F472091

General Info

Members Datasets Scaffolds Average Seq Length
645 358 482 620

Family's Representative Sequence

Representative Sequence 3300002126|JGI24035J26624_1000858|JGI24035J26624_10008582
Length 747
Sequence VELLSALKKHFGYDQFRPLQREIMHDALAGRDLFVLMPTGGGKSLCFQLPALMRDGLTIVVSPLIALMKDQVDGLQTSGIPATYLNSTLDRAEAKARWRGLHRGQYRMLYVAPERLMLDTFLERALNWDIAQFAIDEAHCISEWGHDFRPEYRELKKLRKQLPDVPIMALTATATERVRVDIIKELELRDPRAYVASFNRPNLTYRVVPKTAPYDQLLTFIRSRPNDSGIIYCASRKSTESLARNLNEDGITAKPYHAGLTNAERTKHQDAFLRDDVRVITATIAFGMGINKPNVRFVVHYDLPKNIESYYQETGRAGRDGLPSECVLLFSPGDVAKQLHFIDEKTESEARIARAQLQQMVHYAEARECRRTVLLKYFGESYPSNAEAVGDATLPLQISCESCDNCLQPRETFDGTVHAQKFLSCVYRIRARHGFGFGLGHVVDVLRGADTEAIRQRSHNELSTYGIGGELKRSEWQAIGRELLRLGLIECAPGKFATLSLTPTGLEALRKRTSIVLTKQIEIVEKAPRRRAGAIECDEALFERLRALRRKFADERGVPAYIIFSDVSLREMARKYPSNSAXFRRIPGVGEQKSKDYAEPFLIEIRKYLTTSPRRTFPDEVDSSLPQRQVRLNDSQTDTLRRFQRGETVEQIARARGFVSSTIYGHLLAAIECCKLPQARARFFTPVQEKEITAAFHQVPGGTLTDISAILRNKYDIGLLRIFRALKQGRTASQPSKENDGLEAVTP

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
7 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
8 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
9 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
10 2547132181 Kosakonia sacchari SP1 Isolate Stem
11 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
12 2561511199 Enterobacter sp. R4-368 Isolate Nodule
13 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
14 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
15 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
16 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
17 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
18 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
19 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
20 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
21 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
22 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
23 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
24 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
25 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
26 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
27 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
28 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
29 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
30 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
31 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
32 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
33 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
34 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
35 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
36 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
37 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
38 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
39 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
40 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
41 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
42 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
43 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
44 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
45 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
46 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
47 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
48 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
49 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
50 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
51 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
52 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
53 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
54 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
55 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
56 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
57 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
58 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
59 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
60 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
61 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
62 2636415599 Klebsiella variicola DX120E Isolate Unclassified
63 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
64 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
65 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
66 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
67 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
68 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
69 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
70 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
71 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
72 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
73 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
74 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
75 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
76 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
77 2751185917 Enterobacter sp. HK169 Isolate Unclassified
78 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
79 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
80 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
81 2775507074 Klebsiella sp. D5A Isolate Unclassified
82 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
83 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
84 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
85 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
86 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
87 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
88 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
89 2821118458 Enterobacter asburiae 609 Isolate Unclassified
90 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
91 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
92 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
93 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
94 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
95 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
96 2847085930 Erwinia persicina B64 Isolate Bulb
97 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
98 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
99 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
100 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
101 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
102 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
103 2865014394 Pantoea sp. R-71966 Isolate Unclassified
104 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
105 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
106 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
107 2876601092 Pantoea endophytica 596 Isolate Unclassified
108 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
109 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
110 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
111 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
112 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
113 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
114 2902330777 Methylobacterium sp. 2A Isolate Unclassified
115 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
116 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
117 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
118 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
119 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
120 2919150387 Rahnella aceris 1817 Isolate Unclassified
121 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
122 2927143783 Rahnella sp. 2050 Isolate Unclassified
123 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
124 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
125 2932406140 Serratia sp. 2723 Isolate Rhizosphere
126 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
127 2937539931 Pantoea sp. LS15 Isolate Unclassified
128 2937967321 Serratia sp. YC16 Isolate Unclassified
129 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
130 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
131 2939577877 Serratia sp. 509 Isolate Rhizosphere
132 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
133 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
134 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
135 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
136 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
137 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
138 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
139 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
140 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
141 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
142 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
143 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
144 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
145 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
146 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
147 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
148 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
149 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
150 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
151 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
152 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
153 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
154 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
155 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
156 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
157 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
158 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
159 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
160 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
161 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
162 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
163 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
164 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
165 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
166 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
167 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
168 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
169 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
170 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
171 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
172 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
173 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
174 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
175 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
176 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
177 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
178 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
179 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
180 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
181 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
182 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
183 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
184 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
185 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
186 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
187 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
188 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
189 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
190 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
191 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
192 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
193 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
194 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
195 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
196 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
197 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
198 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
199 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
200 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
201 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
202 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
203 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
204 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
205 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
206 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
207 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
208 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
209 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
210 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
211 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
212 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
213 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
214 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
215 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
216 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
217 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
218 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
219 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
220 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
221 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
222 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
223 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
224 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
225 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
226 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
227 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
228 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
229 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
230 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
231 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
232 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
237 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
238 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
240 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
241 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
273 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
277 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
282 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
283 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
284 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
285 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
286 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
287 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
288 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
304 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
305 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
312 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
331 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
339 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
342 640753048 Serratia proteamaculans 568 Isolate Endosphere
343 641522639 Methylobacterium sp. 4-46 Isolate Nodule
344 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
345 8004592986 Serratia sp. S119 Isolate Unclassified
346 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
347 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
348 8018221730 Enterobacter sp. CM29 Isolate Unclassified
349 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
350 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
351 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
352 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
353 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
354 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
355 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
356 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
357 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
358 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.73
Metatranscriptomes 0
Isolates 25.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0.16
Endosphere 4.03
Nodule 3.72
Rhizoplane 12.09
Rhizosphere 58.45
Stem 0.16
Stem Tuber 0.78
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C1615 2010549000 Bacteria 3193
2 SwRhRL2b_contig_1995509 2162886007 Bacteria 9393
3 JGI24739J22299_10000016 3300001989 Bacteria 51238
4 JGI24035J26624_1000858 3300002126 Bacteria 2859
5 JGI25162J39368_1002393 3300002737 Bacteria 7368
6 JGI25163J39215_1000498 3300002771 Bacteria 11707
7 JGI25164J39214_1000152 3300002772 Bacteria 65144
8 JGI25406J46586_10003544 3300003203 Bacteria 7319
9 rootH2_10019123 3300003320 Bacteria 25137
10 Ga0055538_1000109 3300003751 Bacteria 65144
11 Ga0055539_1000158 3300003752 Bacteria 65144
12 Ga0055533_1000160 3300003756 Bacteria 65144
13 Ga0055525_1000212 3300003759 Bacteria 65144
14 Ga0055541_1000104 3300003841 Bacteria 65144
15 Ga0058692_1000145 3300003856 Bacteria 44977
16 Ga0058692_1000179 3300003856 Bacteria 38966
17 Ga0058692_1000253 3300003856 Bacteria 29276
18 Ga0058692_1000310 3300003856 Bacteria 24410
19 Ga0058692_1002097 3300003856 Bacteria 6881
20 Ga0058692_1005063 3300003856 Bacteria 3801
21 Ga0058692_1007644 3300003856 Bacteria 2850
22 Ga0065703_1019144 3300005272 Bacteria 3817
23 Ga0065704_10000450 3300005289 Bacteria 46008
24 Ga0065704_10000585 3300005289 Bacteria 32775
25 Ga0065704_10001072 3300005289 Bacteria 11040
26 Ga0065704_10002167 3300005289 Bacteria 11665
27 Ga0065704_10005603 3300005289 Bacteria 5939
28 Ga0065704_10083086 3300005289 Bacteria 3495
29 Ga0070676_10005504 3300005328 Bacteria 6745
30 Ga0070670_100010316 3300005331 Bacteria 7972
31 Ga0070666_10023541 3300005335 Bacteria 4009
32 Ga0068868_100052483 3300005338 Bacteria 3210
33 Ga0070668_100010851 3300005347 Bacteria 6778
34 Ga0070668_100021156 3300005347 Bacteria 4918
35 Ga0070668_100039810 3300005347 Bacteria 3595
36 Ga0070675_100003479 3300005354 Bacteria 11943
37 Ga0070675_100022432 3300005354 Bacteria 5045
38 Ga0070671_100035869 3300005355 Bacteria 4110
39 Ga0070673_100066345 3300005364 Bacteria 2882
40 Ga0070688_100003336 3300005365 Bacteria 8231
41 Ga0070688_100015592 3300005365 Bacteria 4329
42 Ga0070659_100005733 3300005366 Bacteria 8942
43 Ga0070659_100080418 3300005366 Bacteria 2602
44 Ga0070713_100003711 3300005436 Bacteria 10111
45 Ga0070705_100022371 3300005440 Bacteria 3378
46 Ga0070694_100006030 3300005444 Bacteria 7353
47 Ga0070708_100015332 3300005445 Bacteria 6326
48 Ga0070708_100042870 3300005445 Bacteria 3975
49 Ga0070663_100025838 3300005455 Bacteria 3969
50 Ga0070662_100001198 3300005457 Bacteria 15942
51 Ga0070662_100007716 3300005457 Bacteria 6983
52 Ga0068867_100027221 3300005459 Bacteria 4108
53 Ga0070706_100000012 3300005467 Bacteria 195040
54 Ga0070706_100026830 3300005467 Bacteria 5299
55 Ga0070706_100089304 3300005467 Bacteria 2857
56 Ga0070707_100000171 3300005468 Bacteria 63131
57 Ga0070707_100018012 3300005468 Bacteria 6644
58 Ga0070707_100025810 3300005468 Bacteria 5577
59 Ga0070707_100037533 3300005468 Bacteria 4625
60 Ga0070707_100091331 3300005468 Bacteria 2948
61 Ga0070698_100005853 3300005471 Bacteria 13438
62 Ga0070698_100006464 3300005471 Bacteria 12714
63 Ga0070698_100062816 3300005471 Bacteria 3746
64 Ga0070699_100055669 3300005518 Bacteria 3424
65 Ga0070699_100072436 3300005518 Bacteria 2997
66 Ga0070679_100174921 3300005530 Bacteria 2119
67 Ga0070684_100047194 3300005535 Bacteria 3732
68 Ga0070697_100004109 3300005536 Bacteria 11151
69 Ga0070697_100014242 3300005536 Bacteria 6249
70 Ga0070697_100055773 3300005536 Bacteria 3213
71 Ga0070697_100107827 3300005536 Bacteria 2317
72 Ga0070696_100035227 3300005546 Bacteria 3445
73 Ga0070665_100001124 3300005548 Bacteria 32893
74 Ga0070665_100022483 3300005548 Bacteria 6347
75 Ga0070665_100024927 3300005548 Bacteria 6028
76 Ga0070704_100031976 3300005549 Bacteria 3544
77 Ga0070704_100075021 3300005549 Bacteria 2469
78 Ga0068857_100000028 3300005577 Bacteria 81820
79 Ga0068851_10002655 3300005834 Bacteria 7876
80 Ga0068863_100003673 3300005841 Bacteria 15154
81 Ga0068858_100014781 3300005842 Bacteria 7344
82 Ga0068860_100026107 3300005843 Bacteria 5633
83 Ga0081455_10001011 3300005937 Bacteria 35586
84 Ga0081455_10007739 3300005937 Bacteria 11270
85 Ga0081455_10008751 3300005937 Bacteria 10478
86 Ga0081455_10012591 3300005937 Bacteria 8431
87 Ga0081540_1000368 3300005983 Bacteria 45151
88 Ga0081539_10001203 3300005985 Bacteria 46667
89 Ga0081539_10001276 3300005985 Bacteria 44329
90 Ga0081539_10012531 3300005985 Bacteria 6518
91 Ga0070717_10012684 3300006028 Bacteria 6432
92 Ga0075364_10006318 3300006051 Bacteria 6962
93 Ga0075364_10033505 3300006051 Bacteria 3309
94 Ga0097621_100005446 3300006237 Bacteria 8965
95 Ga0079104_1000254 3300006946 Bacteria 71140
96 Ga0079104_1000335 3300006946 Bacteria 57496
97 Ga0079104_1000356 3300006946 Bacteria 55363
98 Ga0079104_1000694 3300006946 Bacteria 30639
99 Ga0079104_1001489 3300006946 Bacteria 15601
100 Ga0079104_1002151 3300006946 Bacteria 11168
101 Ga0079104_1003593 3300006946 Bacteria 7111
102 Ga0079104_1004611 3300006946 Bacteria 5808
103 Ga0079104_1011435 3300006946 Bacteria 2853
104 Ga0105251_10000386 3300009011 Bacteria 43038
105 Ga0105251_10000533 3300009011 Bacteria 35947
106 Ga0105251_10001068 3300009011 Bacteria 24007
107 Ga0105251_10002401 3300009011 Bacteria 14789
108 Ga0105251_10006416 3300009011 Bacteria 7495
109 Ga0105251_10015539 3300009011 Bacteria 4155
110 Ga0105251_10021855 3300009011 Bacteria 3332
111 Ga0105251_10022048 3300009011 Bacteria 3315
112 Ga0105244_10000103 3300009036 Bacteria 87849
113 Ga0105244_10000516 3300009036 Bacteria 34499
114 Ga0105244_10000539 3300009036 Bacteria 33792
115 Ga0105244_10000551 3300009036 Bacteria 33478
116 Ga0105244_10000566 3300009036 Bacteria 33080
117 Ga0105244_10000844 3300009036 Bacteria 25934
118 Ga0105244_10005549 3300009036 Bacteria 8359
119 Ga0105244_10005895 3300009036 Bacteria 8042
120 Ga0105244_10010070 3300009036 Bacteria 5755
121 Ga0105244_10011769 3300009036 Bacteria 5219
122 Ga0105250_10000205 3300009092 Bacteria 49631
123 Ga0105250_10000217 3300009092 Bacteria 47880
124 Ga0105250_10002873 3300009092 Bacteria 8415
125 Ga0105240_10058281 3300009093 Bacteria 4821
126 Ga0114129_10083246 3300009147 Bacteria 4445
127 Ga0114129_10121920 3300009147 Bacteria 3587
128 Ga0105243_10000658 3300009148 Bacteria 34192
129 Ga0105243_10005793 3300009148 Bacteria 9592
130 Ga0105241_10000010 3300009174 Bacteria 253836
131 Ga0105239_10071650 3300010375 Bacteria 3808
132 Ga0105246_10008080 3300011119 Bacteria 6458
133 Ga0105246_10013548 3300011119 Bacteria 5113
134 Ga0157373_10000114 3300013100 Bacteria 63657
135 Ga0157373_10012149 3300013100 Bacteria 6331
136 Ga0157373_10013005 3300013100 Bacteria 6109
137 Ga0157373_10058475 3300013100 Bacteria 2733
138 Ga0157371_10000102 3300013102 Bacteria 129057
139 Ga0157371_10000554 3300013102 Bacteria 44435
140 Ga0157371_10000577 3300013102 Bacteria 43493
141 Ga0157371_10000835 3300013102 Bacteria 35218
142 Ga0157371_10007860 3300013102 Bacteria 8561
143 Ga0157371_10028386 3300013102 Bacteria 4052
144 Ga0157370_10000356 3300013104 Bacteria 58148
145 Ga0157370_10000444 3300013104 Bacteria 51739
146 Ga0157370_10001839 3300013104 Bacteria 26159
147 Ga0157369_10000452 3300013105 Bacteria 54418
148 Ga0157369_10018575 3300013105 Bacteria 7794
149 Ga0157374_10020242 3300013296 Bacteria 5901
150 Ga0157374_10051179 3300013296 Bacteria 3843
151 Ga0157378_10016372 3300013297 Bacteria 6492
152 Ga0163162_10017090 3300013306 Bacteria 7097
153 Ga0163162_10088738 3300013306 Bacteria 3171
154 Ga0157372_10000094 3300013307 Bacteria 91570
155 Ga0157372_10016801 3300013307 Bacteria 7855
156 Ga0157372_10115647 3300013307 Bacteria 3075
157 Ga0157375_10005291 3300013308 Bacteria 11208
158 Ga0182008_10001384 3300014497 Bacteria 16416
159 Ga0157379_10012858 3300014968 Bacteria 7320
160 Ga0182006_1000009 3300015261 Bacteria 438243
161 Ga0182006_1016027 3300015261 Bacteria 3202
162 Ga0182007_10008670 3300015262 Bacteria 4161
163 Ga0183366_1009 3300015679 Bacteria 83233
164 Ga0183370_1009 3300015680 Bacteria 83369
165 Ga0183369_1024 3300015685 Bacteria 83369
166 Ga0183368_1012 3300015687 Bacteria 83369
167 Ga0163161_10000006 3300017792 Bacteria 302708
168 Ga0213876_10000106 3300021384 Bacteria 92733
169 Ga0209760_100370 3300025207 Bacteria 11942
170 Ga0209784_100064 3300025224 Bacteria 158058
171 Ga0209566_100079 3300025225 Bacteria 158058
172 Ga0209674_100194 3300025226 Bacteria 65330
173 Ga0209563_100152 3300025230 Bacteria 65330
174 Ga0207427_100181 3300025231 Bacteria 65330
175 Ga0209437_100092 3300025233 Bacteria 240044
176 Ga0209437_100149 3300025233 Bacteria 158058
177 Ga0209677_100148 3300025253 Bacteria 65330
178 Ga0209129_1000179 3300025258 Bacteria 91892
179 Ga0209233_1003969 3300025261 Bacteria 5125
180 Ga0209050_1001319 3300025298 Bacteria 27765
181 Ga0207697_10000080 3300025315 Bacteria 42127
182 Ga0207697_10000565 3300025315 Bacteria 21021
183 Ga0207697_10001605 3300025315 Bacteria 12214
184 Ga0207697_10001735 3300025315 Bacteria 11709
185 Ga0207697_10001989 3300025315 Bacteria 10851
186 Ga0207656_10002534 3300025321 Bacteria 6175
187 Ga0207696_1000046 3300025711 Bacteria 291327
188 Ga0207696_1000331 3300025711 Bacteria 49639
189 Ga0207696_1000347 3300025711 Bacteria 47888
190 Ga0207696_1000404 3300025711 Bacteria 40294
191 Ga0207696_1000414 3300025711 Bacteria 39676
192 Ga0207696_1000434 3300025711 Bacteria 37870
193 Ga0207696_1000534 3300025711 Bacteria 30992
194 Ga0207696_1000590 3300025711 Bacteria 27786
195 Ga0207696_1011496 3300025711 Bacteria 3183
196 Ga0207655_1000111 3300025728 Bacteria 170772
197 Ga0207655_1000170 3300025728 Bacteria 119267
198 Ga0207655_1000208 3300025728 Bacteria 102775
199 Ga0207655_1000245 3300025728 Bacteria 87921
200 Ga0207655_1000393 3300025728 Bacteria 60847
201 Ga0207655_1000547 3300025728 Bacteria 47308
202 Ga0207655_1000583 3300025728 Bacteria 45119
203 Ga0207655_1001676 3300025728 Bacteria 19510
204 Ga0207655_1002339 3300025728 Bacteria 15522
205 Ga0207655_1003418 3300025728 Bacteria 11839
206 Ga0207655_1004465 3300025728 Bacteria 9917
207 Ga0207655_1004584 3300025728 Bacteria 9732
208 Ga0207655_1009735 3300025728 Bacteria 5927
209 Ga0207655_1015135 3300025728 Bacteria 4309
210 Ga0207713_1000045 3300025735 Bacteria 235202
211 Ga0207713_1000056 3300025735 Bacteria 217615
212 Ga0207713_1000075 3300025735 Bacteria 179242
213 Ga0207713_1000334 3300025735 Bacteria 52545
214 Ga0207713_1000340 3300025735 Bacteria 51524
215 Ga0207713_1000368 3300025735 Bacteria 49034
216 Ga0207713_1000613 3300025735 Bacteria 35114
217 Ga0207713_1005588 3300025735 Bacteria 7828
218 Ga0207713_1005810 3300025735 Bacteria 7635
219 Ga0207713_1012005 3300025735 Bacteria 4663
220 Ga0207710_10000024 3300025900 Bacteria 319633
221 Ga0207685_10013631 3300025905 Bacteria 2520
222 Ga0207699_10042974 3300025906 Bacteria 2622
223 Ga0207645_10001266 3300025907 Bacteria 20804
224 Ga0207684_10000028 3300025910 Bacteria 306450
225 Ga0207654_10000010 3300025911 Bacteria 304367
226 Ga0207693_10022979 3300025915 Bacteria 4951
227 Ga0207663_10049848 3300025916 Bacteria 2600
228 Ga0207652_10144812 3300025921 Bacteria 2126
229 Ga0207646_10000750 3300025922 Bacteria 42120
230 Ga0207646_10005961 3300025922 Bacteria 12710
231 Ga0207659_10054359 3300025926 Bacteria 2859
232 Ga0207700_10041392 3300025928 Bacteria 3370
233 Ga0207700_10045799 3300025928 Bacteria 3231
234 Ga0207700_10062244 3300025928 Bacteria 2833
235 Ga0207644_10019694 3300025931 Bacteria 4581
236 Ga0207690_10054702 3300025932 Bacteria 2685
237 Ga0207706_10000188 3300025933 Bacteria 68890
238 Ga0207706_10006159 3300025933 Bacteria 11140
239 Ga0207706_10022047 3300025933 Bacteria 5717
240 Ga0207709_10000428 3300025935 Bacteria 40164
241 Ga0207709_10008436 3300025935 Bacteria 5699
242 Ga0207691_10013604 3300025940 Bacteria 7778
243 Ga0207689_10037124 3300025942 Bacteria 4043
244 Ga0207668_10018622 3300025972 Bacteria 4374
245 Ga0207658_10017639 3300025986 Bacteria 4922
246 Ga0207678_10033857 3300026067 Bacteria 4450
247 Ga0207648_10014539 3300026089 Bacteria 7268
248 Ga0207674_10000367 3300026116 Bacteria 58646
249 Ga0207675_100019738 3300026118 Bacteria 6291
250 Ga0207675_100032043 3300026118 Bacteria 4896
251 Ga0207683_10017568 3300026121 Bacteria 6099
252 Ga0207683_10040438 3300026121 Bacteria 4068
253 Ga0209281_1000139 3300027111 Bacteria 179588
254 Ga0209281_1000285 3300027111 Bacteria 95379
255 Ga0209281_1000305 3300027111 Bacteria 87790
256 Ga0209281_1000312 3300027111 Bacteria 86565
257 Ga0209281_1000326 3300027111 Bacteria 83038
258 Ga0209281_1000341 3300027111 Bacteria 79173
259 Ga0209281_1000497 3300027111 Bacteria 53471
260 Ga0209281_1000794 3300027111 Bacteria 29597
261 Ga0209281_1000867 3300027111 Bacteria 26345
262 Ga0209281_1001035 3300027111 Bacteria 21254
263 Ga0209281_1002561 3300027111 Bacteria 7074
264 Ga0209371_1000063 3300027312 Bacteria 218863
265 Ga0209371_1000068 3300027312 Bacteria 209008
266 Ga0209371_1000071 3300027312 Bacteria 200748
267 Ga0209371_1000201 3300027312 Bacteria 86471
268 Ga0209371_1000210 3300027312 Bacteria 81841
269 Ga0209371_1000299 3300027312 Bacteria 55390
270 Ga0209371_1000323 3300027312 Bacteria 52340
271 Ga0209371_1000331 3300027312 Bacteria 51486
272 Ga0209371_1000429 3300027312 Bacteria 42773
273 Ga0209371_1000617 3300027312 Bacteria 31694
274 Ga0209371_1001510 3300027312 Bacteria 15464
275 Ga0209371_1001732 3300027312 Bacteria 13756
276 Ga0209371_1002324 3300027312 Bacteria 10815
277 Ga0209371_1003334 3300027312 Bacteria 7897
278 Ga0209371_1003829 3300027312 Bacteria 6981
279 Ga0209371_1008231 3300027312 Bacteria 3502
280 Ga0268266_10000295 3300028379 Bacteria 81170
281 Ga0268266_10011374 3300028379 Bacteria 7740
282 Ga0268266_10026318 3300028379 Bacteria 4949
283 Ga0268264_10081321 3300028381 Bacteria 2768
284 Ga0268256_1000060 3300030500 Bacteria 218807
285 Ga0268256_1000064 3300030500 Bacteria 210320
286 Ga0268256_1000070 3300030500 Bacteria 189040
287 Ga0268256_1000166 3300030500 Bacteria 82045
288 Ga0268256_1000284 3300030500 Bacteria 52338
289 Ga0268256_1000386 3300030500 Bacteria 40664
290 Ga0268256_1000720 3300030500 Bacteria 24458
291 Ga0268256_1000769 3300030500 Bacteria 23396
292 Ga0268256_1000995 3300030500 Bacteria 19246
293 Ga0268256_1001510 3300030500 Bacteria 13751
294 Ga0268256_1002953 3300030500 Bacteria 8086
295 Ga0268256_1003033 3300030500 Bacteria 7897
296 Ga0268256_1003255 3300030500 Bacteria 7480
297 Ga0268256_1008520 3300030500 Bacteria 3502
298 Ga0268256_1010641 3300030500 Bacteria 2964
299 Ga0373947_0047516 3300035725 Bacteria 2572
300 Ga0395899_0053566 3300037312 Bacteria 2987
301 Ga0395900_0004913 3300037418 Bacteria 14075
302 Ga0395900_0191703 3300037418 Bacteria 2073
303 Ga0395901_0103143 3300038443 Bacteria 2993
304 Ga0436365_0083358 3300039437 Bacteria 92482
305 Ga0439438_000014 3300041405 Bacteria 130876
306 Ga0439438_001432 3300041405 Bacteria 10525
307 Ga0439447_001628 3300041407 Bacteria 8233
308 Ga0439447_002527 3300041407 Bacteria 6651
309 Ga0439466_0000008 3300041411 Bacteria 246721
310 Ga0439432_003818 3300042006 Bacteria 5559
311 Ga0439432_012497 3300042006 Bacteria 2902
312 Ga0439452_000010 3300042010 Bacteria 459139
313 Ga0439452_000023 3300042010 Bacteria 232427
314 Ga0439452_000067 3300042010 Bacteria 91480
315 Ga0439452_000092 3300042010 Bacteria 77736
316 Ga0439452_000103 3300042010 Bacteria 70370
317 Ga0439452_000160 3300042010 Bacteria 49961
318 Ga0450907_000030 3300042146 Bacteria 68375
319 Ga0439464_0002326 3300042439 Bacteria 4654
320 Ga0439464_0002690 3300042439 Bacteria 4410
321 Ga0451577_0000018 3300042876 Bacteria 516495
322 Ga0451577_0000193 3300042876 Bacteria 128594
323 Ga0451577_0001262 3300042876 Bacteria 34982
324 Ga0451577_0003489 3300042876 Bacteria 17483
325 Ga0466981_0000022 3300044669 Bacteria 83073
326 Ga0453684_0000090 3300044712 Bacteria 391614
327 Ga0453684_0000166 3300044712 Bacteria 294291
328 Ga0453684_0006193 3300044712 Bacteria 22946
329 Ga0453684_0084749 3300044712 Bacteria 3940
330 Ga0453684_0091396 3300044712 Bacteria 3757
331 Ga0451576_0001179 3300045051 Bacteria 46858
332 Ga0495627_001403 3300046453 Bacteria 14254
333 Ga0495591_000031 3300046458 Bacteria 177747
334 Ga0495591_000148 3300046458 Bacteria 74574
335 Ga0495591_002347 3300046458 Bacteria 10645
336 Ga0495591_003527 3300046458 Bacteria 8030
337 Ga0495650_0000199 3300046471 Bacteria 130411
338 Ga0495650_0000360 3300046471 Bacteria 80145
339 Ga0495650_0000418 3300046471 Bacteria 69242
340 Ga0495605_0010666 3300046474 Bacteria 5135
341 Ga0495584_0005890 3300046491 Bacteria 6460
342 Ga0495596_0003622 3300046500 Bacteria 7763
343 Ga0495607_0002720 3300046501 Bacteria 14105
344 Ga0495606_0000541 3300046507 Bacteria 60650
345 Ga0495620_0025189 3300046515 Bacteria 2818
346 Ga0495644_0008348 3300046523 Bacteria 3989
347 Ga0495648_0002122 3300046524 Bacteria 18682
348 Ga0495648_0015539 3300046524 Bacteria 5525
349 Ga0495654_0000040 3300046530 Bacteria 184580
350 Ga0495654_0000519 3300046530 Bacteria 31360
351 Ga0495654_0001042 3300046530 Bacteria 20292
352 Ga0495597_0004190 3300046542 Bacteria 7993
353 Ga0495625_0040316 3300046660 Bacteria 3407
354 Ga0495588_0003426 3300046674 Bacteria 6894
355 Ga0495669_0036697 3300046684 Bacteria 2167
356 Ga0495671_0004850 3300046692 Bacteria 7952
357 Ga0495649_0009979 3300046694 Bacteria 5613
358 Ga0495649_0013129 3300046694 Bacteria 4787
359 Ga0495589_0000274 3300046794 Bacteria 42043
360 Ga0495589_0004351 3300046794 Bacteria 7554
361 Ga0495660_0000045 3300046810 Bacteria 150303
362 Ga0495660_0000134 3300046810 Bacteria 80417
363 Ga0495672_0000083 3300047320 Bacteria 158118
364 Ga0495672_0000224 3300047320 Bacteria 80413
365 Ga0495672_0000225 3300047320 Bacteria 80331
366 Ga0495679_000178 3300047446 Bacteria 57765
367 Ga0495679_002253 3300047446 Bacteria 9983
368 Ga0495679_004186 3300047446 Bacteria 6731
369 Ga0495673_0000216 3300047469 Bacteria 85578
370 Ga0495673_0000622 3300047469 Bacteria 34841
371 Ga0496100_0013822 3300048903 Bacteria 4670
372 Ga0496100_0033456 3300048903 Bacteria 3217
373 Ga0496100_0044670 3300048903 Bacteria 2839
374 Ga0496101_0000119 3300048904 Bacteria 77119
375 Ga0496101_0027293 3300048904 Bacteria 3976
376 Ga0496101_0036427 3300048904 Bacteria 3485
377 Ga0496102_0012173 3300048905 Bacteria 7437
378 Ga0496102_0109050 3300048905 Bacteria 2579
379 Ga0496103_0047363 3300048906 Bacteria 2657
380 Ga0496104_0002540 3300048907 Bacteria 15716
381 Ga0496104_0043728 3300048907 Bacteria 4207
382 Ga0496104_0135936 3300048907 Bacteria 2362
383 Ga0496105_0003574 3300048908 Bacteria 11535
384 Ga0496105_0033590 3300048908 Bacteria 4214
385 Ga0496105_0087023 3300048908 Bacteria 2582
386 Ga0496106_0078425 3300048909 Bacteria 2535
387 Ga0496108_0223940 3300048911 Unclassified 1634
388 Ga0496111_0092232 3300048914 Bacteria 2220
389 Ga0496112_0028605 3300048915 Bacteria 5381
390 Ga0496112_0035677 3300048915 Bacteria 4847
391 Ga0496112_0090606 3300048915 Bacteria 3027
392 Ga0496112_0110272 3300048915 Bacteria 2722
393 Ga0496112_0144760 3300048915 Bacteria 2345
394 Ga0496115_0001677 3300048918 Bacteria 15930
395 Ga0496116_0000058 3300048919 Bacteria 279767
396 Ga0496116_0000282 3300048919 Bacteria 87438
397 Ga0496116_0000521 3300048919 Bacteria 51818
398 Ga0496116_0000739 3300048919 Bacteria 41626
399 Ga0496116_0001084 3300048919 Bacteria 32785
400 Ga0496116_0007283 3300048919 Bacteria 9854
401 Ga0496116_0020140 3300048919 Bacteria 5075
402 Ga0496116_0020922 3300048919 Bacteria 4950
403 Ga0496117_0000450 3300048920 Bacteria 68428
404 Ga0496117_0000470 3300048920 Bacteria 66974
405 Ga0496117_0000830 3300048920 Bacteria 47853
406 Ga0496117_0001133 3300048920 Bacteria 40208
407 Ga0496117_0001270 3300048920 Bacteria 37430
408 Ga0496117_0006340 3300048920 Bacteria 12029
409 Ga0496117_0011036 3300048920 Bacteria 8135
410 Ga0496117_0018381 3300048920 Bacteria 5790
411 Ga0496118_0000490 3300048921 Bacteria 65592
412 Ga0496118_0002159 3300048921 Bacteria 27410
413 Ga0496118_0002301 3300048921 Bacteria 25935
414 Ga0496118_0004618 3300048921 Bacteria 16173
415 Ga0496118_0010354 3300048921 Bacteria 9239
416 Ga0496118_0010600 3300048921 Bacteria 9103
417 Ga0496118_0023219 3300048921 Bacteria 5392
418 Ga0496119_0000170 3300048922 Bacteria 91584
419 Ga0496119_0000219 3300048922 Bacteria 81203
420 Ga0496119_0000490 3300048922 Bacteria 53979
421 Ga0496119_0000680 3300048922 Bacteria 45409
422 Ga0496119_0000706 3300048922 Bacteria 44781
423 Ga0496119_0005425 3300048922 Bacteria 12228
424 Ga0496119_0006097 3300048922 Bacteria 11294
425 Ga0496119_0006499 3300048922 Bacteria 10795
426 Ga0496119_0006577 3300048922 Bacteria 10713
427 Ga0496119_0008481 3300048922 Bacteria 9019
428 Ga0496119_0009261 3300048922 Bacteria 8484
429 Ga0496120_0000108 3300048923 Bacteria 138566
430 Ga0496120_0000279 3300048923 Bacteria 85805
431 Ga0496120_0000301 3300048923 Bacteria 82406
432 Ga0496120_0000476 3300048923 Bacteria 62924
433 Ga0496120_0000813 3300048923 Bacteria 44710
434 Ga0496120_0001708 3300048923 Bacteria 25110
435 Ga0496120_0002528 3300048923 Bacteria 18270
436 Ga0496120_0003918 3300048923 Bacteria 12988
437 Ga0496120_0004377 3300048923 Bacteria 11905
438 Ga0496121_0000074 3300048924 Bacteria 243022
439 Ga0496121_0004066 3300048924 Bacteria 20091
440 Ga0496121_0007430 3300048924 Bacteria 13242
441 Ga0496121_0014648 3300048924 Bacteria 8292
442 Ga0496121_0021651 3300048924 Bacteria 6286
443 Ga0496121_0031269 3300048924 Bacteria 4865
444 Ga0496121_0036728 3300048924 Bacteria 4361
445 Ga0496122_0000467 3300048925 Bacteria 84380
446 Ga0496122_0000607 3300048925 Bacteria 73586
447 Ga0496122_0001119 3300048925 Bacteria 46163
448 Ga0496122_0001849 3300048925 Bacteria 32269
449 Ga0496122_0002360 3300048925 Bacteria 27157
450 Ga0496122_0003475 3300048925 Bacteria 20727
451 Ga0496123_0000322 3300048926 Bacteria 91507
452 Ga0496123_0000370 3300048926 Bacteria 84376
453 Ga0496123_0000451 3300048926 Bacteria 73603
454 Ga0496123_0000918 3300048926 Bacteria 46163
455 Ga0496123_0002061 3300048926 Bacteria 25933
456 Ga0496123_0002686 3300048926 Bacteria 21408
457 Ga0496123_0004991 3300048926 Bacteria 13591
458 Ga0496123_0011336 3300048926 Bacteria 7741
459 Ga0496123_0039168 3300048926 Bacteria 3318
460 Ga0496123_0076191 3300048926 Bacteria 2066
461 Ga0496124_0000304 3300048927 Bacteria 90806
462 Ga0496124_0000514 3300048927 Bacteria 66747
463 Ga0496124_0000583 3300048927 Bacteria 61571
464 Ga0496124_0002602 3300048927 Bacteria 23337
465 Ga0496124_0009646 3300048927 Bacteria 9888
466 Ga0496124_0019622 3300048927 Bacteria 6282
467 Ga0496124_0020453 3300048927 Bacteria 6112
468 Ga0496124_0036725 3300048927 Bacteria 4269
469 Ga0496125_0000534 3300048928 Bacteria 65468
470 Ga0496125_0000563 3300048928 Bacteria 63847
471 Ga0496125_0001797 3300048928 Bacteria 29634
472 Ga0496125_0002298 3300048928 Bacteria 25235
473 Ga0496125_0002977 3300048928 Bacteria 21285
474 Ga0496125_0024605 3300048928 Bacteria 5532
475 Ga0496126_0000648 3300048929 Bacteria 64533
476 Ga0496126_0009913 3300048929 Bacteria 10064
477 Ga0496126_0012282 3300048929 Bacteria 8788
478 Ga0496126_0015373 3300048929 Bacteria 7699
479 Ga0495678_000337 3300049459 Bacteria 49208
480 Ga0495682_0000139 3300049460 Bacteria 62814
481 nmdc:mga00v17_1593_c1 3300050491 Bacteria 11847
482 Ga0500621_000018 3300053126 Bacteria 80374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0191703 Ga0395900_0191703_255_2054 474
2 3300048909 Ga0496106_0078425 Ga0496106_0078425_622_2517 474
3 3300048914 Ga0496111_0092232 Ga0496111_0092232_306_2201 474
4 3300048911 Ga0496108_0223940 Ga0496108_0223940_17_1594 475
5 3300013296 Ga0157374_10051179 Ga0157374_100511791 483
6 3300047446 Ga0495679_004186 Ga0495679_004186_5104_6702 531
7 3300048926 Ga0496123_0076191 Ga0496123_0076191_438_2036 531
8 3300005289 Ga0065704_10083086 Ga0065704_100830864 536
9 3300048929 Ga0496126_0009913 Ga0496126_0009913_8382_10037 550
10 3300005985 Ga0081539_10001203 Ga0081539_1000120345 567
11 3300005331 Ga0070670_100010316 Ga0070670_1000103162 570
12 3300005335 Ga0070666_10023541 Ga0070666_100235412 570
13 3300028379 Ga0268266_10026318 Ga0268266_100263182 570
14 3300026121 Ga0207683_10017568 Ga0207683_100175685 572
15 3300005548 Ga0070665_100022483 Ga0070665_1000224832 575
16 3300048915 Ga0496112_0035677 Ga0496112_0035677_1868_3769 575
17 3300025315 Ga0207697_10001735 Ga0207697_100017353 578
18 3300048915 Ga0496112_0090606 Ga0496112_0090606_1106_2932 582
19 3300005985 Ga0081539_10012531 Ga0081539_100125312 583
20 3300025905 Ga0207685_10013631 Ga0207685_100136312 583
21 3300025915 Ga0207693_10022979 Ga0207693_100229794 583
22 3300025928 Ga0207700_10062244 Ga0207700_100622442 583
23 3300025933 Ga0207706_10022047 Ga0207706_100220472 584
24 3300005436 Ga0070713_100003711 Ga0070713_1000037113 585
25 3300025928 Ga0207700_10045799 Ga0207700_100457991 585
26 3300005468 Ga0070707_100000171 Ga0070707_10000017163 586
27 3300006028 Ga0070717_10012684 Ga0070717_100126842 586
28 3300025922 Ga0207646_10005961 Ga0207646_1000596111 586
29 3300005530 Ga0070679_100174921 Ga0070679_1001749211 588
30 3300005546 Ga0070696_100035227 Ga0070696_1000352273 588
31 3300025921 Ga0207652_10144812 Ga0207652_101448121 588
32 3300005347 Ga0070668_100039810 Ga0070668_1000398102 589
33 3300005365 Ga0070688_100003336 Ga0070688_1000033366 589
34 3300005459 Ga0068867_100027221 Ga0068867_1000272214 589
35 3300025940 Ga0207691_10013604 Ga0207691_100136045 589
36 3300026089 Ga0207648_10014539 Ga0207648_100145395 589
37 3300028379 Ga0268266_10011374 Ga0268266_100113745 589
38 3300002126 JGI24035J26624_1000858 JGI24035J26624_10008582 590
39 3300005328 Ga0070676_10005504 Ga0070676_100055045 590
40 3300005347 Ga0070668_100021156 Ga0070668_1000211564 590
41 3300005354 Ga0070675_100003479 Ga0070675_1000034795 590
42 3300005354 Ga0070675_100022432 Ga0070675_1000224322 590
43 3300005365 Ga0070688_100015592 Ga0070688_1000155923 590
44 3300005366 Ga0070659_100005733 Ga0070659_1000057335 590
45 3300005440 Ga0070705_100022371 Ga0070705_1000223712 590
46 3300005444 Ga0070694_100006030 Ga0070694_1000060302 590
47 3300005445 Ga0070708_100015332 Ga0070708_1000153326 590
48 3300005445 Ga0070708_100042870 Ga0070708_1000428704 590
49 3300005455 Ga0070663_100025838 Ga0070663_1000258382 590
50 3300005457 Ga0070662_100007716 Ga0070662_1000077165 590
51 3300005467 Ga0070706_100000012 Ga0070706_10000001287 590
52 3300005467 Ga0070706_100026830 Ga0070706_1000268304 590
53 3300005467 Ga0070706_100089304 Ga0070706_1000893042 590
54 3300005468 Ga0070707_100018012 Ga0070707_1000180127 590
55 3300005468 Ga0070707_100025810 Ga0070707_1000258105 590
56 3300005468 Ga0070707_100037533 Ga0070707_1000375332 590
57 3300005468 Ga0070707_100091331 Ga0070707_1000913312 590
58 3300005471 Ga0070698_100005853 Ga0070698_1000058533 590
59 3300005471 Ga0070698_100062816 Ga0070698_1000628164 590
60 3300005518 Ga0070699_100055669 Ga0070699_1000556692 590
61 3300005518 Ga0070699_100072436 Ga0070699_1000724362 590
62 3300005535 Ga0070684_100047194 Ga0070684_1000471941 590
63 3300005536 Ga0070697_100004109 Ga0070697_1000041092 590
64 3300005536 Ga0070697_100014242 Ga0070697_1000142426 590
65 3300005536 Ga0070697_100055773 Ga0070697_1000557734 590
66 3300005536 Ga0070697_100107827 Ga0070697_1001078272 590
67 3300005549 Ga0070704_100031976 Ga0070704_1000319762 590
68 3300005841 Ga0068863_100003673 Ga0068863_10000367313 590
69 3300005842 Ga0068858_100014781 Ga0068858_1000147813 590
70 3300005843 Ga0068860_100026107 Ga0068860_1000261073 590
71 3300005937 Ga0081455_10012591 Ga0081455_100125917 590
72 3300005983 Ga0081540_1000368 Ga0081540_100036846 590
73 3300006237 Ga0097621_100005446 Ga0097621_1000054467 590
74 3300009147 Ga0114129_10083246 Ga0114129_100832461 590
75 3300010375 Ga0105239_10071650 Ga0105239_100716502 590
76 3300013297 Ga0157378_10016372 Ga0157378_100163724 590
77 3300013308 Ga0157375_10005291 Ga0157375_100052918 590
78 3300014968 Ga0157379_10012858 Ga0157379_100128586 590
79 3300025315 Ga0207697_10000080 Ga0207697_100000809 590
80 3300025315 Ga0207697_10000565 Ga0207697_1000056513 590
81 3300025910 Ga0207684_10000028 Ga0207684_10000028214 590
82 3300025916 Ga0207663_10049848 Ga0207663_100498482 590
83 3300025922 Ga0207646_10000750 Ga0207646_1000075040 590
84 3300025933 Ga0207706_10000188 Ga0207706_1000018858 590
85 3300025942 Ga0207689_10037124 Ga0207689_100371242 590
86 3300025972 Ga0207668_10018622 Ga0207668_100186222 590
87 3300026067 Ga0207678_10033857 Ga0207678_100338572 590
88 3300026118 Ga0207675_100019738 Ga0207675_1000197382 590
89 3300026118 Ga0207675_100032043 Ga0207675_1000320434 590
90 3300028381 Ga0268264_10081321 Ga0268264_100813212 590
91 3300048903 Ga0496100_0033456 Ga0496100_0033456_957_2813 590
92 3300048905 Ga0496102_0109050 Ga0496102_0109050_419_2275 590
93 3300048907 Ga0496104_0043728 Ga0496104_0043728_2263_4119 590
94 3300048918 Ga0496115_0001677 Ga0496115_0001677_8528_10384 590
95 3300003203 JGI25406J46586_10003544 JGI25406J46586_1000354410 591
96 3300005338 Ga0068868_100052483 Ga0068868_1000524832 591
97 3300005355 Ga0070671_100035869 Ga0070671_1000358692 591
98 3300005364 Ga0070673_100066345 Ga0070673_1000663452 591
99 3300005549 Ga0070704_100075021 Ga0070704_1000750211 591
100 3300005985 Ga0081539_10001276 Ga0081539_1000127646 591
101 3300009011 Ga0105251_10015539 Ga0105251_100155393 591
102 3300025315 Ga0207697_10001605 Ga0207697_100016052 591
103 3300025906 Ga0207699_10042974 Ga0207699_100429742 591
104 3300025907 Ga0207645_10001266 Ga0207645_1000126617 591
105 3300025926 Ga0207659_10054359 Ga0207659_100543592 591
106 3300025928 Ga0207700_10041392 Ga0207700_100413922 591
107 3300025931 Ga0207644_10019694 Ga0207644_100196942 591
108 3300025986 Ga0207658_10017639 Ga0207658_100176393 591
109 3300026121 Ga0207683_10040438 Ga0207683_100404382 591
110 3300035725 Ga0373947_0047516 Ga0373947_0047516_76_1908 591
111 3300037312 Ga0395899_0053566 Ga0395899_0053566_989_2836 591
112 3300037418 Ga0395900_0004913 Ga0395900_0004913_3539_5386 591
113 3300046684 Ga0495669_0036697 Ga0495669_0036697_212_2137 591
114 3300048903 Ga0496100_0044670 Ga0496100_0044670_304_2229 591
115 3300048904 Ga0496101_0027293 Ga0496101_0027293_1156_3081 591
116 3300048907 Ga0496104_0135936 Ga0496104_0135936_149_2074 591
117 3300048915 Ga0496112_0028605 Ga0496112_0028605_17_1942 591
118 3300048915 Ga0496112_0144760 Ga0496112_0144760_135_2045 591
119 3300005937 Ga0081455_10007739 Ga0081455_100077393 592
120 3300013296 Ga0157374_10020242 Ga0157374_100202422 592
121 3300025315 Ga0207697_10001989 Ga0207697_100019893 592
122 3300042876 Ga0451577_0003489 Ga0451577_0003489_7496_9307 592
123 3300044712 Ga0453684_0084749 Ga0453684_0084749_1181_2992 592
124 3300048915 Ga0496112_0110272 Ga0496112_0110272_661_2607 593
125 iso_pu_bacteria 2902330777 2902335042 593
126 3300005471 Ga0070698_100006464 Ga0070698_1000064647 594
127 3300005937 Ga0081455_10001011 Ga0081455_100010116 594
128 3300044712 Ga0453684_0091396 Ga0453684_0091396_118_1947 594
129 iso_pu_bacteria 2595698237 2596374988 594
130 iso_pu_bacteria 2842698319 2842700430 594
131 iso_pu_bacteria 2889306138 2889311889 594
132 iso_pu_bacteria 2902405164 2902411383 594
133 iso_pu_bacteria 2928125067 2928129911 594
134 iso_pu_bacteria 3003665799 3003667325 595
135 3300042876 Ga0451577_0000193 Ga0451577_0000193_92113_93912 596
136 3300042876 Ga0451577_0001262 Ga0451577_0001262_24126_25982 596
137 3300044712 Ga0453684_0000090 Ga0453684_0000090_53081_54937 596
138 3300044712 Ga0453684_0006193 Ga0453684_0006193_20431_22230 596
139 3300045051 Ga0451576_0001179 Ga0451576_0001179_29768_31624 596
140 iso_pu_bacteria 2545555834 2545677610 596
141 iso_pu_bacteria 2738541281 2738743151 596
142 iso_pu_bacteria 2738543032 2739352768 596
143 iso_pu_bacteria 2829745981 2829746408 596
144 iso_pu_bacteria 2861691609 2861692983 596
145 iso_pu_bacteria 641522639 641640347 596
146 iso_pu_bacteria 643348564 643597784 596
147 3300025298 Ga0209050_1001319 Ga0209050_10013199 597
148 3300005937 Ga0081455_10008751 Ga0081455_100087514 598
149 3300038443 Ga0395901_0103143 Ga0395901_0103143_362_2242 598
150 3300048920 Ga0496117_0018381 Ga0496117_0018381_3810_5612 598
151 3300048922 Ga0496119_0006499 Ga0496119_0006499_5940_7742 598
152 3300048922 Ga0496119_0006577 Ga0496119_0006577_5858_7660 598
153 3300048923 Ga0496120_0001708 Ga0496120_0001708_23133_24935 598
154 3300048927 Ga0496124_0000304 Ga0496124_0000304_70645_72447 598
155 iso_pu_bacteria 2791355275 2793403532 598
156 iso_pu_bacteria 2939568625 2939572919 598
157 iso_pu_bacteria 2939642701 2939646895 598
158 iso_pu_bacteria 8055092621 8055093508 598
159 3300013306 Ga0163162_10017090 Ga0163162_100170904 599
160 iso_pu_bacteria 2791354903 2791923175 599
161 iso_pu_bacteria 8057304971 8057305390 599
162 3300009147 Ga0114129_10121920 Ga0114129_101219202 600
163 3300003856 Ga0058692_1005063 Ga0058692_10050632 602
164 3300005289 Ga0065704_10002167 Ga0065704_100021678 602
165 3300005366 Ga0070659_100080418 Ga0070659_1000804182 602
166 3300006051 Ga0075364_10006318 Ga0075364_100063183 602
167 3300006946 Ga0079104_1002151 Ga0079104_10021515 602
168 3300006946 Ga0079104_1004611 Ga0079104_10046115 602
169 3300013100 Ga0157373_10058475 Ga0157373_100584752 602
170 3300013102 Ga0157371_10000835 Ga0157371_100008354 602
171 3300025728 Ga0207655_1000583 Ga0207655_10005835 602
172 3300025728 Ga0207655_1004465 Ga0207655_10044654 602
173 3300025735 Ga0207713_1005588 Ga0207713_10055884 602
174 3300025932 Ga0207690_10054702 Ga0207690_100547022 602
175 3300027111 Ga0209281_1000312 Ga0209281_100031231 602
176 3300027111 Ga0209281_1000341 Ga0209281_100034129 602
177 3300027312 Ga0209371_1003334 Ga0209371_10033342 602
178 3300030500 Ga0268256_1003033 Ga0268256_10030332 602
179 3300041405 Ga0439438_000014 Ga0439438_000014_31638_33449 602
180 3300041407 Ga0439447_001628 Ga0439447_001628_3110_4921 602
181 3300042010 Ga0439452_000010 Ga0439452_000010_247920_249731 602
182 3300042876 Ga0451577_0000018 Ga0451577_0000018_362160_364001 602
183 3300044712 Ga0453684_0000166 Ga0453684_0000166_152499_154340 602
184 3300047469 Ga0495673_0000216 Ga0495673_0000216_52150_53961 602
185 iso_pu_bacteria 2511231025 2511380459 602
186 iso_pu_bacteria 2511231035 2511435569 602
187 iso_pu_bacteria 2599185299 2599925161 602
188 iso_pu_bacteria 2648501693 2650897276 602
189 iso_pu_bacteria 2684622997 2686356234 602
190 iso_pu_bacteria 2808606414 2809126599 602
191 iso_pu_bacteria 2847797336 2847801896 602
192 iso_pu_bacteria 2876601092 2876603391 602
193 iso_pu_bacteria 2881609920 2881611522 602
194 iso_pu_bacteria 2939602548 2939605098 602
195 iso_pu_bacteria 2984494565 2984498660 602
196 iso_pu_bacteria 2990261002 2990264135 602
197 iso_pu_bacteria 8016733728 8016737732 602
198 iso_pu_bacteria 8019499862 8019503558 602
199 3300006946 Ga0079104_1000335 Ga0079104_100033521 603
200 3300006946 Ga0079104_1000694 Ga0079104_100069421 603
201 3300009011 Ga0105251_10000386 Ga0105251_1000038612 603
202 3300009036 Ga0105244_10011769 Ga0105244_100117693 603
203 3300009174 Ga0105241_10000010 Ga0105241_10000010202 603
204 3300013102 Ga0157371_10000102 Ga0157371_1000010258 603
205 3300014497 Ga0182008_10001384 Ga0182008_1000138410 603
206 3300025711 Ga0207696_1000331 Ga0207696_100033121 603
207 3300025728 Ga0207655_1000393 Ga0207655_10003935 603
208 3300027111 Ga0209281_1000285 Ga0209281_100028558 603
209 3300027111 Ga0209281_1001035 Ga0209281_10010354 603
210 3300042006 Ga0439432_003818 Ga0439432_003818_580_2397 603
211 3300046471 Ga0495650_0000199 Ga0495650_0000199_33041_34858 603
212 3300046530 Ga0495654_0001042 Ga0495654_0001042_12701_14518 603
213 3300046794 Ga0495589_0000274 Ga0495589_0000274_35371_37188 603
214 3300046810 Ga0495660_0000045 Ga0495660_0000045_59116_60933 603
215 3300048919 Ga0496116_0000739 Ga0496116_0000739_33161_34978 603
216 3300048920 Ga0496117_0011036 Ga0496117_0011036_2292_4109 603
217 3300048921 Ga0496118_0010354 Ga0496118_0010354_3396_5213 603
218 3300048921 Ga0496118_0010600 Ga0496118_0010600_2530_4347 603
219 3300048922 Ga0496119_0000219 Ga0496119_0000219_29734_31551 603
220 3300048922 Ga0496119_0006097 Ga0496119_0006097_4156_5973 603
221 3300048923 Ga0496120_0000301 Ga0496120_0000301_29734_31551 603
222 3300048923 Ga0496120_0002528 Ga0496120_0002528_12307_14124 603
223 3300048925 Ga0496122_0000607 Ga0496122_0000607_33009_34826 603
224 3300048926 Ga0496123_0000451 Ga0496123_0000451_33026_34843 603
225 3300048927 Ga0496124_0000583 Ga0496124_0000583_866_2683 603
226 3300048928 Ga0496125_0000563 Ga0496125_0000563_59116_60933 603
227 3300048929 Ga0496126_0000648 Ga0496126_0000648_3421_5238 603
228 iso_pu_bacteria 2537561728 2538425110 603
229 iso_pu_bacteria 2608642108 2608671363 603
230 iso_pu_bacteria 2844528606 2844531907 603
231 iso_pu_bacteria 2846540461 2846544576 603
232 iso_pu_bacteria 2854601825 2854603340 603
233 iso_pu_bacteria 2855195626 2855199036 603
234 iso_pu_bacteria 2858466076 2858466793 603
235 iso_pu_bacteria 2865014394 2865018707 603
236 iso_pu_bacteria 2871272651 2871274958 603
237 iso_pu_bacteria 2871282230 2871282486 603
238 iso_pu_bacteria 2945951305 2945954779 603
239 iso_pu_bacteria 2978975091 2978977269 603
240 iso_pu_bacteria 2508501071 2508850134 604
241 iso_pu_bacteria 2547132181 2547698525 604
242 iso_pu_bacteria 2554235234 2555262463 604
243 iso_pu_bacteria 2561511199 2562465375 604
244 iso_pu_bacteria 2585427591 2585829012 604
245 iso_pu_bacteria 2585427592 2585833783 604
246 iso_pu_bacteria 2599185169 2599413413 604
247 iso_pu_bacteria 2600255254 2601526159 604
248 iso_pu_bacteria 2600255255 2601531189 604
249 iso_pu_bacteria 2600255256 2601536430 604
250 iso_pu_bacteria 2600255257 2601541795 604
251 iso_pu_bacteria 2600255280 2601618051 604
252 iso_pu_bacteria 2600255281 2601623085 604
253 iso_pu_bacteria 2600255287 2601646438 604
254 iso_pu_bacteria 2600255288 2601651441 604
255 iso_pu_bacteria 2600255289 2601656499 604
256 iso_pu_bacteria 2600255290 2601661403 604
257 iso_pu_bacteria 2600255291 2601666462 604
258 iso_pu_bacteria 2600255298 2601699421 604
259 iso_pu_bacteria 2600255299 2601704333 604
260 iso_pu_bacteria 2600255300 2601709272 604
261 iso_pu_bacteria 2600255301 2601714294 604
262 iso_pu_bacteria 2600255302 2601719356 604
263 iso_pu_bacteria 2600255303 2601724242 604
264 iso_pu_bacteria 2600255304 2601729250 604
265 iso_pu_bacteria 2600255305 2601734275 604
266 iso_pu_bacteria 2600255306 2601739262 604
267 iso_pu_bacteria 2600255307 2601743965 604
268 iso_pu_bacteria 2600255309 2601754800 604
269 iso_pu_bacteria 2600255310 2601760161 604
270 iso_pu_bacteria 2600255311 2601765557 604
271 iso_pu_bacteria 2600255392 2602021979 604
272 iso_pu_bacteria 2602042046 2603641595 604
273 iso_pu_bacteria 2602042047 2603641764 604
274 iso_pu_bacteria 2602042052 2603659200 604
275 iso_pu_bacteria 2602042053 2603664093 604
276 iso_pu_bacteria 2602042067 2603706808 604
277 iso_pu_bacteria 2602042103 2603836622 604
278 iso_pu_bacteria 2602042104 2603841728 604
279 iso_pu_bacteria 2602042105 2603846799 604
280 iso_pu_bacteria 2602042106 2603851844 604
281 iso_pu_bacteria 2602042109 2603864792 604
282 iso_pu_bacteria 2602042110 2603869418 604
283 iso_pu_bacteria 2602042111 2603874693 604
284 iso_pu_bacteria 2603880178 2606046628 604
285 iso_pu_bacteria 2603880184 2606068496 604
286 iso_pu_bacteria 2603880202 2606144301 604
287 iso_pu_bacteria 2603880211 2606174492 604
288 iso_pu_bacteria 2609459761 2609914200 604
289 iso_pu_bacteria 2636415599 2637227714 604
290 iso_pu_bacteria 2667528173 2671110349 604
291 iso_pu_bacteria 2671180115 2671588213 604
292 iso_pu_bacteria 2675903046 2676410188 604
293 iso_pu_bacteria 2681812866 2681995194 604
294 iso_pu_bacteria 2711768156 2712471589 604
295 iso_pu_bacteria 2751185917 2753858051 604
296 iso_pu_bacteria 2775506706 2775538418 604
297 iso_pu_bacteria 2775507074 2777024309 604
298 iso_pu_bacteria 2791355010 2792314570 604
299 iso_pu_bacteria 2811995292 2813731187 604
300 iso_pu_bacteria 2814123068 2814698878 604
301 iso_pu_bacteria 2821118458 2821122993 604
302 iso_pu_bacteria 2823373977 2823378518 604
303 iso_pu_bacteria 2844425489 2844429559 604
304 iso_pu_bacteria 2847085930 2847089602 604
305 iso_pu_bacteria 2852103415 2852104315 604
306 iso_pu_bacteria 2869551831 2869552010 604
307 iso_pu_bacteria 2884086401 2884091020 604
308 iso_pu_bacteria 2888366609 2888366788 604
309 iso_pu_bacteria 2888373701 2888375573 604
310 iso_pu_bacteria 2891670763 2891673341 604
311 iso_pu_bacteria 2904474040 2904478769 604
312 iso_pu_bacteria 2904513164 2904518428 604
313 iso_pu_bacteria 2908669403 2908674557 604
314 iso_pu_bacteria 2919108558 2919113791 604
315 iso_pu_bacteria 2919150387 2919154877 604
316 iso_pu_bacteria 2923634449 2923637077 604
317 iso_pu_bacteria 2927143783 2927148461 604
318 iso_pu_bacteria 2927833300 2927836480 604
319 iso_pu_bacteria 2935625433 2935630065 604
320 iso_pu_bacteria 2939573065 2939577682 604
321 iso_pu_bacteria 2939607340 2939611825 604
322 iso_pu_bacteria 2939617950 2939622239 604
323 iso_pu_bacteria 2945874760 2945874994 604
324 iso_pu_bacteria 2969079654 2969084755 604
325 iso_pu_bacteria 2971820967 2971826281 604
326 iso_pu_bacteria 2974435778 2974436419 604
327 iso_pu_bacteria 2984559226 2984561876 604
328 iso_pu_bacteria 2984595703 2984599942 604
329 iso_pu_bacteria 8019504834 8019509099 604
330 iso_pu_bacteria 8054844752 8054845320 604
331 iso_pu_bacteria 8054849141 8054850295 604
332 iso_pu_bacteria 8055087960 8055090266 604
333 iso_pu_bacteria 8055097453 8055098018 604
334 iso_pu_bacteria 8055693939 8055694136 604
335 3300001989 JGI24739J22299_10000016 JGI24739J22299_1000001620 606
336 3300003856 Ga0058692_1000145 Ga0058692_100014513 606
337 3300003856 Ga0058692_1000179 Ga0058692_100017924 606
338 3300003856 Ga0058692_1000253 Ga0058692_100025315 606
339 3300003856 Ga0058692_1000310 Ga0058692_100031013 606
340 3300009011 Ga0105251_10000533 Ga0105251_100005337 606
341 3300009011 Ga0105251_10006416 Ga0105251_100064166 606
342 3300009036 Ga0105244_10000551 Ga0105244_1000055114 606
343 3300009036 Ga0105244_10005549 Ga0105244_100055496 606
344 3300013100 Ga0157373_10000114 Ga0157373_1000011446 606
345 3300013100 Ga0157373_10012149 Ga0157373_100121492 606
346 3300013102 Ga0157371_10000554 Ga0157371_1000055419 606
347 3300013102 Ga0157371_10000577 Ga0157371_1000057738 606
348 3300013104 Ga0157370_10000444 Ga0157370_1000044421 606
349 3300025711 Ga0207696_1000404 Ga0207696_10004047 606
350 3300027312 Ga0209371_1000063 Ga0209371_100006331 606
351 3300027312 Ga0209371_1000068 Ga0209371_100006830 606
352 3300027312 Ga0209371_1000331 Ga0209371_100033132 606
353 3300027312 Ga0209371_1001510 Ga0209371_100151012 606
354 3300027312 Ga0209371_1002324 Ga0209371_10023243 606
355 3300030500 Ga0268256_1000060 Ga0268256_1000060153 606
356 3300030500 Ga0268256_1000064 Ga0268256_1000064161 606
357 3300030500 Ga0268256_1000769 Ga0268256_10007696 606
358 3300030500 Ga0268256_1003255 Ga0268256_10032555 606
359 3300042006 Ga0439432_012497 Ga0439432_012497_701_2527 606
360 3300042010 Ga0439452_000023 Ga0439452_000023_30108_31934 606
361 3300046458 Ga0495591_000031 Ga0495591_000031_32470_34296 606
362 3300046530 Ga0495654_0000040 Ga0495654_0000040_150131_151957 606
363 3300048904 Ga0496101_0000119 Ga0496101_0000119_43068_44894 606
364 3300048919 Ga0496116_0000521 Ga0496116_0000521_19844_21670 606
365 3300048919 Ga0496116_0007283 Ga0496116_0007283_6688_8514 606
366 3300048920 Ga0496117_0001270 Ga0496117_0001270_16118_17944 606
367 3300048923 Ga0496120_0003918 Ga0496120_0003918_10458_12284 606
368 3300048925 Ga0496122_0002360 Ga0496122_0002360_13782_15608 606
369 3300048927 Ga0496124_0036725 Ga0496124_0036725_1452_3278 606
370 iso_pu_bacteria 3000376612 3000376648 606
371 3300002737 JGI25162J39368_1002393 JGI25162J39368_10023935 607
372 3300003856 Ga0058692_1007644 Ga0058692_10076442 607
373 3300005347 Ga0070668_100010851 Ga0070668_1000108515 607
374 3300005457 Ga0070662_100001198 Ga0070662_1000011986 607
375 3300005548 Ga0070665_100024927 Ga0070665_1000249273 607
376 3300009011 Ga0105251_10022048 Ga0105251_100220482 607
377 3300009036 Ga0105244_10005895 Ga0105244_100058954 607
378 3300011119 Ga0105246_10008080 Ga0105246_100080801 607
379 3300011119 Ga0105246_10013548 Ga0105246_100135483 607
380 3300013102 Ga0157371_10028386 Ga0157371_100283863 607
381 3300013105 Ga0157369_10018575 Ga0157369_100185755 607
382 3300013306 Ga0163162_10088738 Ga0163162_100887382 607
383 3300013307 Ga0157372_10016801 Ga0157372_100168013 607
384 3300013307 Ga0157372_10115647 Ga0157372_101156472 607
385 3300015261 Ga0182006_1016027 Ga0182006_10160273 607
386 3300015262 Ga0182007_10008670 Ga0182007_100086703 607
387 3300025233 Ga0209437_100092 Ga0209437_100092184 607
388 3300025711 Ga0207696_1000434 Ga0207696_10004345 607
389 3300025728 Ga0207655_1000111 Ga0207655_100011129 607
390 3300025728 Ga0207655_1003418 Ga0207655_10034185 607
391 3300025728 Ga0207655_1004584 Ga0207655_10045847 607
392 3300025735 Ga0207713_1000045 Ga0207713_1000045181 607
393 3300025735 Ga0207713_1012005 Ga0207713_10120054 607
394 3300025933 Ga0207706_10006159 Ga0207706_100061595 607
395 3300027312 Ga0209371_1000071 Ga0209371_100007131 607
396 3300027312 Ga0209371_1000429 Ga0209371_100042928 607
397 3300027312 Ga0209371_1000617 Ga0209371_10006176 607
398 3300030500 Ga0268256_1000070 Ga0268256_100007028 607
399 3300030500 Ga0268256_1000386 Ga0268256_100038613 607
400 3300041407 Ga0439447_002527 Ga0439447_002527_4520_6349 607
401 3300041411 Ga0439466_0000008 Ga0439466_0000008_211570_213399 607
402 3300042146 Ga0450907_000030 Ga0450907_000030_33478_35307 607
403 3300042439 Ga0439464_0002326 Ga0439464_0002326_390_2219 607
404 3300046458 Ga0495591_003527 Ga0495591_003527_5573_7399 607
405 3300046471 Ga0495650_0000360 Ga0495650_0000360_28997_30823 607
406 3300046474 Ga0495605_0010666 Ga0495605_0010666_3181_5007 607
407 3300046491 Ga0495584_0005890 Ga0495584_0005890_3111_4937 607
408 3300046500 Ga0495596_0003622 Ga0495596_0003622_4508_6337 607
409 3300046501 Ga0495607_0002720 Ga0495607_0002720_2860_4686 607
410 3300046507 Ga0495606_0000541 Ga0495606_0000541_29204_31030 607
411 3300046523 Ga0495644_0008348 Ga0495644_0008348_1833_3659 607
412 3300046524 Ga0495648_0002122 Ga0495648_0002122_12301_14130 607
413 3300046524 Ga0495648_0015539 Ga0495648_0015539_1369_3195 607
414 3300046530 Ga0495654_0000519 Ga0495654_0000519_259_2085 607
415 3300046692 Ga0495671_0004850 Ga0495671_0004850_1481_3307 607
416 3300046794 Ga0495589_0004351 Ga0495589_0004351_4750_6576 607
417 3300046810 Ga0495660_0000134 Ga0495660_0000134_29288_31114 607
418 3300047320 Ga0495672_0000083 Ga0495672_0000083_122705_124534 607
419 3300047320 Ga0495672_0000224 Ga0495672_0000224_49322_51148 607
420 3300047446 Ga0495679_002253 Ga0495679_002253_4375_6204 607
421 3300047469 Ga0495673_0000622 Ga0495673_0000622_3766_5592 607
422 3300048903 Ga0496100_0013822 Ga0496100_0013822_2584_4413 607
423 3300048905 Ga0496102_0012173 Ga0496102_0012173_3105_4934 607
424 3300048908 Ga0496105_0003574 Ga0496105_0003574_4858_6687 607
425 3300048908 Ga0496105_0087023 Ga0496105_0087023_263_2092 607
426 3300048919 Ga0496116_0020140 Ga0496116_0020140_2008_3837 607
427 3300048920 Ga0496117_0000470 Ga0496117_0000470_32530_34359 607
428 3300048920 Ga0496117_0001133 Ga0496117_0001133_25975_27804 607
429 3300048921 Ga0496118_0000490 Ga0496118_0000490_32616_34445 607
430 3300048921 Ga0496118_0002301 Ga0496118_0002301_12801_14630 607
431 3300048922 Ga0496119_0000490 Ga0496119_0000490_18812_20641 607
432 3300048922 Ga0496119_0000706 Ga0496119_0000706_33412_35241 607
433 3300048922 Ga0496119_0008481 Ga0496119_0008481_3829_5655 607
434 3300048923 Ga0496120_0000108 Ga0496120_0000108_33587_35416 607
435 3300048923 Ga0496120_0000476 Ga0496120_0000476_28737_30563 607
436 3300048923 Ga0496120_0000813 Ga0496120_0000813_9543_11372 607
437 3300048924 Ga0496121_0000074 Ga0496121_0000074_33534_35363 607
438 3300048925 Ga0496122_0003475 Ga0496122_0003475_1832_3661 607
439 3300048926 Ga0496123_0002061 Ga0496123_0002061_15311_17140 607
440 3300048927 Ga0496124_0009646 Ga0496124_0009646_1079_2908 607
441 3300048927 Ga0496124_0019622 Ga0496124_0019622_1079_2908 607
442 3300048928 Ga0496125_0002298 Ga0496125_0002298_18669_20498 607
443 3300049459 Ga0495678_000337 Ga0495678_000337_29584_31410 607
444 3300049460 Ga0495682_0000139 Ga0495682_0000139_31738_33564 607
445 3300053126 Ga0500621_000018 Ga0500621_000018_29233_31059 607
446 iso_pu_bacteria 2706794495 2707100907 607
447 2010549000 RicEn_C1615 RicEn_29520 608
448 2162886007 SwRhRL2b_contig_1995509 SwRhRL2b_0616.00000950 608
449 3300002771 JGI25163J39215_1000498 JGI25163J39215_10004988 608
450 3300002772 JGI25164J39214_1000152 JGI25164J39214_10001528 608
451 3300003320 rootH2_10019123 rootH2_100191235 608
452 3300003751 Ga0055538_1000109 Ga0055538_10001098 608
453 3300003752 Ga0055539_1000158 Ga0055539_100015856 608
454 3300003756 Ga0055533_1000160 Ga0055533_100016056 608
455 3300003759 Ga0055525_1000212 Ga0055525_100021256 608
456 3300003841 Ga0055541_1000104 Ga0055541_100010456 608
457 3300003856 Ga0058692_1002097 Ga0058692_10020975 608
458 3300005272 Ga0065703_1019144 Ga0065703_10191442 608
459 3300005289 Ga0065704_10000450 Ga0065704_1000045041 608
460 3300005289 Ga0065704_10000585 Ga0065704_100005856 608
461 3300005289 Ga0065704_10001072 Ga0065704_100010727 608
462 3300005289 Ga0065704_10005603 Ga0065704_100056033 608
463 3300005548 Ga0070665_100001124 Ga0070665_1000011245 608
464 3300005577 Ga0068857_100000028 Ga0068857_10000002854 608
465 3300005834 Ga0068851_10002655 Ga0068851_100026555 608
466 3300006051 Ga0075364_10033505 Ga0075364_100335052 608
467 3300006946 Ga0079104_1000254 Ga0079104_100025444 608
468 3300006946 Ga0079104_1000356 Ga0079104_100035623 608
469 3300006946 Ga0079104_1001489 Ga0079104_10014898 608
470 3300006946 Ga0079104_1003593 Ga0079104_10035935 608
471 3300006946 Ga0079104_1011435 Ga0079104_10114352 608
472 3300009011 Ga0105251_10001068 Ga0105251_100010687 608
473 3300009011 Ga0105251_10002401 Ga0105251_100024012 608
474 3300009011 Ga0105251_10021855 Ga0105251_100218552 608
475 3300009036 Ga0105244_10000103 Ga0105244_1000010357 608
476 3300009036 Ga0105244_10000516 Ga0105244_1000051630 608
477 3300009036 Ga0105244_10000539 Ga0105244_1000053919 608
478 3300009036 Ga0105244_10000566 Ga0105244_1000056621 608
479 3300009036 Ga0105244_10000844 Ga0105244_100008445 608
480 3300009036 Ga0105244_10010070 Ga0105244_100100705 608
481 3300009092 Ga0105250_10000205 Ga0105250_1000020529 608
482 3300009092 Ga0105250_10000217 Ga0105250_1000021718 608
483 3300009092 Ga0105250_10002873 Ga0105250_100028738 608
484 3300009093 Ga0105240_10058281 Ga0105240_100582814 608
485 3300009148 Ga0105243_10000658 Ga0105243_1000065830 608
486 3300009148 Ga0105243_10005793 Ga0105243_100057938 608
487 3300013100 Ga0157373_10013005 Ga0157373_100130055 608
488 3300013102 Ga0157371_10007860 Ga0157371_100078604 608
489 3300013104 Ga0157370_10000356 Ga0157370_100003563 608
490 3300013104 Ga0157370_10001839 Ga0157370_1000183921 608
491 3300013105 Ga0157369_10000452 Ga0157369_1000045232 608
492 3300013307 Ga0157372_10000094 Ga0157372_1000009431 608
493 3300015261 Ga0182006_1000009 Ga0182006_1000009224 608
494 3300015679 Ga0183366_1009 Ga0183366_100928 608
495 3300015680 Ga0183370_1009 Ga0183370_100953 608
496 3300015685 Ga0183369_1024 Ga0183369_102453 608
497 3300015687 Ga0183368_1012 Ga0183368_101253 608
498 3300017792 Ga0163161_10000006 Ga0163161_1000000668 608
499 3300021384 Ga0213876_10000106 Ga0213876_1000010663 608
500 3300025207 Ga0209760_100370 Ga0209760_1003708 608
501 3300025224 Ga0209784_100064 Ga0209784_10006491 608
502 3300025225 Ga0209566_100079 Ga0209566_10007991 608
503 3300025226 Ga0209674_100194 Ga0209674_10019457 608
504 3300025230 Ga0209563_100152 Ga0209563_10015257 608
505 3300025231 Ga0207427_100181 Ga0207427_10018157 608
506 3300025233 Ga0209437_100149 Ga0209437_10014991 608
507 3300025253 Ga0209677_100148 Ga0209677_1001488 608
508 3300025258 Ga0209129_1000179 Ga0209129_100017931 608
509 3300025261 Ga0209233_1003969 Ga0209233_10039694 608
510 3300025321 Ga0207656_10002534 Ga0207656_100025344 608
511 3300025711 Ga0207696_1000046 Ga0207696_100004670 608
512 3300025711 Ga0207696_1000347 Ga0207696_100034718 608
513 3300025711 Ga0207696_1000414 Ga0207696_100041431 608
514 3300025711 Ga0207696_1000534 Ga0207696_100053429 608
515 3300025711 Ga0207696_1000590 Ga0207696_10005904 608
516 3300025711 Ga0207696_1011496 Ga0207696_10114963 608
517 3300025728 Ga0207655_1000170 Ga0207655_100017061 608
518 3300025728 Ga0207655_1000208 Ga0207655_100020867 608
519 3300025728 Ga0207655_1000245 Ga0207655_100024527 608
520 3300025728 Ga0207655_1000547 Ga0207655_100054718 608
521 3300025728 Ga0207655_1001676 Ga0207655_10016763 608
522 3300025728 Ga0207655_1002339 Ga0207655_10023397 608
523 3300025728 Ga0207655_1009735 Ga0207655_10097355 608
524 3300025728 Ga0207655_1015135 Ga0207655_10151352 608
525 3300025735 Ga0207713_1000056 Ga0207713_100005670 608
526 3300025735 Ga0207713_1000075 Ga0207713_1000075117 608
527 3300025735 Ga0207713_1000334 Ga0207713_100033419 608
528 3300025735 Ga0207713_1000340 Ga0207713_100034020 608
529 3300025735 Ga0207713_1000368 Ga0207713_100036819 608
530 3300025735 Ga0207713_1000613 Ga0207713_100061315 608
531 3300025735 Ga0207713_1005810 Ga0207713_10058102 608
532 3300025900 Ga0207710_10000024 Ga0207710_10000024223 608
533 3300025911 Ga0207654_10000010 Ga0207654_10000010203 608
534 3300025935 Ga0207709_10000428 Ga0207709_1000042829 608
535 3300025935 Ga0207709_10008436 Ga0207709_100084362 608
536 3300026116 Ga0207674_10000367 Ga0207674_100003676 608
537 3300027111 Ga0209281_1000139 Ga0209281_100013987 608
538 3300027111 Ga0209281_1000305 Ga0209281_100030535 608
539 3300027111 Ga0209281_1000326 Ga0209281_100032628 608
540 3300027111 Ga0209281_1000497 Ga0209281_100049730 608
541 3300027111 Ga0209281_1000794 Ga0209281_100079428 608
542 3300027111 Ga0209281_1000867 Ga0209281_100086719 608
543 3300027111 Ga0209281_1002561 Ga0209281_10025614 608
544 3300027312 Ga0209371_1000201 Ga0209371_100020151 608
545 3300027312 Ga0209371_1000210 Ga0209371_100021027 608
546 3300027312 Ga0209371_1000299 Ga0209371_100029930 608
547 3300027312 Ga0209371_1000323 Ga0209371_100032327 608
548 3300027312 Ga0209371_1001732 Ga0209371_10017329 608
549 3300027312 Ga0209371_1003829 Ga0209371_10038292 608
550 3300027312 Ga0209371_1008231 Ga0209371_10082312 608
551 3300028379 Ga0268266_10000295 Ga0268266_1000029551 608
552 3300030500 Ga0268256_1000166 Ga0268256_100016654 608
553 3300030500 Ga0268256_1000284 Ga0268256_100028425 608
554 3300030500 Ga0268256_1000720 Ga0268256_100072022 608
555 3300030500 Ga0268256_1000995 Ga0268256_10009957 608
556 3300030500 Ga0268256_1001510 Ga0268256_10015109 608
557 3300030500 Ga0268256_1002953 Ga0268256_10029533 608
558 3300030500 Ga0268256_1008520 Ga0268256_10085202 608
559 3300030500 Ga0268256_1010641 Ga0268256_10106413 608
560 3300039437 Ga0436365_0083358 Ga0436365_0083358_57798_59627 608
561 3300041405 Ga0439438_001432 Ga0439438_001432_3110_4939 608
562 3300042010 Ga0439452_000067 Ga0439452_000067_31667_33493 608
563 3300042010 Ga0439452_000092 Ga0439452_000092_27435_29327 608
564 3300042010 Ga0439452_000103 Ga0439452_000103_39717_41609 608
565 3300042010 Ga0439452_000160 Ga0439452_000160_3502_5394 608
566 3300042439 Ga0439464_0002690 Ga0439464_0002690_2493_4385 608
567 3300044669 Ga0466981_0000022 Ga0466981_0000022_52239_54131 608
568 3300046453 Ga0495627_001403 Ga0495627_001403_7235_9091 608
569 3300046458 Ga0495591_000148 Ga0495591_000148_31663_33555 608
570 3300046458 Ga0495591_002347 Ga0495591_002347_8004_9884 608
571 3300046471 Ga0495650_0000418 Ga0495650_0000418_27435_29327 608
572 3300046515 Ga0495620_0025189 Ga0495620_0025189_545_2428 608
573 3300046542 Ga0495597_0004190 Ga0495597_0004190_1820_3646 608
574 3300046660 Ga0495625_0040316 Ga0495625_0040316_595_2421 608
575 3300046674 Ga0495588_0003426 Ga0495588_0003426_3379_5205 608
576 3300046694 Ga0495649_0009979 Ga0495649_0009979_1748_3628 608
577 3300046694 Ga0495649_0013129 Ga0495649_0013129_1374_3257 608
578 3300047320 Ga0495672_0000225 Ga0495672_0000225_49260_51086 608
579 3300047446 Ga0495679_000178 Ga0495679_000178_49446_51272 608
580 3300048904 Ga0496101_0036427 Ga0496101_0036427_990_2837 608
581 3300048906 Ga0496103_0047363 Ga0496103_0047363_684_2540 608
582 3300048907 Ga0496104_0002540 Ga0496104_0002540_2290_4182 608
583 3300048908 Ga0496105_0033590 Ga0496105_0033590_123_2015 608
584 3300048919 Ga0496116_0000058 Ga0496116_0000058_206750_208606 608
585 3300048919 Ga0496116_0000282 Ga0496116_0000282_29637_31469 608
586 3300048919 Ga0496116_0001084 Ga0496116_0001084_27485_29377 608
587 3300048919 Ga0496116_0020922 Ga0496116_0020922_994_2886 608
588 3300048920 Ga0496117_0000450 Ga0496117_0000450_32162_34018 608
589 3300048920 Ga0496117_0000830 Ga0496117_0000830_18528_20420 608
590 3300048920 Ga0496117_0006340 Ga0496117_0006340_4307_6199 608
591 3300048921 Ga0496118_0002159 Ga0496118_0002159_22652_24544 608
592 3300048921 Ga0496118_0004618 Ga0496118_0004618_3513_5369 608
593 3300048921 Ga0496118_0023219 Ga0496118_0023219_426_2318 608
594 3300048922 Ga0496119_0000170 Ga0496119_0000170_58028_59854 608
595 3300048922 Ga0496119_0000680 Ga0496119_0000680_23328_25160 608
596 3300048922 Ga0496119_0005425 Ga0496119_0005425_8998_10890 608
597 3300048922 Ga0496119_0009261 Ga0496119_0009261_6142_7968 608
598 3300048923 Ga0496120_0000279 Ga0496120_0000279_54289_56121 608
599 3300048923 Ga0496120_0004377 Ga0496120_0004377_3409_5301 608
600 3300048924 Ga0496121_0004066 Ga0496121_0004066_15110_17002 608
601 3300048924 Ga0496121_0007430 Ga0496121_0007430_3409_5301 608
602 3300048924 Ga0496121_0014648 Ga0496121_0014648_1490_3382 608
603 3300048924 Ga0496121_0021651 Ga0496121_0021651_3935_5827 608
604 3300048924 Ga0496121_0031269 Ga0496121_0031269_2779_4671 608
605 3300048924 Ga0496121_0036728 Ga0496121_0036728_1307_3199 608
606 3300048925 Ga0496122_0000467 Ga0496122_0000467_50752_52644 608
607 3300048925 Ga0496122_0001119 Ga0496122_0001119_17300_19192 608
608 3300048925 Ga0496122_0001849 Ga0496122_0001849_26083_27912 608
609 3300048926 Ga0496123_0000322 Ga0496123_0000322_56854_58683 608
610 3300048926 Ga0496123_0000370 Ga0496123_0000370_50748_52640 608
611 3300048926 Ga0496123_0000918 Ga0496123_0000918_26972_28864 608
612 3300048926 Ga0496123_0002686 Ga0496123_0002686_2947_4839 608
613 3300048926 Ga0496123_0004991 Ga0496123_0004991_7363_9252 608
614 3300048926 Ga0496123_0011336 Ga0496123_0011336_935_2827 608
615 3300048926 Ga0496123_0039168 Ga0496123_0039168_1322_3148 608
616 3300048927 Ga0496124_0000514 Ga0496124_0000514_35647_37527 608
617 3300048927 Ga0496124_0002602 Ga0496124_0002602_2437_4329 608
618 3300048927 Ga0496124_0020453 Ga0496124_0020453_3135_5027 608
619 3300048928 Ga0496125_0000534 Ga0496125_0000534_29882_31711 608
620 3300048928 Ga0496125_0001797 Ga0496125_0001797_22720_24612 608
621 3300048928 Ga0496125_0002977 Ga0496125_0002977_738_2630 608
622 3300048928 Ga0496125_0024605 Ga0496125_0024605_3506_5332 608
623 3300048929 Ga0496126_0012282 Ga0496126_0012282_3412_5304 608
624 3300048929 Ga0496126_0015373 Ga0496126_0015373_5131_6957 608
625 3300050491 nmdc:mga00v17_1593_c1 nmdc:mga00v17_1593_c1_6218_8110 608
626 iso_pu_bacteria 2506520007 2506576165 608
627 iso_pu_bacteria 2506520008 2506581303 608
628 iso_pu_bacteria 2602042066 2603701445 608
629 iso_pu_bacteria 2654587920 2656277215 608
630 iso_pu_bacteria 2667528172 2671105821 608
631 iso_pu_bacteria 2681812869 2682009998 608
632 iso_pu_bacteria 2687453601 2689442596 608
633 iso_pu_bacteria 2765235842 2765591217 608
634 iso_pu_bacteria 2772190666 2772436740 608
635 iso_pu_bacteria 2806310673 2807179016 608
636 iso_pu_bacteria 2932406140 2932409054 608
637 iso_pu_bacteria 2937539931 2937540958 608
638 iso_pu_bacteria 2937967321 2937971471 608
639 iso_pu_bacteria 2939577877 2939581642 608
640 iso_pu_bacteria 2974310843 2974314550 608
641 iso_pu_bacteria 640753048 640935684 608
642 iso_pu_bacteria 8004592986 8004593523 608
643 iso_pu_bacteria 8015394850 8015397384 608
644 iso_pu_bacteria 8018221730 8018224087 608
645 iso_pu_bacteria 8018405270 8018405487 608

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00570

HRDC

HRDC domain

538

605

0.96

PF09382

RQC

RQC domain

409

526

0.94

PF16124

RecQ_Zn_bind

RecQ zinc-binding

332

407

0.94

PF00271

Helicase_C

Helicase conserved C-terminal domain

212

321

0.92

PF14493

HTH_40

Helix-turn-helix domain

635

724

0.92

PF00270

DEAD

DEAD/DEAH box helicase

17

181

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wud-assembly1.cif.gz_A e. coli recq hrdc domain 1.001 530 606
1wud-assembly1.cif.gz_A e. coli recq hrdc domain 0.9886 530 606
1oyw-assembly1.cif.gz_A structure of the recq catalytic core 0.9751 8 516
1oyy-assembly1.cif.gz_A structure of the recq catalytic core bound to atp-gamma-s 0.9676 1 516
1oyy-assembly1.cif.gz_A structure of the recq catalytic core bound to atp-gamma-s 0.9657 1 516
ID Description Score Start End Superfamily
1oywA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9809 8 207 3.40.50.300
af_A0A1D6HM55_7_223_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9781 11 209 3.40.50.300
af_A0A1D6H058_407_632_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9736 13 209 3.40.50.300
af_A0A1D6PNE9_185_410_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9716 13 209 3.40.50.300
1oywA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9715 341 516 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C7LQR3-F1-model_v4 ATP-dependent DNA helicase RecQ (EC 5.6.2.4) (DNA 3'-5' helicase RecQ) 0.9685 13 368 GO:0003676
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0030894
GO:0043138
GO:0043590
AF-A0A832MV41-F1-model_v4 ATP-dependent DNA helicase RecQ (EC 5.6.2.4) (DNA 3'-5' helicase RecQ) 0.9659 13 357 GO:0003676
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0030894
GO:0043138
GO:0043590
AF-A0A0S7H1A3-F1-model_v4 deleted 0.9586 47 406
AF-A0A7G7WNI0-F1-model_v4 ATP-dependent DNA helicase (EC 5.6.2.4) 0.9564 9 406 GO:0000724
GO:0003676
GO:0005524
GO:0005634
GO:0005694
GO:0005737
GO:0006268
GO:0006355
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A7V9FI46-F1-model_v4 ATP-dependent DNA helicase RecQ (EC 5.6.2.4) (DNA 3'-5' helicase RecQ) 0.9499 8 340 GO:0003676
GO:0005524
GO:0005694
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0043138

Feature Viewer

pLDDT pTM Quality
89.77 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map