bacteria 2112
419 Ga0373936_0004738 3300035113 Bacteria 5137
420 Ga0373939_0059399 3300035114 Bacteria 1213
421 Ga0373945_0008705 3300035116 Bacteria 3311
422 Ga0373953_0024111 3300035117 Bacteria 2310
423 Ga0373953_0042411 3300035117 Bacteria 1813
424 Ga0373954_0040174 3300035118 Bacteria 2179
425 Ga0373954_0067905 3300035118 Bacteria 1690
426 Ga0373956_0034747 3300035119 Bacteria 2221
427 Ga0373960_0021497 3300035121 Bacteria 1716
428 Ga0373955_0142109 3300035172 Bacteria 1408
429 Ga0373955_0146060 3300035172 Bacteria 1389
430 Ga0373961_0022727 3300035241 Bacteria 1680
431 Ga0373962_0035312 3300035242 Bacteria 1388
432 Ga0373924_0000024 3300035410 Bacteria 38618
433 Ga0373924_0034596 3300035410 Bacteria 2046
434 Ga0373924_0064087 3300035410 Bacteria 1542
435 Ga0373931_0006889 3300035691 Bacteria 5344
436 Ga0373931_0087457 3300035691 Bacteria 1730
437 Ga0373931_0115628 3300035691 Bacteria 1527
438 Ga0373931_0125440 3300035691 Bacteria 1472
439 Ga0373935_0082652 3300035692 Bacteria 2089
440 Ga0373927_0007724 3300035695 Bacteria 7277
441 Ga0373927_0030996 3300035695 Bacteria 3488
442 Ga0373927_0031855 3300035695 Bacteria 3434
443 Ga0373927_0092633 3300035695 Bacteria 1963
444 Ga0373927_0137594 3300035695 Unclassified 1597
445 Ga0373927_0279878 3300035695 Bacteria 1097
446 Ga0373933_0102698 3300035724 Bacteria 1775
447 Ga0373933_0250116 3300035724 Bacteria 1141
448 Ga0373947_0003454 3300035725 Bacteria 9339
449 Ga0373947_0050573 3300035725 Bacteria 2499
450 Ga0373947_0080584 3300035725 Bacteria 2014
451 Ga0373947_0097649 3300035725 Bacteria 1841
452 Ga0373937_0000791 3300036401 Bacteria 27108
453 Ga0373937_0019260 3300036401 Bacteria 6109
454 Ga0373937_0030209 3300036401 Bacteria 4908
455 Ga0373937_0071568 3300036401 Bacteria 3198
456 Ga0373937_0097063 3300036401 Bacteria 2733
457 Ga0373937_0200503 3300036401 Bacteria 1876
458 Ga0373937_0239543 3300036401 Bacteria 1709
459 Ga0373925_0026001 3300037068 Bacteria 4280
460 Ga0373925_0036345 3300037068 Bacteria 3635
461 Ga0373925_0062986 3300037068 Bacteria 2789
462 Ga0373925_0069326 3300037068 Bacteria 2663
463 Ga0373925_0092535 3300037068 Bacteria 2313
464 Ga0395899_0026821 3300037312 Bacteria 4346
465 Ga0395899_0038300 3300037312 Bacteria 3591
466 Ga0395899_0065846 3300037312 Bacteria 2662
467 Ga0395900_0066655 3300037418 Bacteria 3699
468 Ga0395900_0075207 3300037418 Bacteria 3472
469 Ga0395900_0099152 3300037418 Bacteria 2993
470 Ga0395898_0057728 3300037466 Bacteria 3781
471 Ga0395898_0142764 3300037466 Bacteria 2292
472 Ga0395901_0006867 3300038443 Bacteria 11497
473 Ga0395901_0035190 3300038443 Bacteria 5174
474 Ga0395901_0128900 3300038443 Bacteria 2659
475 Ga0395901_0193543 3300038443 Bacteria 2132
476 Ga0400483_103223 3300039062 Bacteria 15669
477 Ga0400483_282632 3300039062 Bacteria 4873
478 Ga0400489_46949 3300039093 Bacteria 44874
479 Ga0436365_0540361 3300039437 Bacteria 12246
480 Ga0436365_1347952 3300039437 Bacteria 3535
481 Ga0436365_1510318 3300039437 Bacteria 1348
482 Ga0436360_0854754 3300039438 Bacteria 1446
483 Ga0436361_0462470 3300039447 Bacteria 1595
484 Ga0436361_1140118 3300039447 Bacteria 1824
485 Ga0439431_0033580 3300041997 Bacteria 1283
486 Ga0439456_030662 3300042013 Bacteria 1151
487 Ga0451577_0025298 3300042876 Bacteria 5388
488 Ga0466963_0171298 3300044694 Bacteria 1513
489 Ga0466957_0003462 3300044842 Bacteria 8663
490 Ga0466957_0066760 3300044842 Bacteria 2218
491 Ga0466959_0098843 3300045049 Bacteria 2090
492 Ga0451576_0140957 3300045051 Bacteria 2514
493 Ga0466967_0001061 3300045976 Bacteria 15144
494 Ga0466967_0002809 3300045976 Bacteria 11043
495 Ga0466967_0007309 3300045976 Bacteria 7954
496 Ga0466967_0022682 3300045976 Bacteria 5129
497 Ga0466967_0302926 3300045976 Bacteria 1538
498 Ga0495629_0225730 3300046459 Bacteria 1291
499 Ga0495580_0009999 3300046472 Bacteria 7416
500 Ga0495580_0083074 3300046472 Bacteria 2232
501 Ga0495639_0048183 3300046475 Bacteria 1932
502 Ga0495664_0027367 3300046477 Bacteria 3324
503 Ga0495594_0033256 3300046499 Bacteria 2803
504 Ga0495594_0208618 3300046499 Bacteria 1114
505 Ga0495628_0074627 3300046516 Bacteria 2641
506 Ga0495630_0112266 3300046517 Bacteria 2064
507 Ga0495666_0031947 3300046526 Bacteria 2579
508 Ga0495652_0138169 3300046529 Bacteria 1920
509 Ga0495640_0067292 3300046533 Bacteria 2413
510 Ga0495667_0069515 3300046559 Bacteria 2298
511 Ga0495667_0119950 3300046559 Bacteria 1699
512 Ga0495667_0200093 3300046559 Bacteria 1279
513 Ga0495635_0216256 3300046663 Bacteria 1297
514 Ga0495623_0015993 3300046679 Bacteria 4849
515 Ga0495623_0083703 3300046679 Bacteria 1970
516 Ga0495624_0035568 3300046690 Bacteria 3216
517 Ga0495581_0011289 3300047315 Bacteria 5166
518 Ga0495674_0094626 3300047319 Bacteria 2548
519 Ga0495674_0287057 3300047319 Bacteria 1347
520 Ga0495672_0154409 3300047320 Bacteria 1187
521 Ga0495675_0029942 3300047444 Bacteria 3473
522 Ga0495684_0067700 3300047471 Bacteria 2715
523 Ga0496100_0005471 3300048903 Bacteria 6843
524 Ga0496100_0204426 3300048903 Bacteria 1441
525 Ga0496101_0008803 3300048904 Bacteria 6603
526 Ga0496102_0052112 3300048905 Bacteria 3728
527 Ga0496102_0053701 3300048905 Bacteria 3672
528 Ga0496102_0074768 3300048905 Bacteria 3115
529 Ga0496103_0076476 3300048906 Bacteria 2100
530 Ga0496104_0005540 3300048907 Bacteria 11059
531 Ga0496104_0019605 3300048907 Bacteria 6190
532 Ga0496104_0077074 3300048907 Bacteria 3176
533 Ga0496105_0013464 3300048908 Bacteria 6494
534 Ga0496105_0211300 3300048908 Bacteria 1581
535 Ga0496106_0008193 3300048909 Bacteria 7724
536 Ga0496107_0017290 3300048910 Bacteria 5070
537 Ga0496108_0273936 3300048911 Bacteria 1469
538 Ga0496108_0390521 3300048911 Bacteria 1215
539 Ga0496109_0009668 3300048912 Bacteria 8228
540 Ga0496109_0044847 3300048912 Bacteria 4012
541 Ga0496109_0147409 3300048912 Bacteria 2202
542 Ga0496110_0008712 3300048913 Bacteria 8169
543 Ga0496110_0123844 3300048913 Bacteria 2331
544 Ga0496111_0027073 3300048914 Unclassified 4053
545 Ga0496111_0125062 3300048914 Bacteria 1900
546 Ga0496111_0324873 3300048914 Bacteria 1139
547 Ga0496112_0005155 3300048915 Bacteria 11238
548 Ga0496112_0026939 3300048915 Bacteria 5540
549 Ga0496112_0074260 3300048915 Bacteria 3362
550 Ga0496112_0488530 3300048915 Bacteria 1167
551 Ga0496113_0054918 3300048916 Bacteria 2984
552 Ga0496114_0152876 3300048917 Bacteria 2002
553 Ga0496114_0204230 3300048917 Bacteria 1731
554 Ga0496115_0252954 3300048918 Unclassified 1450
555 Ga0496115_0500608 3300048918 Bacteria 976
556 Ga0496126_0000406 3300048929 Bacteria 87599
557 Ga0501031_0058133 3300049568 Bacteria 2520
558 Ga0501034_0001175 3300049571 Bacteria 36278
559 Ga0501034_0152987 3300049571 Bacteria 2282
560 Ga0501036_0063272 3300049572 Bacteria 3133
561 Ga0501036_0100768 3300049572 Bacteria 2443
562 Ga0501036_0509624 3300049572 Bacteria 1001
563 Ga0501037_0086424 3300049573 Bacteria 2270
564 Ga0501038_0019227 3300049574 Bacteria 6160
565 Ga0501039_0006177 3300049575 Bacteria 9098
566 Ga0501040_0028845 3300049576 Unclassified 3743
567 Ga0501040_0029243 3300049576 Bacteria 3719
568 Ga0501041_0010818 3300049577 Bacteria 5383
569 Ga0501041_0212395 3300049577 Unclassified 1214
570 Ga0501041_0407198 3300049577 Bacteria 862
571 Ga0501043_0075320 3300049579 Bacteria 2651
572 Ga0501043_0305157 3300049579 Bacteria 1216
573 Ga0501047_0015077 3300049581 Bacteria 7357
574 Ga0501047_0086990 3300049581 Bacteria 3003
575 Ga0501072_0095264 3300049588 Unclassified 2366
576 Ga0501072_0096440 3300049588 Bacteria 2350
577 Ga0501073_0050807 3300049589 Bacteria 2904
578 Ga0501075_0000265 3300049591 Bacteria 28570
579 Ga0501075_0243354 3300049591 Unclassified 1371
580 Ga0501076_0000132 3300049592 Bacteria 41750
581 Ga0501076_0042627 3300049592 Bacteria 3574
582 Ga0501079_0019096 3300049741 Bacteria 5237
583 Ga0501080_0062624 3300049742 Bacteria 3462
584 Ga0501080_0202829 3300049742 Bacteria 1820
585 Ga0501081_0061280 3300049743 Bacteria 2608
586 Ga0501083_0198700 3300049744 Bacteria 1308
587 Ga0501035_0062301 3300049822 Bacteria 3319
588 Ga0501044_0112667 3300049823 Bacteria 2727
589 Ga0501044_0149247 3300049823 Bacteria 2321
590 Ga0501044_0154911 3300049823 Bacteria 2271
591 Ga0501045_0042000 3300049824 Bacteria 3328
592 Ga0501045_0174229 3300049824 Bacteria 1603
593 nmdc:mga03683_14462_c1 3300050489 Bacteria 2921
594 nmdc:mga03683_1864_c1 3300050489 Bacteria 6418
595 nmdc:mga03683_37495_c1 3300050489 Bacteria 1975
596 nmdc:mga03n38_64555_c1 3300050490 Bacteria 1676
597 nmdc:mga00v17_75755_c1 3300050491 Bacteria 2092
598 nmdc:mga0yw44_191180_c1 3300050492 Bacteria 1350
599 nmdc:mga0yw44_208693_c1 3300050492 Bacteria 1292
600 nmdc:mga0yw44_58640_c1 3300050492 Bacteria 2352
601 nmdc:mga0k408_12246_c1 3300050493 Bacteria 4687
602 nmdc:mga05p37_11505_c2 3300050507 Bacteria 5702
603 nmdc:mga05p37_134618_c1 3300050507 Bacteria 3032
604 nmdc:mga05p37_18280_c1 3300050507 Bacteria 8468
605 nmdc:mga05p37_575257_c1 3300050507 Bacteria 1277
606 nmdc:mga05p37_597303_c1 3300050507 Bacteria 1247
607 nmdc:mga09592_11396_c1 3300050508 Bacteria 7229
608 nmdc:mga09592_250129_c1 3300050508 Bacteria 1536
609 nmdc:mga09592_265393_c1 3300050508 Bacteria 1489
610 nmdc:mga09592_286846_c1 3300050508 Bacteria 1427
611 nmdc:mga0qj67_152137_c1 3300050509 Bacteria 1877
612 nmdc:mga0qj67_41449_c1 3300050509 Bacteria 3622
613 nmdc:mga06r32_10120_c1 3300050510 Bacteria 8513
614 nmdc:mga06r32_53910_c1 3300050510 Bacteria 3855
615 nmdc:mga06r32_6202_c1 3300050510 Bacteria 10730
616 nmdc:mga08y16_106413_c1 3300050511 Unclassified 2920
617 nmdc:mga0n895_101538_c1 3300050512 Bacteria 2886
618 nmdc:mga0n895_153028_c1 3300050512 Bacteria 2337
619 nmdc:mga0n895_160795_c1 3300050512 Bacteria 2278
620 nmdc:mga0n895_22935_c1 3300050512 Bacteria 5857
621 nmdc:mga0rr50_308605_c1 3300050513 Bacteria 1325
622 nmdc:mga0rr50_7355_c1 3300050513 Bacteria 6784
623 nmdc:mga08x19_10742_c1 3300050514 Bacteria 5502
624 nmdc:mga08x19_139_c1 3300050514 Bacteria 64397
625 nmdc:mga08x19_140421_c1 3300050514 Unclassified 1631
626 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
627 nmdc:mga08x19_34778_c1 3300050514 Bacteria 3186
628 nmdc:mga0a205_106524_c1 3300050515 Bacteria 2701
629 nmdc:mga0a205_222301_c1 3300050515 Bacteria 1773
630 nmdc:mga0sz30_15_c1 3300050516 Bacteria 83405
631 Ga0495601_0007325 3300053077 Bacteria 6467
632 Ga0495595_0004133 3300053084 Bacteria 5827
633 Ga0495619_0101096 3300053085 Bacteria 1963
634 Ga0500641_0000591 3300053096 Bacteria 13070
635 Ga0500641_0006301 3300053096 Bacteria 4211
636 Ga0500562_025422 3300053108 Bacteria 1549
637 Ga0500552_000458 3300053733 Bacteria 3762
638 Ga0501084_0010948 3300054114 Bacteria 7512
639 Ga0501084_0015526 3300054114 Bacteria 6316
640 Ga0501082_0003150 3300060353 Bacteria 14380
641 Ga0501082_0111138 3300060353 Unclassified 2372
642 Ga0530510_0000011 3300061734 Bacteria 125603
643 Ga0530510_0125254 3300061734 Bacteria 1888
644 2558913770 2558860112 Bacteria 9931328
645 2870785874 2870782633 Bacteria 9624083
646 Ga0070680_100003395
647 Ga0065715_10101630
648 Ga0070658_10005362
649 Ga0070690_100001060
650 Ga0070690_100055759
651 Ga0070670_100000038
652 Ga0068869_100025251
653 Ga0070666_10000210
654 Ga0070680_100002348
655 Ga0070680_100056977
656 Ga0070680_100162564
657 Ga0070682_100001240
658 Ga0068868_100216092
659 Ga0068868_100237975
660 Ga0068868_100253513
661 Ga0070660_100108852
662 Ga0070689_100114670
663 Ga0070691_10003177
664 Ga0070691_10081834
665 Ga0070687_100000784
666 Ga0070668_100000038
667 Ga0070668_100191764
668 Ga0070668_100335851
669 Ga0070669_100000037
670 Ga0070669_100123089
671 Ga0070675_100125223
672 Ga0070675_100487986
673 Ga0070674_100315458
674 Ga0070674_100333849
675 Ga0070673_100061560
676 Ga0070673_100223661
677 Ga0070659_100062621
678 Ga0070667_100000106
679 Ga0070709_10000723
680 Ga0070709_10229489
681 Ga0070714_100020273
682 Ga0070714_100317541
683 Ga0070713_100000017
684 Ga0070713_100274794
685 Ga0070710_10033203
686 Ga0070701_10175822
687 Ga0070711_100113211
688 Ga0070711_100210536
689 Ga0070711_100341492
690 Ga0070705_100005956
691 Ga0070705_100021330
692 Ga0070705_100216406
693 Ga0070700_100064037
694 Ga0070694_100001660
695 Ga0070694_100006131
696 Ga0070694_100202182
697 Ga0070708_100000635
698 Ga0070708_100074136
699 Ga0070663_100227518
700 Ga0070678_100148489
701 Ga0070681_10000014
702 Ga0070681_10003411
703 Ga0070681_10249446
704 Ga0070681_10327744
705 Ga0068867_100016612
706 Ga0070706_100004301
707 Ga0070706_100046046
708 Ga0070706_100052829
709 Ga0070706_100076147
710 Ga0070707_100000387
711 Ga0070707_100012569
712 Ga0070707_100083972
713 Ga0070707_100120066
714 Ga0070698_100154868
715 Ga0070698_100407772
716 Ga0070699_100001243
717 Ga0070699_100005487
718 Ga0070699_100064778
719 Ga0070699_100130219
720 Ga0070699_100289292
721 Ga0070679_100000496
722 Ga0070679_100001405
723 Ga0070679_100005116
724 Ga0070679_100106828
725 Ga0070679_100285145
726 Ga0070697_100000949
727 Ga0070697_100008129
728 Ga0070697_100016148
729 Ga0070697_100117598
730 Ga0068853_100003305
731 Ga0068853_100005537
732 Ga0068853_100277208
733 Ga0070672_100166208
734 Ga0070672_100206959
735 Ga0070686_100072033
736 Ga0070695_100216490
737 Ga0070696_100008140
738 Ga0070693_100005975
739 Ga0070665_100002235
740 Ga0070665_100014039
741 Ga0070665_100015345
742 Ga0070665_100035555
743 Ga0070665_100044611
744 Ga0070704_100014466
745 Ga0070704_100090619
746 Ga0070704_100395600
747 Ga0068855_100000752
748 Ga0068855_100035251
749 Ga0068855_100210513
750 Ga0068855_100288659
751 Ga0068857_100000172
752 Ga0068857_100057146
753 Ga0068854_100035402
754 Ga0068854_100196627
755 Ga0068854_100270109
756 Ga0068856_100002580
757 Ga0068856_100013564
758 Ga0068856_100117163
759 Ga0068859_100017838
760 Ga0068864_100000065
761 Ga0068864_100099345
762 Ga0068866_10013092
763 Ga0068861_100345806
764 Ga0068861_100446720
765 Ga0068870_10072410
766 Ga0068863_100019017
767 Ga0068863_100175683
768 Ga0068863_100396364
769 Ga0068858_100099677
770 Ga0068860_100000191
771 Ga0068860_100054428
772 Ga0068860_100059953
773 Ga0068860_100062177
774 Ga0068860_100139132
775 Ga0068860_100305522
776 Ga0068862_100000937
777 Ga0068862_100058409
778 Ga0068862_100063270
779 Ga0081455_10001681
780 Ga0081455_10009127
781 Ga0081538_10033150
782 Ga0081538_10052506
783 Ga0081540_1081264
784 Ga0081539_10004342
785 Ga0070717_10067153
786 Ga0070717_10249446
787 Ga0070717_10416296
788 Ga0075365_10209616
789 Ga0075363_100135504
790 Ga0070716_100110828
791 Ga0070712_100002031
792 Ga0070712_100181250
793 Ga0075362_10005570
794 Ga0075362_10006343
795 Ga0075362_10044318
796 Ga0075362_10083473
797 Ga0075367_10059635
798 Ga0075369_10000101
799 Ga0075366_10000880
800 Ga0075366_10060297
801 Ga0075370_10077325
802 Ga0075370_10086779
803 Ga0068871_100021796
804 Ga0075428_100123077
805 Ga0075430_100182230
806 Ga0075430_100184364
807 Ga0075431_100009092
808 Ga0075431_100107725
809 Ga0075431_100264436
810 Ga0075431_100632825
811 Ga0075433_10182608
812 Ga0075433_10417876
813 Ga0075434_100016993
814 Ga0075434_100026958
815 Ga0075434_100057403
816 Ga0075434_100375053
817 Ga0075429_100005130
818 Ga0075429_100077108
819 Ga0075429_100197028
820 Ga0075429_100279496
821 Ga0075429_100292083
822 Ga0075436_100000298
823 Ga0075436_100002439
824 Ga0075436_100055822
825 Ga0075436_100087543
826 Ga0097620_100017837
827 Ga0075435_100009236
828 Ga0075435_100017319
829 Ga0075435_100319733
830 Ga0075435_100409962
831 Ga0099794_10045519
832 Ga0105240_10093516
833 Ga0105240_10389043
834 Ga0111539_10073592
835 Ga0105247_10014721
836 Ga0105247_10156157
837 Ga0114129_10069547
838 Ga0114129_10171223
839 Ga0114129_10323904
840 Ga0114129_10333125
841 Ga0114129_10368994
842 Ga0114129_10677394
843 Ga0114129_10884837
844 Ga0105243_10001313
845 Ga0105243_10050046
846 Ga0105243_10073897
847 Ga0105243_10112443
848 Ga0105243_10630448
849 Ga0105241_10034927
850 Ga0105241_10103013
851 Ga0105241_10113657
852 Ga0105242_10000997
853 Ga0105242_10087273
854 Ga0105248_10023170
855 Ga0105248_10026936
856 Ga0105248_10034077
857 Ga0105248_10140424
858 Ga0105248_10634678
859 Ga0105237_10079293
860 Ga0105238_10001268
861 Ga0105249_10000713
862 Ga0105249_10007835
863 Ga0105249_10021811
864 Ga0105249_10029600
865 Ga0105249_10217062
866 Ga0105249_10244130
867 Ga0105249_10389531
868 Ga0105239_10208928
869 Ga0105246_10075310
870 Ga0157373_10037182
871 Ga0157370_10005235
872 Ga0157370_10330061
873 Ga0157369_10067378
874 Ga0157369_10091691
875 Ga0157374_10106322
876 Ga0157378_10167836
877 Ga0157378_10235573
878 Ga0163162_10365993
879 Ga0157372_10001645
880 Ga0157375_10078934
881 Ga0157375_10161289
882 Ga0157375_10305983
883 Ga0157375_10521310
884 Ga0163163_10012424
885 Ga0163163_10015321
886 Ga0157380_10145742
887 Ga0157379_10010717
888 Ga0157379_10013271
889 Ga0157379_10025453
890 Ga0157379_10034275
891 Ga0157379_10063817
892 Ga0157379_10325270
893 Ga0157379_10339687
894 Ga0157376_10024774
895 Ga0206354_11615725
896 Ga0206353_10127440
897 Ga0213876_10123276
898 Ga0207426_1021340
899 Ga0207426_1025343
900 Ga0207692_10142974
901 Ga0207642_10109589
902 Ga0207710_10008655
903 Ga0207680_10001475
904 Ga0207699_10000117
905 Ga0207699_10068719
906 Ga0207699_10121957
907 Ga0207645_10152494
908 Ga0207705_10002117
909 Ga0207684_10033753
910 Ga0207684_10106321
911 Ga0207684_10175254
912 Ga0207684_10177551
913 Ga0207654_10169904
914 Ga0207654_10197325
915 Ga0207654_10217302
916 Ga0207707_10000001
917 Ga0207707_10000899
918 Ga0207707_10002876
919 Ga0207707_10011252
920 Ga0207707_10273189
921 Ga0207707_10277525
922 Ga0207695_10150923
923 Ga0207695_10256388
924 Ga0207671_10036040
925 Ga0207671_10100873
926 Ga0207693_10000129
927 Ga0207693_10000331
928 Ga0207663_10018830
929 Ga0207660_10000228
930 Ga0207660_10001870
931 Ga0207660_10044659
932 Ga0207660_10091691
933 Ga0207662_10004619
934 Ga0207662_10010817
935 Ga0207652_10000094
936 Ga0207652_10001011
937 Ga0207652_10006913
938 Ga0207652_10122415
939 Ga0207652_10196209
940 Ga0207646_10000140
941 Ga0207646_10078319
942 Ga0207646_10092062
943 Ga0207646_10097167
944 Ga0207646_10141533
945 Ga0207646_10429630
946 Ga0207681_10000015
947 Ga0207681_10154147
948 Ga0207694_10026794
949 Ga0207650_10000032
950 Ga0207700_10000034
951 Ga0207700_10008470
952 Ga0207700_10067940
953 Ga0207664_10013472
954 Ga0207664_10256346
955 Ga0207644_10040778
956 Ga0207644_10398868
957 Ga0207690_10090185
958 Ga0207690_10231667
959 Ga0207686_10000208
960 Ga0207709_10000029
961 Ga0207709_10203361
962 Ga0207670_10083868
963 Ga0207669_10235713
964 Ga0207665_10060643
965 Ga0207665_10062885
966 Ga0207691_10095277
967 Ga0207711_10017820
968 Ga0207711_10041220
969 Ga0207711_10461310
970 Ga0207689_10005287
971 Ga0207667_10000116
972 Ga0207667_10015722
973 Ga0207667_10437311
974 Ga0207651_10073743
975 Ga0207651_10127657
976 Ga0207651_10167391
977 Ga0207712_10000804
978 Ga0207712_10011410
979 Ga0207712_10034890
980 Ga0207712_10136508
981 Ga0207668_10000369
982 Ga0207640_10031532
983 Ga0207640_10033861
984 Ga0207640_10049108
985 Ga0207658_10000339
986 Ga0207677_10191398
987 Ga0207703_10538609
988 Ga0207639_10013585
989 Ga0207639_10060493
990 Ga0207708_10063497
991 Ga0207702_10002207
992 Ga0207702_10017121
993 Ga0207641_10001336
994 Ga0207648_10030793
995 Ga0207648_10068221
996 Ga0207648_10292162
997 Ga0207676_10001012
998 Ga0207676_10408737
999 Ga0207674_10000365
1000 Ga0207674_10028116
1001 Ga0207674_10048537
1002 Ga0207675_100003240
1003 Ga0207675_100170498
1004 Ga0207675_100205082
1005 Ga0207428_10002980
1006 Ga0268266_10003163
1007 Ga0268266_10007293
1008 Ga0268266_10131604
1009 Ga0268266_10208559
1010 Ga0268266_10498724
1011 Ga0268265_10005169
1012 Ga0268265_10018212
1013 Ga0268265_10109946
1014 Ga0268264_10000266
1015 Ga0268264_10037874
1016 Ga0268264_10228465
1017 Ga0268264_10251513
1018 Ga0268264_10252488
1019 Ga0268264_10411314
1020 Ga0265318_10001108
1021 Ga0265338_10047237
1022 Ga0265338_10087264
1023 Ga0265324_10025954
1024 Ga0265330_10013929
1025 Ga0265332_10000666
1026 Ga0265328_10001346
1027 Ga0265328_10010152
1028 Ga0265320_10001230
1029 Ga0265320_10009541
1030 Ga0265325_10000060
1031 Ga0265325_10005798
1032 Ga0265325_10074558
1033 Ga0265329_10009562
1034 Ga0265340_10007571
1035 Ga0265339_10000448
1036 Ga0265339_10007388
1037 Ga0265331_10000300
1038 Ga0265331_10000393
1039 Ga0265331_10024221
1040 Ga0265331_10037103
1041 Ga0265316_10005705
1042 Ga0265316_10034065
1043 Ga0265316_10261696
1044 Ga0307509_10000062
1045 Ga0265313_10001837
1046 Ga0265313_10061367
1047 Ga0265313_10108318
1048 Ga0307508_10074541
1049 Ga0265314_10006388
1050 Ga0265314_10034434
1051 Ga0265342_10003783
1052 Ga0307516_10000539
1053 Ga0307413_10151149
1054 Ga0307412_10018559
1055 Ga0307414_10137808
1056 Ga0307411_10018385
1057 Ga0307415_100354363
1058 Ga0373929_0006961
1059 Ga0373929_0021329
1060 Ga0373940_0019806
1061 Ga0373944_0042820
1062 Ga0373923_0031731
1063 Ga0373923_0032380
1064 Ga0373936_0004738
1065 Ga0373939_0059399
1066 Ga0373945_0008705
1067 Ga0373953_0024111
1068 Ga0373953_0042411
1069 Ga0373954_0040174
1070 Ga0373954_0067905
1071 Ga0373956_0034747
1072 Ga0373960_0021497
1073 Ga0373955_0142109
1074 Ga0373955_0146060
1075 Ga0373961_0022727
1076 Ga0373962_0035312
1077 Ga0373924_0000024
1078 Ga0373924_0034596
1079 Ga0373924_0064087
1080 Ga0373931_0006889
1081 Ga0373931_0087457
1082 Ga0373931_0115628
1083 Ga0373931_0125440
1084 Ga0373935_0082652
1085 Ga0373927_0007724
1086 Ga0373927_0030996
1087 Ga0373927_0031855
1088 Ga0373927_0092633
1089 Ga0373927_0137594
1090 Ga0373927_0279878
1091 Ga0373933_0102698
1092 Ga0373933_0250116
1093 Ga0373947_0003454
1094 Ga0373947_0050573
1095 Ga0373947_0080584
1096 Ga0373947_0097649
1097 Ga0373937_0000791
1098 Ga0373937_0019260
1099 Ga0373937_0030209
1100 Ga0373937_0071568
1101 Ga0373937_0097063
1102 Ga0373937_0200503
1103 Ga0373937_0239543
1104 Ga0373925_0026001
1105 Ga0373925_0036345
1106 Ga0373925_0062986
1107 Ga0373925_0069326
1108 Ga0373925_0092535
1109 Ga0395899_0026821
1110 Ga0395899_0038300
1111 Ga0395899_0065846
1112 Ga0395900_0066655
1113 Ga0395900_0075207
1114 Ga0395900_0099152
1115 Ga0395898_0057728
1116 Ga0395898_0142764
1117 Ga0395901_0006867
1118 Ga0395901_0035190
1119 Ga0395901_0128900
1120 Ga0395901_0193543
1121 Ga0400483_103223
1122 Ga0400483_282632
1123 Ga0400489_46949
1124 Ga0436365_0540361
1125 Ga0436365_1347952
1126 Ga0436365_1510318
1127 Ga0436360_0854754
1128 Ga0436361_0462470
1129 Ga0436361_1140118
1130 Ga0439431_0033580
1131 Ga0439456_030662
1132 Ga0451577_0025298
1133 Ga0466963_0171298
1134 Ga0466957_0003462
1135 Ga0466957_0066760
1136 Ga0466959_0098843
1137 Ga0451576_0140957
1138 Ga0466967_0001061
1139 Ga0466967_0002809
1140 Ga0466967_0007309
1141 Ga0466967_0022682
1142 Ga0466967_0302926
1143 Ga0495629_0225730
1144 Ga0495580_0009999
1145 Ga0495580_0083074
1146 Ga0495639_0048183
1147 Ga0495664_0027367
1148 Ga0495594_0033256
1149 Ga0495594_0208618
1150 Ga0495628_0074627
1151 Ga0495630_0112266
1152 Ga0495666_0031947
1153 Ga0495652_0138169
1154 Ga0495640_0067292
1155 Ga0495667_0069515
1156 Ga0495667_0119950
1157 Ga0495667_0200093
1158 Ga0495635_0216256
1159 Ga0495623_0015993
1160 Ga0495623_0083703
1161 Ga0495624_0035568
1162 Ga0495581_0011289
1163 Ga0495674_0094626
1164 Ga0495674_0287057
1165 Ga0495672_0154409
1166 Ga0495675_0029942
1167 Ga0495684_0067700
1168 Ga0496100_0005471
1169 Ga0496100_0204426
1170 Ga0496101_0008803
1171 Ga0496102_0052112
1172 Ga0496102_0053701
1173 Ga0496102_0074768
1174 Ga0496103_0076476
1175 Ga0496104_0005540
1176 Ga0496104_0019605
1177 Ga0496104_0077074
1178 Ga0496105_0013464
1179 Ga0496105_0211300
1180 Ga0496106_0008193
1181 Ga0496107_0017290
1182 Ga0496108_0273936
1183 Ga0496108_0390521
1184 Ga0496109_0009668
1185 Ga0496109_0044847
1186 Ga0496109_0147409
1187 Ga0496110_0008712
1188 Ga0496110_0123844
1189 Ga0496111_0027073
1190 Ga0496111_0125062
1191 Ga0496111_0324873
1192 Ga0496112_0005155
1193 Ga0496112_0026939
1194 Ga0496112_0074260
1195 Ga0496112_0488530
1196 Ga0496113_0054918
1197 Ga0496114_0152876
1198 Ga0496114_0204230
1199 Ga0496115_0252954
1200 Ga0496115_0500608
1201 Ga0496126_0000406
1202 Ga0501031_0058133
1203 Ga0501034_0001175
1204 Ga0501034_0152987
1205 Ga0501036_0063272
1206 Ga0501036_0100768
1207 Ga0501036_0509624
1208 Ga0501037_0086424
1209 Ga0501038_0019227
1210 Ga0501039_0006177
1211 Ga0501040_0028845
1212 Ga0501040_0029243
1213 Ga0501041_0010818
1214 Ga0501041_0212395
1215 Ga0501041_0407198
1216 Ga0501043_0075320
1217 Ga0501043_0305157
1218 Ga0501047_0015077
1219 Ga0501047_0086990
1220 Ga0501072_0095264
1221 Ga0501072_0096440
1222 Ga0501073_0050807
1223 Ga0501075_0000265
1224 Ga0501075_0243354
1225 Ga0501076_0000132
1226 Ga0501076_0042627
1227 Ga0501079_0019096
1228 Ga0501080_0062624
1229 Ga0501080_0202829
1230 Ga0501081_0061280
1231 Ga0501083_0198700
1232 Ga0501035_0062301
1233 Ga0501044_0112667
1234 Ga0501044_0149247
1235 Ga0501044_0154911
1236 Ga0501045_0042000
1237 Ga0501045_0174229
1238 nmdc:mga03683_14462_c1
1239 nmdc:mga03683_1864_c1
1240 nmdc:mga03683_37495_c1
1241 nmdc:mga03n38_64555_c1
1242 nmdc:mga00v17_75755_c1
1243 nmdc:mga0yw44_191180_c1
1244 nmdc:mga0yw44_208693_c1
1245 nmdc:mga0yw44_58640_c1
1246 nmdc:mga0k408_12246_c1
1247 nmdc:mga05p37_11505_c2
1248 nmdc:mga05p37_134618_c1
1249 nmdc:mga05p37_18280_c1
1250 nmdc:mga05p37_575257_c1
1251 nmdc:mga05p37_597303_c1
1252 nmdc:mga09592_11396_c1
1253 nmdc:mga09592_250129_c1
1254 nmdc:mga09592_265393_c1
1255 nmdc:mga09592_286846_c1
1256 nmdc:mga0qj67_152137_c1
1257 nmdc:mga0qj67_41449_c1
1258 nmdc:mga06r32_10120_c1
1259 nmdc:mga06r32_53910_c1
1260 nmdc:mga06r32_6202_c1
1261 nmdc:mga08y16_106413_c1
1262 nmdc:mga0n895_101538_c1
1263 nmdc:mga0n895_153028_c1
1264 nmdc:mga0n895_160795_c1
1265 nmdc:mga0n895_22935_c1
1266 nmdc:mga0rr50_308605_c1
1267 nmdc:mga0rr50_7355_c1
1268 nmdc:mga08x19_10742_c1
1269 nmdc:mga08x19_139_c1
1270 nmdc:mga08x19_140421_c1
1271 nmdc:mga08x19_18_c1
1272 nmdc:mga08x19_34778_c1
1273 nmdc:mga0a205_106524_c1
1274 nmdc:mga0a205_222301_c1
1275 nmdc:mga0sz30_15_c1
1276 Ga0495601_0007325
1277 Ga0495595_0004133
1278 Ga0495619_0101096
1279 Ga0500641_0000591
1280 Ga0500641_0006301
1281 Ga0500562_025422
1282 Ga0500552_000458
1283 Ga0501084_0010948
1284 Ga0501084_0015526
1285 Ga0501082_0003150
1286 Ga0501082_0111138
1287 Ga0530510_0000011
1288 Ga0530510_0125254
1289 2558913770
1290 2870785874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

95

179

0.96

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

220

349

0.93

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

252

391

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9593 1 323
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9574 1 323
1yb5-assembly1.cif.gz_A crystal structure of human zeta-crystallin with bound nadp 0.9552 1 324
1yb5-assembly1.cif.gz_A crystal structure of human zeta-crystallin with bound nadp 0.9466 1 324
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9453 1 323
ID Description Score Start End Superfamily
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9802 131 258 3.40.50.720
af_P95185_121_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9757 124 288 3.40.50.720
af_P47199_9_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9757 3 118 3.90.180.10
af_B0BNC9_26_350_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9751 2 325 3.90.180.10
af_P96826_2_321_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9717 2 323 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A355B5N3-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9825 112 324 GO:0008270
GO:0016491
AF-A0A7S1LSE5-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9796 20 321 GO:0016491
AF-A0A2A4AT29-F1-model_v4 deleted 0.9792 1 324
AF-A0A3D5V0E0-F1-model_v4 NADPH:quinone oxidoreductase 0.9791 1 260 GO:0016491
AF-A0A5E6MFL2-F1-model_v4 Partial enoyl reductase 0.979 1 162 GO:0003730
GO:0003960
GO:0005829
GO:0070402

Map