F472087
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 644 | 370 | 600 | 289 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8002745576|8002746204 |
| Length | 307 |
| Sequence | TNHAAIIEAQGLHKQYGDFKALNDVSFRVLPGRIVGLIGPNGAGKTSLLKGILGLSTLDGGLSVLGLKPMKERTKLLEQVSFIADTAILPSWLKVHQAIDYVAGVHPRFNREKAQAFLAKTTINPKSRIKALSKGMVTQLHLALVMAIDSKLLVLDEPTLGLDIMYRKQFYSSLLEDYFDEQKTILITTHQVEEVENLLTDVLFIDRGHLVLDSSMDDISQRFCQLSVSTEGRHQVLEAGFQPIYEETRLGGASLLFEGVDPETLAAFGKLHTPSIADLFVAKVSSANERRHDESTVSNMQWKEAGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 2 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 3 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 4 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 5 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 6 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 7 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 8 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 9 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 10 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 11 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 12 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 13 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 14 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 15 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 16 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 17 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 18 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 19 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 20 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 21 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 22 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 23 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 24 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 25 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 26 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 27 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 28 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 29 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 30 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 31 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 32 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 33 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 34 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 35 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 36 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 37 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 38 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 39 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 40 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 41 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 42 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 43 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 44 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 47 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 48 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 49 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 114 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 117 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 118 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 203 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 204 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 207 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 231 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 232 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 233 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 234 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 235 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 236 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 237 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 238 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 239 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 240 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 241 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 242 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 243 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 244 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 245 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 246 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 247 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 248 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 249 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 250 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 251 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 306 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 307 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 308 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 309 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 310 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 311 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 312 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 313 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 314 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 344 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 358 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 360 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 361 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 368 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 369 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 370 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.17 |
| Metatranscriptomes | 0 |
| Isolates | 6.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.16 |
| Bulb | 0 |
| Endosphere | 13.66 |
| Nodule | 0 |
| Rhizoplane | 1.55 |
| Rhizosphere | 72.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001100 | 3300001904 | Bacteria | 4948 |
| 2 | JGI25152J39213_1000294 | 3300002773 | Bacteria | 32905 |
| 3 | JGI25152J39213_1025832 | 3300002773 | Bacteria | 967 |
| 4 | JGI25150J39212_1000272 | 3300002774 | Bacteria | 27404 |
| 5 | JGI25151J46595_10000148 | 3300003187 | Bacteria | 92040 |
| 6 | JGI25151J46595_10000380 | 3300003187 | Bacteria | 46059 |
| 7 | JGI25165J46597_1015751 | 3300003214 | Bacteria | 1018 |
| 8 | JGI25153J46596_10000240 | 3300003215 | Bacteria | 46059 |
| 9 | rootH2_10014367 | 3300003320 | Bacteria | 1215 |
| 10 | Ga0055526_1000032 | 3300003771 | Bacteria | 143118 |
| 11 | Ga0055526_1004730 | 3300003771 | Bacteria | 8064 |
| 12 | Ga0055526_1008358 | 3300003771 | Bacteria | 5184 |
| 13 | Ga0055537_1000308 | 3300003773 | Bacteria | 33643 |
| 14 | Ga0055537_1001514 | 3300003773 | Bacteria | 8934 |
| 15 | Ga0055524_1000054 | 3300003775 | Bacteria | 143118 |
| 16 | Ga0055524_1019184 | 3300003775 | Bacteria | 2346 |
| 17 | Ga0055534_1000073 | 3300003784 | Bacteria | 77473 |
| 18 | Ga0055534_1000224 | 3300003784 | Bacteria | 41130 |
| 19 | Ga0055528_1000021 | 3300003790 | Bacteria | 143118 |
| 20 | Ga0055528_1000080 | 3300003790 | Bacteria | 75390 |
| 21 | Ga0055528_1018251 | 3300003790 | Bacteria | 2385 |
| 22 | Ga0055530_10009430 | 3300003791 | Bacteria | 3752 |
| 23 | Ga0055531_10008715 | 3300003794 | Bacteria | 5298 |
| 24 | Ga0055531_10013111 | 3300003794 | Bacteria | 3846 |
| 25 | Ga0055531_10023050 | 3300003794 | Bacteria | 2350 |
| 26 | Ga0065714_10073995 | 3300005288 | Bacteria | 3098 |
| 27 | Ga0070683_100143047 | 3300005329 | Bacteria | 2266 |
| 28 | Ga0070690_100111990 | 3300005330 | Bacteria | 1822 |
| 29 | Ga0070666_10001419 | 3300005335 | Bacteria | 14514 |
| 30 | Ga0070666_10014671 | 3300005335 | Bacteria | 4990 |
| 31 | Ga0070666_10042227 | 3300005335 | Bacteria | 3050 |
| 32 | Ga0070680_100051193 | 3300005336 | Bacteria | 3369 |
| 33 | Ga0070682_100207131 | 3300005337 | Bacteria | 1388 |
| 34 | Ga0068868_100151594 | 3300005338 | Bacteria | 1909 |
| 35 | Ga0070660_100151860 | 3300005339 | Bacteria | 1862 |
| 36 | Ga0070661_100071859 | 3300005344 | Bacteria | 2546 |
| 37 | Ga0070661_100208297 | 3300005344 | Bacteria | 1496 |
| 38 | Ga0070668_100006634 | 3300005347 | Bacteria | 8579 |
| 39 | Ga0070668_100529690 | 3300005347 | Bacteria | 1023 |
| 40 | Ga0070669_100163965 | 3300005353 | Bacteria | 1729 |
| 41 | Ga0070675_100052632 | 3300005354 | Bacteria | 3348 |
| 42 | Ga0070675_100180021 | 3300005354 | Bacteria | 1827 |
| 43 | Ga0070675_100422159 | 3300005354 | Bacteria | 1192 |
| 44 | Ga0070671_100065050 | 3300005355 | Bacteria | 3037 |
| 45 | Ga0070671_100178302 | 3300005355 | Bacteria | 1798 |
| 46 | Ga0070688_100069421 | 3300005365 | Bacteria | 2250 |
| 47 | Ga0070667_100186491 | 3300005367 | Bacteria | 1836 |
| 48 | Ga0070709_10008561 | 3300005434 | Bacteria | 5624 |
| 49 | Ga0070710_10064647 | 3300005437 | Bacteria | 2093 |
| 50 | Ga0070663_100150711 | 3300005455 | Bacteria | 1783 |
| 51 | Ga0070663_100185229 | 3300005455 | Bacteria | 1617 |
| 52 | Ga0070662_100008730 | 3300005457 | Bacteria | 6609 |
| 53 | Ga0068867_100020303 | 3300005459 | Bacteria | 4734 |
| 54 | Ga0070685_10001357 | 3300005466 | Bacteria | 12835 |
| 55 | Ga0068853_100552989 | 3300005539 | Bacteria | 1090 |
| 56 | Ga0070695_100233358 | 3300005545 | Bacteria | 1331 |
| 57 | Ga0070693_100048012 | 3300005547 | Bacteria | 2430 |
| 58 | Ga0070665_100002186 | 3300005548 | Bacteria | 21805 |
| 59 | Ga0070704_100118479 | 3300005549 | Bacteria | 2029 |
| 60 | Ga0070664_100048582 | 3300005564 | Bacteria | 3586 |
| 61 | Ga0070664_100149160 | 3300005564 | Bacteria | 2064 |
| 62 | Ga0068854_100003726 | 3300005578 | Bacteria | 9530 |
| 63 | Ga0068856_100048310 | 3300005614 | Bacteria | 4192 |
| 64 | Ga0070702_100261353 | 3300005615 | Bacteria | 1179 |
| 65 | Ga0068852_100007423 | 3300005616 | Bacteria | 8002 |
| 66 | Ga0068852_100186170 | 3300005616 | Bacteria | 1955 |
| 67 | Ga0068864_100169381 | 3300005618 | Bacteria | 1990 |
| 68 | Ga0068864_100236506 | 3300005618 | Bacteria | 1691 |
| 69 | Ga0068851_10071334 | 3300005834 | Bacteria | 1797 |
| 70 | Ga0068863_100030981 | 3300005841 | Bacteria | 5107 |
| 71 | Ga0068858_100002248 | 3300005842 | Bacteria | 19510 |
| 72 | Ga0068858_100140069 | 3300005842 | Bacteria | 2270 |
| 73 | Ga0068860_100012548 | 3300005843 | Bacteria | 8342 |
| 74 | Ga0068862_100098307 | 3300005844 | Bacteria | 2557 |
| 75 | Ga0075364_10055884 | 3300006051 | Bacteria | 2583 |
| 76 | Ga0075367_10060521 | 3300006178 | Bacteria | 2258 |
| 77 | Ga0075369_10023439 | 3300006186 | Bacteria | 2552 |
| 78 | Ga0097621_100098562 | 3300006237 | Bacteria | 2455 |
| 79 | Ga0075428_100004151 | 3300006844 | Bacteria | 15943 |
| 80 | Ga0075428_100023196 | 3300006844 | Bacteria | 6864 |
| 81 | Ga0075430_100127914 | 3300006846 | Bacteria | 2118 |
| 82 | Ga0075431_100488703 | 3300006847 | Bacteria | 1223 |
| 83 | Ga0075433_10002485 | 3300006852 | Bacteria | 14022 |
| 84 | Ga0075434_100007796 | 3300006871 | Bacteria | 9916 |
| 85 | Ga0068865_100022084 | 3300006881 | Bacteria | 4145 |
| 86 | Ga0068865_100081305 | 3300006881 | Bacteria | 2326 |
| 87 | Ga0068865_100451244 | 3300006881 | Bacteria | 1063 |
| 88 | Ga0105251_10002382 | 3300009011 | Bacteria | 14871 |
| 89 | Ga0105240_10000961 | 3300009093 | Bacteria | 51366 |
| 90 | Ga0105240_10003082 | 3300009093 | Bacteria | 26204 |
| 91 | Ga0105240_10019507 | 3300009093 | Bacteria | 9058 |
| 92 | Ga0111539_10000362 | 3300009094 | Bacteria | 55860 |
| 93 | Ga0105247_10006331 | 3300009101 | Bacteria | 7332 |
| 94 | Ga0114129_10392702 | 3300009147 | Bacteria | 1829 |
| 95 | Ga0105243_10151836 | 3300009148 | Bacteria | 1988 |
| 96 | Ga0105248_10053413 | 3300009177 | Bacteria | 4534 |
| 97 | Ga0105248_10589969 | 3300009177 | Bacteria | 1254 |
| 98 | Ga0105237_10206519 | 3300009545 | Bacteria | 1964 |
| 99 | Ga0105237_10237459 | 3300009545 | Bacteria | 1824 |
| 100 | Ga0105238_10005696 | 3300009551 | Bacteria | 12313 |
| 101 | Ga0105238_10007146 | 3300009551 | Bacteria | 11166 |
| 102 | Ga0105238_10109505 | 3300009551 | Bacteria | 2743 |
| 103 | Ga0105238_10412819 | 3300009551 | Bacteria | 1344 |
| 104 | Ga0105249_10001497 | 3300009553 | Bacteria | 20490 |
| 105 | Ga0105249_10279848 | 3300009553 | Bacteria | 1666 |
| 106 | Ga0105032_101018 | 3300009979 | Bacteria | 2612 |
| 107 | Ga0105030_100226 | 3300009987 | Bacteria | 4852 |
| 108 | Ga0105239_10000041 | 3300010375 | Bacteria | 200922 |
| 109 | Ga0105239_10118967 | 3300010375 | Bacteria | 2932 |
| 110 | Ga0105239_10231843 | 3300010375 | Bacteria | 2071 |
| 111 | Ga0157321_1000872 | 3300012487 | Bacteria | 1429 |
| 112 | Ga0157327_1000290 | 3300012512 | Bacteria | 2620 |
| 113 | Ga0157338_1008877 | 3300012515 | Bacteria | 984 |
| 114 | Ga0157371_10000985 | 3300013102 | Bacteria | 31537 |
| 115 | Ga0157371_10055246 | 3300013102 | Bacteria | 2818 |
| 116 | Ga0157371_10076727 | 3300013102 | Bacteria | 2366 |
| 117 | Ga0157370_10005426 | 3300013104 | Bacteria | 14304 |
| 118 | Ga0157370_10012159 | 3300013104 | Bacteria | 8950 |
| 119 | Ga0157370_10047852 | 3300013104 | Bacteria | 4097 |
| 120 | Ga0157370_10099505 | 3300013104 | Bacteria | 2725 |
| 121 | Ga0157369_10001201 | 3300013105 | Bacteria | 32237 |
| 122 | Ga0157369_10109243 | 3300013105 | Bacteria | 2941 |
| 123 | Ga0157369_10219939 | 3300013105 | Bacteria | 1988 |
| 124 | Ga0157374_10012378 | 3300013296 | Bacteria | 7422 |
| 125 | Ga0163162_10396510 | 3300013306 | Bacteria | 1513 |
| 126 | Ga0157372_10028506 | 3300013307 | Bacteria | 6094 |
| 127 | Ga0157375_10122494 | 3300013308 | Bacteria | 2712 |
| 128 | Ga0157375_10422413 | 3300013308 | Bacteria | 1499 |
| 129 | Ga0157375_10638721 | 3300013308 | Bacteria | 1221 |
| 130 | Ga0163163_10000105 | 3300014325 | Bacteria | 89594 |
| 131 | Ga0163163_10028025 | 3300014325 | Bacteria | 5404 |
| 132 | Ga0157380_10000921 | 3300014326 | Bacteria | 18538 |
| 133 | Ga0157380_10161871 | 3300014326 | Bacteria | 1946 |
| 134 | Ga0182008_10002184 | 3300014497 | Bacteria | 12428 |
| 135 | Ga0182008_10016357 | 3300014497 | Bacteria | 3855 |
| 136 | Ga0157377_10060510 | 3300014745 | Bacteria | 2162 |
| 137 | Ga0157379_10002099 | 3300014968 | Bacteria | 16538 |
| 138 | Ga0157379_10280121 | 3300014968 | Bacteria | 1517 |
| 139 | Ga0157376_10040492 | 3300014969 | Bacteria | 3809 |
| 140 | Ga0182006_1000074 | 3300015261 | Bacteria | 130403 |
| 141 | Ga0182006_1000714 | 3300015261 | Bacteria | 22995 |
| 142 | Ga0182007_10000277 | 3300015262 | Bacteria | 34005 |
| 143 | Ga0182007_10010728 | 3300015262 | Bacteria | 3602 |
| 144 | Ga0182007_10022612 | 3300015262 | Bacteria | 2218 |
| 145 | Ga0182005_1000034 | 3300015265 | Bacteria | 180998 |
| 146 | Ga0182005_1000237 | 3300015265 | Bacteria | 35530 |
| 147 | Ga0182005_1003954 | 3300015265 | Bacteria | 4889 |
| 148 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 149 | Ga0163161_10007092 | 3300017792 | Bacteria | 7748 |
| 150 | Ga0163161_10022768 | 3300017792 | Bacteria | 4414 |
| 151 | Ga0209674_100583 | 3300025226 | Bacteria | 14107 |
| 152 | Ga0209672_105337 | 3300025228 | Bacteria | 2222 |
| 153 | Ga0207427_100112 | 3300025231 | Bacteria | 109224 |
| 154 | Ga0207427_106587 | 3300025231 | Bacteria | 1453 |
| 155 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 156 | Ga0209437_101569 | 3300025233 | Bacteria | 5319 |
| 157 | Ga0209437_112201 | 3300025233 | Bacteria | 1261 |
| 158 | Ga0207425_1000044 | 3300025245 | Bacteria | 195202 |
| 159 | Ga0207425_1008227 | 3300025245 | Bacteria | 2686 |
| 160 | Ga0209148_1002648 | 3300025254 | Bacteria | 5797 |
| 161 | Ga0209129_1000044 | 3300025258 | Bacteria | 298971 |
| 162 | Ga0209129_1012709 | 3300025258 | Bacteria | 1907 |
| 163 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 164 | Ga0209233_1001529 | 3300025261 | Bacteria | 9067 |
| 165 | Ga0209233_1030781 | 3300025261 | Bacteria | 1261 |
| 166 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 167 | Ga0209565_1000022 | 3300025263 | Bacteria | 390888 |
| 168 | Ga0209455_1012921 | 3300025272 | Bacteria | 1969 |
| 169 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 170 | Ga0209673_1003462 | 3300025273 | Bacteria | 9289 |
| 171 | Ga0209673_1003800 | 3300025273 | Bacteria | 8567 |
| 172 | Ga0209130_1004086 | 3300025284 | Bacteria | 5755 |
| 173 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 174 | Ga0209675_1000060 | 3300025291 | Bacteria | 184316 |
| 175 | Ga0209675_1021154 | 3300025291 | Bacteria | 1740 |
| 176 | Ga0209675_1025225 | 3300025291 | Bacteria | 1503 |
| 177 | Ga0209676_1002126 | 3300025292 | Bacteria | 15145 |
| 178 | Ga0209676_1002303 | 3300025292 | Bacteria | 13908 |
| 179 | Ga0209676_1027133 | 3300025292 | Bacteria | 1806 |
| 180 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 181 | Ga0209025_1000012 | 3300025294 | Bacteria | 924362 |
| 182 | Ga0209025_1001660 | 3300025294 | Bacteria | 27398 |
| 183 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 184 | Ga0209564_1000302 | 3300025295 | Bacteria | 97770 |
| 185 | Ga0209564_1005489 | 3300025295 | Bacteria | 7210 |
| 186 | Ga0209758_1000018 | 3300025297 | Bacteria | 753320 |
| 187 | Ga0209758_1005556 | 3300025297 | Bacteria | 9610 |
| 188 | Ga0209758_1006287 | 3300025297 | Bacteria | 8630 |
| 189 | Ga0209758_1008433 | 3300025297 | Bacteria | 6675 |
| 190 | Ga0209758_1052595 | 3300025297 | Bacteria | 1406 |
| 191 | Ga0209758_1053392 | 3300025297 | Bacteria | 1389 |
| 192 | Ga0209050_1001624 | 3300025298 | Bacteria | 23068 |
| 193 | Ga0209050_1033330 | 3300025298 | Bacteria | 1563 |
| 194 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 195 | Ga0209051_1000816 | 3300025303 | Bacteria | 32306 |
| 196 | Ga0209257_1000145 | 3300025304 | Bacteria | 195152 |
| 197 | Ga0209257_1000251 | 3300025304 | Bacteria | 123796 |
| 198 | Ga0209257_1003260 | 3300025304 | Bacteria | 14202 |
| 199 | Ga0209257_1003726 | 3300025304 | Bacteria | 12652 |
| 200 | Ga0209257_1008600 | 3300025304 | Bacteria | 5739 |
| 201 | Ga0209257_1011752 | 3300025304 | Bacteria | 4161 |
| 202 | Ga0209257_1041584 | 3300025304 | Bacteria | 1362 |
| 203 | Ga0207656_10001973 | 3300025321 | Bacteria | 6834 |
| 204 | Ga0207713_1025756 | 3300025735 | Bacteria | 2708 |
| 205 | Ga0207710_10041379 | 3300025900 | Bacteria | 2044 |
| 206 | Ga0207680_10001048 | 3300025903 | Bacteria | 13045 |
| 207 | Ga0207647_10000077 | 3300025904 | Bacteria | 74952 |
| 208 | Ga0207647_10000571 | 3300025904 | Bacteria | 28746 |
| 209 | Ga0207645_10135673 | 3300025907 | Bacteria | 1602 |
| 210 | Ga0207654_10000432 | 3300025911 | Bacteria | 24010 |
| 211 | Ga0207695_10000032 | 3300025913 | Bacteria | 521283 |
| 212 | Ga0207695_10004121 | 3300025913 | Bacteria | 19965 |
| 213 | Ga0207695_10033630 | 3300025913 | Bacteria | 5587 |
| 214 | Ga0207695_10063497 | 3300025913 | Bacteria | 3807 |
| 215 | Ga0207671_10056194 | 3300025914 | Bacteria | 2916 |
| 216 | Ga0207657_10047409 | 3300025919 | Bacteria | 3758 |
| 217 | Ga0207649_10029268 | 3300025920 | Bacteria | 3252 |
| 218 | Ga0207649_10081088 | 3300025920 | Bacteria | 2100 |
| 219 | Ga0207681_10462918 | 3300025923 | Bacteria | 1033 |
| 220 | Ga0207694_10000663 | 3300025924 | Bacteria | 30981 |
| 221 | Ga0207694_10002603 | 3300025924 | Bacteria | 14630 |
| 222 | Ga0207659_10087623 | 3300025926 | Bacteria | 2318 |
| 223 | Ga0207659_10166056 | 3300025926 | Bacteria | 1737 |
| 224 | Ga0207706_10002097 | 3300025933 | Bacteria | 19509 |
| 225 | Ga0207704_10024004 | 3300025938 | Bacteria | 3297 |
| 226 | Ga0207704_10180458 | 3300025938 | Bacteria | 1525 |
| 227 | Ga0207691_10011883 | 3300025940 | Bacteria | 8355 |
| 228 | Ga0207691_10105600 | 3300025940 | Bacteria | 2509 |
| 229 | Ga0207711_10070760 | 3300025941 | Bacteria | 3026 |
| 230 | Ga0207689_10085963 | 3300025942 | Bacteria | 2585 |
| 231 | Ga0207689_10091985 | 3300025942 | Bacteria | 2492 |
| 232 | Ga0207661_10494802 | 3300025944 | Bacteria | 1117 |
| 233 | Ga0207712_10000241 | 3300025961 | Bacteria | 53803 |
| 234 | Ga0207712_10422273 | 3300025961 | Bacteria | 1125 |
| 235 | Ga0207668_10022807 | 3300025972 | Bacteria | 4012 |
| 236 | Ga0207668_10580698 | 3300025972 | Bacteria | 974 |
| 237 | Ga0207640_10009475 | 3300025981 | Bacteria | 5454 |
| 238 | Ga0207658_10027641 | 3300025986 | Bacteria | 3988 |
| 239 | Ga0207658_10249181 | 3300025986 | Bacteria | 1508 |
| 240 | Ga0207703_10001114 | 3300026035 | Bacteria | 25397 |
| 241 | Ga0207703_10166415 | 3300026035 | Bacteria | 1935 |
| 242 | Ga0207639_10000627 | 3300026041 | Bacteria | 24355 |
| 243 | Ga0207678_10005139 | 3300026067 | Bacteria | 11727 |
| 244 | Ga0207678_10355806 | 3300026067 | Bacteria | 1263 |
| 245 | Ga0207702_10241864 | 3300026078 | Bacteria | 1691 |
| 246 | Ga0207641_10057652 | 3300026088 | Bacteria | 3303 |
| 247 | Ga0207676_10394099 | 3300026095 | Bacteria | 1292 |
| 248 | Ga0207674_10016915 | 3300026116 | Bacteria | 7965 |
| 249 | Ga0207683_10102543 | 3300026121 | Bacteria | 2555 |
| 250 | Ga0207698_10042654 | 3300026142 | Bacteria | 3392 |
| 251 | Ga0207698_10042677 | 3300026142 | Bacteria | 3391 |
| 252 | Ga0207698_10098064 | 3300026142 | Bacteria | 2421 |
| 253 | Ga0210000_1011151 | 3300027462 | Bacteria | 1330 |
| 254 | Ga0209995_1005493 | 3300027471 | Bacteria | 2034 |
| 255 | Ga0209968_1014418 | 3300027526 | Bacteria | 1244 |
| 256 | Ga0209982_1001130 | 3300027552 | Bacteria | 3568 |
| 257 | Ga0209970_1001680 | 3300027614 | Bacteria | 3850 |
| 258 | Ga0209983_1001362 | 3300027665 | Bacteria | 5436 |
| 259 | Ga0209971_1005234 | 3300027682 | Bacteria | 3082 |
| 260 | Ga0209971_1011062 | 3300027682 | Bacteria | 2137 |
| 261 | Ga0209974_10014205 | 3300027876 | Bacteria | 2653 |
| 262 | Ga0207428_10001201 | 3300027907 | Bacteria | 27753 |
| 263 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 264 | Ga0268266_10038006 | 3300028379 | Bacteria | 4099 |
| 265 | Ga0268265_10078558 | 3300028380 | Bacteria | 2596 |
| 266 | Ga0316177_1175444 | 3300030731 | Bacteria | 3915 |
| 267 | Ga0314311_1113969 | 3300030733 | Bacteria | 1870 |
| 268 | Ga0316178_1116314 | 3300030735 | Bacteria | 2135 |
| 269 | Ga0307408_100022099 | 3300031548 | Bacteria | 4317 |
| 270 | Ga0307408_100295415 | 3300031548 | Bacteria | 1355 |
| 271 | Ga0316575_10029031 | 3300031665 | Bacteria | 2158 |
| 272 | Ga0316576_10026298 | 3300031727 | Bacteria | 4083 |
| 273 | Ga0316576_10084245 | 3300031727 | Bacteria | 2362 |
| 274 | Ga0316576_10110016 | 3300031727 | Bacteria | 2065 |
| 275 | Ga0307413_10073931 | 3300031824 | Bacteria | 2156 |
| 276 | Ga0307413_10131826 | 3300031824 | Bacteria | 1712 |
| 277 | Ga0307410_10207838 | 3300031852 | Bacteria | 1498 |
| 278 | Ga0307410_10508453 | 3300031852 | Bacteria | 992 |
| 279 | Ga0307406_10080208 | 3300031901 | Bacteria | 2166 |
| 280 | Ga0307406_10234964 | 3300031901 | Bacteria | 1371 |
| 281 | Ga0307407_10020697 | 3300031903 | Bacteria | 3376 |
| 282 | Ga0307412_10002109 | 3300031911 | Bacteria | 11040 |
| 283 | Ga0307412_10072671 | 3300031911 | Bacteria | 2351 |
| 284 | Ga0307412_10348900 | 3300031911 | Bacteria | 1187 |
| 285 | Ga0307412_10395346 | 3300031911 | Bacteria | 1123 |
| 286 | Ga0307409_100450889 | 3300031995 | Bacteria | 1242 |
| 287 | Ga0307409_100466715 | 3300031995 | Bacteria | 1222 |
| 288 | Ga0307414_10000412 | 3300032004 | Bacteria | 23093 |
| 289 | Ga0307414_10004347 | 3300032004 | Bacteria | 7692 |
| 290 | Ga0307414_10006872 | 3300032004 | Bacteria | 6367 |
| 291 | Ga0307414_10028824 | 3300032004 | Bacteria | 3605 |
| 292 | Ga0307414_10136033 | 3300032004 | Bacteria | 1916 |
| 293 | Ga0307414_10383780 | 3300032004 | Bacteria | 1215 |
| 294 | Ga0307411_10062595 | 3300032005 | Bacteria | 2482 |
| 295 | Ga0307411_10272286 | 3300032005 | Bacteria | 1343 |
| 296 | Ga0307415_100113180 | 3300032126 | Bacteria | 2017 |
| 297 | Ga0307415_100366564 | 3300032126 | Bacteria | 1218 |
| 298 | Ga0373944_0001655 | 3300035089 | Bacteria | 5634 |
| 299 | Ga0373923_0050741 | 3300035111 | Bacteria | 1739 |
| 300 | Ga0316574_0073254 | 3300035398 | Bacteria | 2165 |
| 301 | Ga0316574_0080149 | 3300035398 | Bacteria | 2072 |
| 302 | Ga0316574_0146766 | 3300035398 | Bacteria | 1520 |
| 303 | Ga0316574_0211076 | 3300035398 | Bacteria | 1246 |
| 304 | Ga0316574_0316944 | 3300035398 | Bacteria | 990 |
| 305 | Ga0373935_0366495 | 3300035692 | Bacteria | 1030 |
| 306 | Ga0316584_0076702 | 3300036712 | Bacteria | 2504 |
| 307 | Ga0316584_0102094 | 3300036712 | Bacteria | 2148 |
| 308 | Ga0395899_0011157 | 3300037312 | Bacteria | 6885 |
| 309 | Ga0395900_0140311 | 3300037418 | Bacteria | 2475 |
| 310 | Ga0395900_0258126 | 3300037418 | Bacteria | 1741 |
| 311 | Ga0395898_0051520 | 3300037466 | Bacteria | 4025 |
| 312 | Ga0395905_0001851 | 3300037471 | Bacteria | 24380 |
| 313 | Ga0395905_0039962 | 3300037471 | Bacteria | 4401 |
| 314 | Ga0237816_00339 | 3300039145 | Bacteria | 3959 |
| 315 | Ga0436360_0083929 | 3300039438 | Bacteria | 2043 |
| 316 | Ga0439436_0000010 | 3300041404 | Bacteria | 104480 |
| 317 | Ga0439436_0011982 | 3300041404 | Bacteria | 2633 |
| 318 | Ga0439436_0020163 | 3300041404 | Bacteria | 1986 |
| 319 | Ga0439465_0000702 | 3300041413 | Bacteria | 10279 |
| 320 | Ga0439465_0010662 | 3300041413 | Bacteria | 2884 |
| 321 | Ga0451837_0284343 | 3300041494 | Bacteria | 2346 |
| 322 | Ga0451837_1188535 | 3300041494 | Bacteria | 2494 |
| 323 | Ga0451843_0168248 | 3300041509 | Bacteria | 6794 |
| 324 | Ga0439431_0038662 | 3300041997 | Bacteria | 1208 |
| 325 | Ga0439443_005301 | 3300042003 | Bacteria | 1718 |
| 326 | Ga0439445_0004287 | 3300042004 | Bacteria | 3227 |
| 327 | Ga0439432_011364 | 3300042006 | Bacteria | 3069 |
| 328 | Ga0439449_0051328 | 3300042007 | Bacteria | 1525 |
| 329 | Ga0439452_002612 | 3300042010 | Bacteria | 6591 |
| 330 | Ga0439462_0009397 | 3300042015 | Bacteria | 2473 |
| 331 | Ga0450914_005910 | 3300042118 | Bacteria | 1055 |
| 332 | Ga0450920_000805 | 3300042122 | Bacteria | 5054 |
| 333 | Ga0450923_000215 | 3300042125 | Bacteria | 5522 |
| 334 | Ga0450923_003573 | 3300042125 | Bacteria | 2364 |
| 335 | Ga0450894_001444 | 3300042131 | Bacteria | 3416 |
| 336 | Ga0450894_002707 | 3300042131 | Bacteria | 2352 |
| 337 | Ga0450896_001045 | 3300042133 | Bacteria | 3248 |
| 338 | Ga0450906_005714 | 3300042145 | Bacteria | 2541 |
| 339 | Ga0439446_0007777 | 3300042156 | Bacteria | 2825 |
| 340 | Ga0450908_000103 | 3300042184 | Bacteria | 17093 |
| 341 | Ga0450908_000171 | 3300042184 | Bacteria | 13660 |
| 342 | Ga0439434_0005876 | 3300042435 | Bacteria | 3585 |
| 343 | Ga0439434_0033625 | 3300042435 | Bacteria | 1564 |
| 344 | Ga0439435_0017960 | 3300042436 | Bacteria | 1794 |
| 345 | Ga0439444_0001571 | 3300042437 | Bacteria | 3004 |
| 346 | Ga0439460_0033576 | 3300042461 | Bacteria | 1474 |
| 347 | Ga0450918_006925 | 3300042531 | Bacteria | 2014 |
| 348 | Ga0451577_0003018 | 3300042876 | Bacteria | 19168 |
| 349 | Ga0451577_0004523 | 3300042876 | Bacteria | 14640 |
| 350 | Ga0451577_0826231 | 3300042876 | Bacteria | 836 |
| 351 | Ga0466982_0000114 | 3300044672 | Bacteria | 19966 |
| 352 | Ga0453684_0002629 | 3300044712 | Bacteria | 42920 |
| 353 | Ga0451576_0001728 | 3300045051 | Bacteria | 35952 |
| 354 | Ga0466967_0037847 | 3300045976 | Bacteria | 4133 |
| 355 | Ga0466967_0507747 | 3300045976 | Bacteria | 1184 |
| 356 | Ga0495638_0000122 | 3300046460 | Bacteria | 125872 |
| 357 | Ga0495638_0000458 | 3300046460 | Bacteria | 48869 |
| 358 | Ga0495638_0001580 | 3300046460 | Bacteria | 20408 |
| 359 | Ga0495638_0013747 | 3300046460 | Bacteria | 5498 |
| 360 | Ga0495650_0000381 | 3300046471 | Bacteria | 76364 |
| 361 | Ga0495584_0001848 | 3300046491 | Bacteria | 12259 |
| 362 | Ga0495585_0000046 | 3300046492 | Bacteria | 120969 |
| 363 | Ga0495607_0000640 | 3300046501 | Bacteria | 34013 |
| 364 | Ga0495607_0001181 | 3300046501 | Bacteria | 23575 |
| 365 | Ga0495583_0001184 | 3300046506 | Bacteria | 28099 |
| 366 | Ga0495606_0000203 | 3300046507 | Bacteria | 103887 |
| 367 | Ga0495606_0000348 | 3300046507 | Bacteria | 79254 |
| 368 | Ga0495606_0011126 | 3300046507 | Bacteria | 7374 |
| 369 | Ga0495606_0012465 | 3300046507 | Bacteria | 6812 |
| 370 | Ga0495606_0015136 | 3300046507 | Bacteria | 5966 |
| 371 | Ga0495606_0092844 | 3300046507 | Bacteria | 1853 |
| 372 | Ga0495610_0005537 | 3300046512 | Bacteria | 8937 |
| 373 | Ga0495610_0029071 | 3300046512 | Bacteria | 2915 |
| 374 | Ga0495616_0000116 | 3300046513 | Bacteria | 70266 |
| 375 | Ga0495620_0001776 | 3300046515 | Bacteria | 12690 |
| 376 | Ga0495631_0000477 | 3300046518 | Bacteria | 26777 |
| 377 | Ga0495631_0001682 | 3300046518 | Bacteria | 13157 |
| 378 | Ga0495632_0106178 | 3300046519 | Bacteria | 1321 |
| 379 | Ga0495637_0030148 | 3300046520 | Bacteria | 2407 |
| 380 | Ga0495643_0001155 | 3300046522 | Bacteria | 25858 |
| 381 | Ga0495643_0057370 | 3300046522 | Bacteria | 2075 |
| 382 | Ga0495648_0011255 | 3300046524 | Bacteria | 6753 |
| 383 | Ga0495609_0007688 | 3300046538 | Bacteria | 5350 |
| 384 | Ga0495621_0085911 | 3300046539 | Bacteria | 1179 |
| 385 | Ga0495645_0016277 | 3300046543 | Bacteria | 5306 |
| 386 | Ga0495622_0005779 | 3300046557 | Bacteria | 5740 |
| 387 | Ga0495633_0004487 | 3300046558 | Bacteria | 8855 |
| 388 | Ga0495656_0001524 | 3300046615 | Bacteria | 7572 |
| 389 | Ga0495656_0050481 | 3300046615 | Bacteria | 1776 |
| 390 | Ga0495656_0063067 | 3300046615 | Bacteria | 1623 |
| 391 | Ga0495668_0015091 | 3300046616 | Bacteria | 4518 |
| 392 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 393 | Ga0495611_0000109 | 3300046648 | Bacteria | 57832 |
| 394 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 395 | Ga0495625_0062922 | 3300046660 | Bacteria | 2621 |
| 396 | Ga0495625_0197231 | 3300046660 | Bacteria | 1330 |
| 397 | Ga0495659_0025447 | 3300046664 | Bacteria | 2026 |
| 398 | Ga0495661_0001093 | 3300046665 | Bacteria | 23831 |
| 399 | Ga0495670_0000779 | 3300046691 | Bacteria | 15299 |
| 400 | Ga0495670_0006987 | 3300046691 | Bacteria | 5563 |
| 401 | Ga0495670_0100122 | 3300046691 | Bacteria | 1492 |
| 402 | Ga0495671_0000409 | 3300046692 | Bacteria | 34512 |
| 403 | Ga0495649_0007061 | 3300046694 | Bacteria | 6911 |
| 404 | Ga0495589_0000295 | 3300046794 | Bacteria | 39752 |
| 405 | Ga0495660_0000109 | 3300046810 | Bacteria | 88780 |
| 406 | Ga0495660_0004337 | 3300046810 | Bacteria | 8589 |
| 407 | Ga0495636_0000956 | 3300047318 | Bacteria | 10762 |
| 408 | Ga0495636_0042661 | 3300047318 | Bacteria | 1885 |
| 409 | Ga0495672_0000344 | 3300047320 | Bacteria | 59479 |
| 410 | Ga0495672_0000455 | 3300047320 | Bacteria | 48439 |
| 411 | Ga0495672_0128909 | 3300047320 | Bacteria | 1333 |
| 412 | Ga0495683_0001272 | 3300047323 | Bacteria | 17077 |
| 413 | Ga0495675_0044198 | 3300047444 | Bacteria | 2838 |
| 414 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 415 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 416 | Ga0495673_0000018 | 3300047469 | Bacteria | 569190 |
| 417 | Ga0495673_0000257 | 3300047469 | Bacteria | 73959 |
| 418 | Ga0495681_0063699 | 3300047470 | Bacteria | 1691 |
| 419 | Ga0495684_0094919 | 3300047471 | Bacteria | 2258 |
| 420 | Ga0495686_0004163 | 3300047472 | Bacteria | 12032 |
| 421 | Ga0495686_0005681 | 3300047472 | Bacteria | 9758 |
| 422 | Ga0495686_0009284 | 3300047472 | Bacteria | 7101 |
| 423 | Ga0496101_0020446 | 3300048904 | Bacteria | 4532 |
| 424 | Ga0496101_0253184 | 3300048904 | Bacteria | 1372 |
| 425 | Ga0496102_0316263 | 3300048905 | Bacteria | 1471 |
| 426 | Ga0496104_0165012 | 3300048907 | Bacteria | 2124 |
| 427 | Ga0496106_0006126 | 3300048909 | Bacteria | 8896 |
| 428 | Ga0496106_0256970 | 3300048909 | Bacteria | 1397 |
| 429 | Ga0496107_0105660 | 3300048910 | Bacteria | 2067 |
| 430 | Ga0496108_0024090 | 3300048911 | Bacteria | 5010 |
| 431 | Ga0496109_0370196 | 3300048912 | Bacteria | 1353 |
| 432 | Ga0496111_0135551 | 3300048914 | Bacteria | 1823 |
| 433 | Ga0496116_0021823 | 3300048919 | Bacteria | 4816 |
| 434 | Ga0496116_0044159 | 3300048919 | Bacteria | 3030 |
| 435 | Ga0496116_0052004 | 3300048919 | Bacteria | 2717 |
| 436 | Ga0496116_0175437 | 3300048919 | Bacteria | 1155 |
| 437 | Ga0496117_0001326 | 3300048920 | Bacteria | 36388 |
| 438 | Ga0496117_0003433 | 3300048920 | Bacteria | 18430 |
| 439 | Ga0496117_0020067 | 3300048920 | Bacteria | 5464 |
| 440 | Ga0496117_0038566 | 3300048920 | Bacteria | 3538 |
| 441 | Ga0496117_0064822 | 3300048920 | Bacteria | 2488 |
| 442 | Ga0496118_0000998 | 3300048921 | Bacteria | 44121 |
| 443 | Ga0496118_0002175 | 3300048921 | Bacteria | 27277 |
| 444 | Ga0496118_0003475 | 3300048921 | Bacteria | 19765 |
| 445 | Ga0496118_0020671 | 3300048921 | Bacteria | 5829 |
| 446 | Ga0496118_0024282 | 3300048921 | Bacteria | 5239 |
| 447 | Ga0496118_0029670 | 3300048921 | Bacteria | 4582 |
| 448 | Ga0496118_0045015 | 3300048921 | Bacteria | 3450 |
| 449 | Ga0496119_0000377 | 3300048922 | Bacteria | 61561 |
| 450 | Ga0496119_0000984 | 3300048922 | Bacteria | 36651 |
| 451 | Ga0496119_0015652 | 3300048922 | Bacteria | 5821 |
| 452 | Ga0496120_0000535 | 3300048923 | Bacteria | 58503 |
| 453 | Ga0496120_0000573 | 3300048923 | Bacteria | 56179 |
| 454 | Ga0496121_0000045 | 3300048924 | Bacteria | 336130 |
| 455 | Ga0496121_0000420 | 3300048924 | Bacteria | 83995 |
| 456 | Ga0496121_0008877 | 3300048924 | Bacteria | 11687 |
| 457 | Ga0496121_0010922 | 3300048924 | Bacteria | 10146 |
| 458 | Ga0496121_0012054 | 3300048924 | Bacteria | 9497 |
| 459 | Ga0496122_0001711 | 3300048925 | Bacteria | 34031 |
| 460 | Ga0496122_0053750 | 3300048925 | Bacteria | 3032 |
| 461 | Ga0496122_0170448 | 3300048925 | Bacteria | 1313 |
| 462 | Ga0496122_0210506 | 3300048925 | Bacteria | 1126 |
| 463 | Ga0496123_0000624 | 3300048926 | Bacteria | 59382 |
| 464 | Ga0496123_0011448 | 3300048926 | Bacteria | 7686 |
| 465 | Ga0496124_0000880 | 3300048927 | Bacteria | 48881 |
| 466 | Ga0496124_0007843 | 3300048927 | Bacteria | 11259 |
| 467 | Ga0496124_0017423 | 3300048927 | Bacteria | 6769 |
| 468 | Ga0496124_0024504 | 3300048927 | Bacteria | 5483 |
| 469 | Ga0496124_0123529 | 3300048927 | Bacteria | 2065 |
| 470 | Ga0496125_0013298 | 3300048928 | Bacteria | 8098 |
| 471 | Ga0496125_0015163 | 3300048928 | Bacteria | 7465 |
| 472 | Ga0496125_0017277 | 3300048928 | Bacteria | 6889 |
| 473 | Ga0496125_0025722 | 3300048928 | Bacteria | 5384 |
| 474 | Ga0496125_0116954 | 3300048928 | Bacteria | 1913 |
| 475 | Ga0496126_0001979 | 3300048929 | Bacteria | 29032 |
| 476 | Ga0496126_0028861 | 3300048929 | Bacteria | 5279 |
| 477 | Ga0496126_0187708 | 3300048929 | Bacteria | 1752 |
| 478 | Ga0495678_000312 | 3300049459 | Bacteria | 52223 |
| 479 | Ga0495682_0043352 | 3300049460 | Bacteria | 1647 |
| 480 | Ga0501031_0031664 | 3300049568 | Bacteria | 3450 |
| 481 | Ga0501031_0360890 | 3300049568 | Bacteria | 940 |
| 482 | Ga0501032_0011389 | 3300049569 | Bacteria | 6389 |
| 483 | Ga0501032_0031997 | 3300049569 | Bacteria | 3606 |
| 484 | Ga0501033_0000696 | 3300049570 | Bacteria | 31087 |
| 485 | Ga0501034_0000083 | 3300049571 | Bacteria | 169656 |
| 486 | Ga0501034_0000383 | 3300049571 | Bacteria | 75632 |
| 487 | Ga0501034_0000605 | 3300049571 | Bacteria | 56544 |
| 488 | Ga0501034_0009142 | 3300049571 | Bacteria | 10400 |
| 489 | Ga0501034_0016614 | 3300049571 | Bacteria | 7547 |
| 490 | Ga0501034_0024812 | 3300049571 | Bacteria | 6100 |
| 491 | Ga0501034_0063663 | 3300049571 | Bacteria | 3702 |
| 492 | Ga0501034_0096426 | 3300049571 | Bacteria | 2953 |
| 493 | Ga0501034_0149869 | 3300049571 | Bacteria | 2309 |
| 494 | Ga0501036_0026653 | 3300049572 | Bacteria | 4881 |
| 495 | Ga0501036_0029315 | 3300049572 | Bacteria | 4652 |
| 496 | Ga0501036_0153922 | 3300049572 | Bacteria | 1939 |
| 497 | Ga0501036_0171996 | 3300049572 | Bacteria | 1825 |
| 498 | Ga0501036_0183551 | 3300049572 | Bacteria | 1761 |
| 499 | Ga0501036_0419925 | 3300049572 | Bacteria | 1115 |
| 500 | Ga0501037_0056062 | 3300049573 | Bacteria | 2879 |
| 501 | Ga0501037_0081207 | 3300049573 | Bacteria | 2351 |
| 502 | Ga0501037_0194010 | 3300049573 | Bacteria | 1437 |
| 503 | Ga0501038_0045963 | 3300049574 | Bacteria | 3787 |
| 504 | Ga0501038_0051497 | 3300049574 | Bacteria | 3552 |
| 505 | Ga0501038_0079719 | 3300049574 | Bacteria | 2760 |
| 506 | Ga0501039_0010242 | 3300049575 | Bacteria | 7144 |
| 507 | Ga0501039_0023892 | 3300049575 | Bacteria | 4693 |
| 508 | Ga0501039_0146133 | 3300049575 | Bacteria | 1858 |
| 509 | Ga0501040_0001619 | 3300049576 | Bacteria | 14346 |
| 510 | Ga0501040_0094695 | 3300049576 | Bacteria | 2078 |
| 511 | Ga0501041_0023310 | 3300049577 | Bacteria | 3712 |
| 512 | Ga0501042_0020878 | 3300049578 | Bacteria | 4560 |
| 513 | Ga0501042_0086212 | 3300049578 | Bacteria | 2252 |
| 514 | Ga0501042_0110423 | 3300049578 | Bacteria | 1980 |
| 515 | Ga0501043_0150754 | 3300049579 | Bacteria | 1820 |
| 516 | Ga0501046_0008656 | 3300049580 | Bacteria | 8848 |
| 517 | Ga0501046_0038984 | 3300049580 | Bacteria | 3809 |
| 518 | Ga0501046_0099306 | 3300049580 | Bacteria | 2235 |
| 519 | Ga0501047_0000329 | 3300049581 | Bacteria | 54632 |
| 520 | Ga0501048_0026833 | 3300049582 | Bacteria | 4192 |
| 521 | Ga0501067_0007059 | 3300049583 | Bacteria | 6238 |
| 522 | Ga0501067_0012712 | 3300049583 | Bacteria | 4667 |
| 523 | Ga0501068_0005260 | 3300049584 | Bacteria | 7065 |
| 524 | Ga0501068_0030679 | 3300049584 | Bacteria | 3191 |
| 525 | Ga0501068_0257221 | 3300049584 | Bacteria | 1113 |
| 526 | Ga0501070_0003388 | 3300049586 | Bacteria | 13830 |
| 527 | Ga0501070_0006687 | 3300049586 | Bacteria | 9820 |
| 528 | Ga0501070_0025672 | 3300049586 | Bacteria | 4943 |
| 529 | Ga0501070_0072985 | 3300049586 | Bacteria | 2840 |
| 530 | Ga0501070_0122820 | 3300049586 | Bacteria | 2146 |
| 531 | Ga0501071_0001551 | 3300049587 | Bacteria | 13430 |
| 532 | Ga0501071_0023045 | 3300049587 | Bacteria | 4345 |
| 533 | Ga0501071_0115889 | 3300049587 | Bacteria | 1983 |
| 534 | Ga0501071_0137354 | 3300049587 | Bacteria | 1819 |
| 535 | Ga0501072_0007169 | 3300049588 | Bacteria | 8454 |
| 536 | Ga0501072_0034000 | 3300049588 | Bacteria | 3993 |
| 537 | Ga0501072_0051598 | 3300049588 | Bacteria | 3238 |
| 538 | Ga0501072_0072863 | 3300049588 | Bacteria | 2715 |
| 539 | Ga0501073_0004211 | 3300049589 | Bacteria | 10784 |
| 540 | Ga0501073_0007079 | 3300049589 | Bacteria | 8356 |
| 541 | Ga0501073_0053296 | 3300049589 | Bacteria | 2832 |
| 542 | Ga0501073_0074968 | 3300049589 | Bacteria | 2355 |
| 543 | Ga0501073_0089078 | 3300049589 | Bacteria | 2145 |
| 544 | Ga0501074_0017509 | 3300049590 | Bacteria | 5201 |
| 545 | Ga0501074_0086866 | 3300049590 | Bacteria | 2241 |
| 546 | Ga0501074_0122585 | 3300049590 | Bacteria | 1859 |
| 547 | Ga0501074_0434604 | 3300049590 | Bacteria | 931 |
| 548 | Ga0501075_0033209 | 3300049591 | Bacteria | 3838 |
| 549 | Ga0501075_0056702 | 3300049591 | Bacteria | 2950 |
| 550 | Ga0501076_0008787 | 3300049592 | Bacteria | 7422 |
| 551 | Ga0501076_0012052 | 3300049592 | Bacteria | 6461 |
| 552 | Ga0501076_0115667 | 3300049592 | Bacteria | 2170 |
| 553 | Ga0501077_0032482 | 3300049593 | Bacteria | 3322 |
| 554 | Ga0501077_0102143 | 3300049593 | Bacteria | 1817 |
| 555 | Ga0501217_020871 | 3300049661 | Bacteria | 1543 |
| 556 | Ga0501225_0002077 | 3300049705 | Bacteria | 6225 |
| 557 | Ga0501079_0007069 | 3300049741 | Bacteria | 8470 |
| 558 | Ga0501079_0018659 | 3300049741 | Bacteria | 5299 |
| 559 | Ga0501079_0193152 | 3300049741 | Bacteria | 1589 |
| 560 | Ga0501080_0000831 | 3300049742 | Bacteria | 25188 |
| 561 | Ga0501080_0006072 | 3300049742 | Bacteria | 10828 |
| 562 | Ga0501080_0043093 | 3300049742 | Bacteria | 4201 |
| 563 | Ga0501080_0047373 | 3300049742 | Bacteria | 4001 |
| 564 | Ga0501080_0306181 | 3300049742 | Bacteria | 1440 |
| 565 | Ga0501081_0001812 | 3300049743 | Bacteria | 13265 |
| 566 | Ga0501081_0023856 | 3300049743 | Bacteria | 4103 |
| 567 | Ga0501083_0000763 | 3300049744 | Bacteria | 21055 |
| 568 | Ga0501035_0031769 | 3300049822 | Bacteria | 4809 |
| 569 | Ga0501035_0056395 | 3300049822 | Bacteria | 3505 |
| 570 | Ga0501035_0101172 | 3300049822 | Bacteria | 2529 |
| 571 | Ga0501035_0336563 | 3300049822 | Bacteria | 1265 |
| 572 | Ga0501044_0008158 | 3300049823 | Bacteria | 11493 |
| 573 | Ga0501044_0043010 | 3300049823 | Bacteria | 4695 |
| 574 | Ga0501044_0052936 | 3300049823 | Bacteria | 4178 |
| 575 | Ga0501044_0253843 | 3300049823 | Bacteria | 1698 |
| 576 | Ga0501045_0031909 | 3300049824 | Bacteria | 3816 |
| 577 | nmdc:mga06z11_97613_c1 | 3300050494 | Bacteria | 1606 |
| 578 | nmdc:mga06r32_335741_c1 | 3300050510 | Bacteria | 1496 |
| 579 | nmdc:mga08y16_6375_c1 | 3300050511 | Bacteria | 12372 |
| 580 | nmdc:mga0n895_25067_c1 | 3300050512 | Bacteria | 5631 |
| 581 | nmdc:mga0a205_1685_c1 | 3300050515 | Bacteria | 19075 |
| 582 | Ga0500643_000075 | 3300053087 | Bacteria | 111465 |
| 583 | Ga0500555_000099 | 3300053103 | Bacteria | 40706 |
| 584 | Ga0500562_028288 | 3300053108 | Bacteria | 1473 |
| 585 | Ga0500568_0001378 | 3300053139 | Bacteria | 15779 |
| 586 | Ga0500568_0009406 | 3300053139 | Bacteria | 4647 |
| 587 | Ga0500616_0012566 | 3300053153 | Bacteria | 4952 |
| 588 | Ga0500634_0000105 | 3300053161 | Bacteria | 32265 |
| 589 | Ga0500645_002986 | 3300053730 | Bacteria | 7166 |
| 590 | Ga0500565_000099 | 3300053734 | Bacteria | 4098 |
| 591 | Ga0501084_0055026 | 3300054114 | Bacteria | 3329 |
| 592 | Ga0501084_0195146 | 3300054114 | Bacteria | 1708 |
| 593 | Ga0501084_0212881 | 3300054114 | Bacteria | 1631 |
| 594 | Ga0501082_0000144 | 3300060353 | Bacteria | 59165 |
| 595 | Ga0501082_0003883 | 3300060353 | Bacteria | 13054 |
| 596 | Ga0501082_0012419 | 3300060353 | Bacteria | 7319 |
| 597 | Ga0501082_0029480 | 3300060353 | Bacteria | 4727 |
| 598 | Ga0501082_0143669 | 3300060353 | Bacteria | 2071 |
| 599 | Ga0530510_0031172 | 3300061734 | Bacteria | 3833 |
| 600 | Ga0530510_0075906 | 3300061734 | Bacteria | 2441 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0366495 | Ga0373935_0366495_280_1020 | 239 |
| 2 | 3300042876 | Ga0451577_0826231 | Ga0451577_0826231_81_818 | 239 |
| 3 | 3300046615 | Ga0495656_0063067 | Ga0495656_0063067_122_994 | 253 |
| 4 | 3300049589 | Ga0501073_0074968 | Ga0501073_0074968_361_1140 | 259 |
| 5 | 3300048927 | Ga0496124_0017423 | Ga0496124_0017423_2481_3341 | 278 |
| 6 | 3300049593 | Ga0501077_0102143 | Ga0501077_0102143_511_1353 | 280 |
| 7 | 3300031901 | Ga0307406_10234964 | Ga0307406_102349642 | 281 |
| 8 | iso_pu_bacteria | 2593339238 | 2595446547 | 281 |
| 9 | iso_pu_bacteria | 2593339239 | 2595451927 | 281 |
| 10 | iso_pu_bacteria | 2643221577 | 2643894969 | 281 |
| 11 | iso_pu_bacteria | 2643221685 | 2644477127 | 281 |
| 12 | iso_pu_bacteria | 2718218334 | 2721026802 | 281 |
| 13 | iso_pu_bacteria | 2738543009 | 2739228250 | 281 |
| 14 | iso_pu_bacteria | 2739367700 | 2739731632 | 281 |
| 15 | iso_pu_bacteria | 2818991440 | 2819563121 | 281 |
| 16 | iso_pu_bacteria | 2842918807 | 2842919656 | 281 |
| 17 | iso_pu_bacteria | 2904463128 | 2904463737 | 281 |
| 18 | iso_pu_bacteria | 2919085039 | 2919087771 | 281 |
| 19 | iso_pu_bacteria | 2919404418 | 2919405007 | 281 |
| 20 | iso_pu_bacteria | 2941471342 | 2941472675 | 281 |
| 21 | iso_pu_bacteria | 2953994433 | 2953994956 | 281 |
| 22 | 3300031852 | Ga0307410_10207838 | Ga0307410_102078382 | 282 |
| 23 | 3300031903 | Ga0307407_10020697 | Ga0307407_100206975 | 282 |
| 24 | 3300031995 | Ga0307409_100450889 | Ga0307409_1004508892 | 282 |
| 25 | 3300046558 | Ga0495633_0004487 | Ga0495633_0004487_5948_6820 | 282 |
| 26 | 3300053161 | Ga0500634_0000105 | Ga0500634_0000105_10513_11385 | 282 |
| 27 | iso_pu_bacteria | 2576861471 | 2578457844 | 282 |
| 28 | iso_pu_bacteria | 2747842501 | 2748015834 | 282 |
| 29 | iso_pu_bacteria | 2852649853 | 2852650282 | 282 |
| 30 | iso_pu_bacteria | 2857442823 | 2857446989 | 282 |
| 31 | iso_pu_bacteria | 2939589442 | 2939592906 | 282 |
| 32 | iso_pu_bacteria | 2939622612 | 2939626754 | 282 |
| 33 | iso_pu_bacteria | 2941475908 | 2941476413 | 282 |
| 34 | iso_pu_bacteria | 2974307012 | 2974308445 | 282 |
| 35 | iso_pu_bacteria | 2977247770 | 2977249201 | 282 |
| 36 | iso_pu_bacteria | 2984514374 | 2984516345 | 282 |
| 37 | iso_pu_bacteria | 2987605356 | 2987607295 | 282 |
| 38 | 3300002773 | JGI25152J39213_1000294 | JGI25152J39213_100029429 | 283 |
| 39 | 3300002774 | JGI25150J39212_1000272 | JGI25150J39212_10002725 | 283 |
| 40 | 3300003187 | JGI25151J46595_10000380 | JGI25151J46595_1000038014 | 283 |
| 41 | 3300003215 | JGI25153J46596_10000240 | JGI25153J46596_1000024014 | 283 |
| 42 | 3300003771 | Ga0055526_1004730 | Ga0055526_10047306 | 283 |
| 43 | 3300003773 | Ga0055537_1001514 | Ga0055537_10015146 | 283 |
| 44 | 3300003775 | Ga0055524_1019184 | Ga0055524_10191844 | 283 |
| 45 | 3300003784 | Ga0055534_1000073 | Ga0055534_100007359 | 283 |
| 46 | 3300003790 | Ga0055528_1000080 | Ga0055528_10000806 | 283 |
| 47 | 3300003794 | Ga0055531_10008715 | Ga0055531_100087152 | 283 |
| 48 | 3300003794 | Ga0055531_10023050 | Ga0055531_100230504 | 283 |
| 49 | 3300005344 | Ga0070661_100208297 | Ga0070661_1002082972 | 283 |
| 50 | 3300005354 | Ga0070675_100422159 | Ga0070675_1004221591 | 283 |
| 51 | 3300005434 | Ga0070709_10008561 | Ga0070709_100085614 | 283 |
| 52 | 3300005564 | Ga0070664_100048582 | Ga0070664_1000485824 | 283 |
| 53 | 3300005615 | Ga0070702_100261353 | Ga0070702_1002613531 | 283 |
| 54 | 3300006051 | Ga0075364_10055884 | Ga0075364_100558843 | 283 |
| 55 | 3300006178 | Ga0075367_10060521 | Ga0075367_100605213 | 283 |
| 56 | 3300009011 | Ga0105251_10002382 | Ga0105251_1000238211 | 283 |
| 57 | 3300009148 | Ga0105243_10151836 | Ga0105243_101518362 | 283 |
| 58 | 3300009979 | Ga0105032_101018 | Ga0105032_1010184 | 283 |
| 59 | 3300012487 | Ga0157321_1000872 | Ga0157321_10008722 | 283 |
| 60 | 3300013102 | Ga0157371_10000985 | Ga0157371_1000098517 | 283 |
| 61 | 3300013102 | Ga0157371_10055246 | Ga0157371_100552462 | 283 |
| 62 | 3300013102 | Ga0157371_10076727 | Ga0157371_100767272 | 283 |
| 63 | 3300013104 | Ga0157370_10012159 | Ga0157370_100121598 | 283 |
| 64 | 3300013105 | Ga0157369_10109243 | Ga0157369_101092432 | 283 |
| 65 | 3300014497 | Ga0182008_10002184 | Ga0182008_100021842 | 283 |
| 66 | 3300015262 | Ga0182007_10000277 | Ga0182007_1000027711 | 283 |
| 67 | 3300015262 | Ga0182007_10010728 | Ga0182007_100107282 | 283 |
| 68 | 3300015265 | Ga0182005_1000237 | Ga0182005_100023711 | 283 |
| 69 | 3300017792 | Ga0163161_10007092 | Ga0163161_100070922 | 283 |
| 70 | 3300017792 | Ga0163161_10022768 | Ga0163161_100227682 | 283 |
| 71 | 3300025245 | Ga0207425_1000044 | Ga0207425_10000446 | 283 |
| 72 | 3300025258 | Ga0209129_1000044 | Ga0209129_1000044271 | 283 |
| 73 | 3300025263 | Ga0209565_1000022 | Ga0209565_100002280 | 283 |
| 74 | 3300025273 | Ga0209673_1003462 | Ga0209673_10034628 | 283 |
| 75 | 3300025291 | Ga0209675_1000060 | Ga0209675_100006038 | 283 |
| 76 | 3300025291 | Ga0209675_1025225 | Ga0209675_10252252 | 283 |
| 77 | 3300025292 | Ga0209676_1002126 | Ga0209676_10021262 | 283 |
| 78 | 3300025294 | Ga0209025_1000012 | Ga0209025_1000012230 | 283 |
| 79 | 3300025295 | Ga0209564_1000302 | Ga0209564_100030223 | 283 |
| 80 | 3300025297 | Ga0209758_1000018 | Ga0209758_1000018428 | 283 |
| 81 | 3300025297 | Ga0209758_1008433 | Ga0209758_10084338 | 283 |
| 82 | 3300025304 | Ga0209257_1000251 | Ga0209257_100025196 | 283 |
| 83 | 3300025304 | Ga0209257_1008600 | Ga0209257_10086004 | 283 |
| 84 | 3300025735 | Ga0207713_1025756 | Ga0207713_10257563 | 283 |
| 85 | 3300025907 | Ga0207645_10135673 | Ga0207645_101356732 | 283 |
| 86 | 3300025926 | Ga0207659_10087623 | Ga0207659_100876232 | 283 |
| 87 | 3300026121 | Ga0207683_10102543 | Ga0207683_101025433 | 283 |
| 88 | 3300028379 | Ga0268266_10038006 | Ga0268266_100380062 | 283 |
| 89 | 3300030731 | Ga0316177_1175444 | Ga0316177_11754442 | 283 |
| 90 | 3300030733 | Ga0314311_1113969 | Ga0314311_11139692 | 283 |
| 91 | 3300030735 | Ga0316178_1116314 | Ga0316178_11163143 | 283 |
| 92 | 3300031727 | Ga0316576_10026298 | Ga0316576_100262982 | 283 |
| 93 | 3300031727 | Ga0316576_10110016 | Ga0316576_101100162 | 283 |
| 94 | 3300032004 | Ga0307414_10004347 | Ga0307414_100043474 | 283 |
| 95 | 3300035398 | Ga0316574_0080149 | Ga0316574_0080149_534_1391 | 283 |
| 96 | 3300035398 | Ga0316574_0146766 | Ga0316574_0146766_16_873 | 283 |
| 97 | 3300035398 | Ga0316574_0211076 | Ga0316574_0211076_112_969 | 283 |
| 98 | 3300035398 | Ga0316574_0316944 | Ga0316574_0316944_25_885 | 283 |
| 99 | 3300036712 | Ga0316584_0102094 | Ga0316584_0102094_1264_2121 | 283 |
| 100 | 3300039438 | Ga0436360_0083929 | Ga0436360_0083929_1018_1890 | 283 |
| 101 | 3300041404 | Ga0439436_0011982 | Ga0439436_0011982_922_1800 | 283 |
| 102 | 3300042876 | Ga0451577_0004523 | Ga0451577_0004523_12339_13199 | 283 |
| 103 | 3300044712 | Ga0453684_0002629 | Ga0453684_0002629_9556_10413 | 283 |
| 104 | 3300045051 | Ga0451576_0001728 | Ga0451576_0001728_25540_26397 | 283 |
| 105 | 3300045976 | Ga0466967_0037847 | Ga0466967_0037847_1994_2869 | 283 |
| 106 | 3300046460 | Ga0495638_0001580 | Ga0495638_0001580_12466_13341 | 283 |
| 107 | 3300046460 | Ga0495638_0013747 | Ga0495638_0013747_3088_3963 | 283 |
| 108 | 3300046506 | Ga0495583_0001184 | Ga0495583_0001184_18996_19853 | 283 |
| 109 | 3300046519 | Ga0495632_0106178 | Ga0495632_0106178_169_1026 | 283 |
| 110 | 3300046522 | Ga0495643_0001155 | Ga0495643_0001155_11179_12054 | 283 |
| 111 | 3300046810 | Ga0495660_0004337 | Ga0495660_0004337_2799_3656 | 283 |
| 112 | 3300047320 | Ga0495672_0000344 | Ga0495672_0000344_46305_47162 | 283 |
| 113 | 3300047320 | Ga0495672_0000455 | Ga0495672_0000455_36123_36998 | 283 |
| 114 | 3300047320 | Ga0495672_0128909 | Ga0495672_0128909_196_1071 | 283 |
| 115 | 3300047444 | Ga0495675_0044198 | Ga0495675_0044198_1199_2101 | 283 |
| 116 | 3300047470 | Ga0495681_0063699 | Ga0495681_0063699_373_1248 | 283 |
| 117 | 3300047472 | Ga0495686_0004163 | Ga0495686_0004163_2359_3234 | 283 |
| 118 | 3300047472 | Ga0495686_0009284 | Ga0495686_0009284_1636_2511 | 283 |
| 119 | 3300048919 | Ga0496116_0021823 | Ga0496116_0021823_731_1606 | 283 |
| 120 | 3300048919 | Ga0496116_0044159 | Ga0496116_0044159_2096_2971 | 283 |
| 121 | 3300048919 | Ga0496116_0175437 | Ga0496116_0175437_56_931 | 283 |
| 122 | 3300048920 | Ga0496117_0001326 | Ga0496117_0001326_22874_23749 | 283 |
| 123 | 3300048920 | Ga0496117_0003433 | Ga0496117_0003433_13893_14768 | 283 |
| 124 | 3300048920 | Ga0496117_0038566 | Ga0496117_0038566_408_1283 | 283 |
| 125 | 3300048920 | Ga0496117_0064822 | Ga0496117_0064822_636_1511 | 283 |
| 126 | 3300048921 | Ga0496118_0002175 | Ga0496118_0002175_21959_22834 | 283 |
| 127 | 3300048921 | Ga0496118_0003475 | Ga0496118_0003475_3607_4482 | 283 |
| 128 | 3300048921 | Ga0496118_0020671 | Ga0496118_0020671_3173_4048 | 283 |
| 129 | 3300048921 | Ga0496118_0029670 | Ga0496118_0029670_510_1385 | 283 |
| 130 | 3300048922 | Ga0496119_0000984 | Ga0496119_0000984_11259_12134 | 283 |
| 131 | 3300048923 | Ga0496120_0000535 | Ga0496120_0000535_33109_33984 | 283 |
| 132 | 3300048924 | Ga0496121_0010922 | Ga0496121_0010922_3902_4777 | 283 |
| 133 | 3300048925 | Ga0496122_0001711 | Ga0496122_0001711_10081_10953 | 283 |
| 134 | 3300048925 | Ga0496122_0210506 | Ga0496122_0210506_62_937 | 283 |
| 135 | 3300048926 | Ga0496123_0000624 | Ga0496123_0000624_45396_46268 | 283 |
| 136 | 3300048926 | Ga0496123_0011448 | Ga0496123_0011448_4387_5262 | 283 |
| 137 | 3300048927 | Ga0496124_0007843 | Ga0496124_0007843_3374_4249 | 283 |
| 138 | 3300048927 | Ga0496124_0024504 | Ga0496124_0024504_4346_5221 | 283 |
| 139 | 3300048928 | Ga0496125_0015163 | Ga0496125_0015163_3043_3918 | 283 |
| 140 | 3300048928 | Ga0496125_0017277 | Ga0496125_0017277_2842_3714 | 283 |
| 141 | 3300048928 | Ga0496125_0025722 | Ga0496125_0025722_4457_5332 | 283 |
| 142 | 3300048928 | Ga0496125_0116954 | Ga0496125_0116954_1004_1879 | 283 |
| 143 | 3300048929 | Ga0496126_0001979 | Ga0496126_0001979_20832_21707 | 283 |
| 144 | 3300048929 | Ga0496126_0187708 | Ga0496126_0187708_636_1511 | 283 |
| 145 | 3300049570 | Ga0501033_0000696 | Ga0501033_0000696_28336_29199 | 283 |
| 146 | 3300049571 | Ga0501034_0016614 | Ga0501034_0016614_3272_4144 | 283 |
| 147 | 3300049571 | Ga0501034_0149869 | Ga0501034_0149869_537_1400 | 283 |
| 148 | 3300049574 | Ga0501038_0051497 | Ga0501038_0051497_683_1558 | 283 |
| 149 | 3300049586 | Ga0501070_0025672 | Ga0501070_0025672_2589_3464 | 283 |
| 150 | 3300049822 | Ga0501035_0336563 | Ga0501035_0336563_219_1094 | 283 |
| 151 | 3300050494 | nmdc:mga06z11_97613_c1 | nmdc:mga06z11_97613_c1_538_1413 | 283 |
| 152 | 3300053139 | Ga0500568_0009406 | Ga0500568_0009406_906_1766 | 283 |
| 153 | 3300053153 | Ga0500616_0012566 | Ga0500616_0012566_1473_2333 | 283 |
| 154 | 3300053734 | Ga0500565_000099 | Ga0500565_000099_2844_3719 | 283 |
| 155 | iso_pu_bacteria | 2571042365 | 2572255063 | 283 |
| 156 | iso_pu_bacteria | 2643221559 | 2643817661 | 283 |
| 157 | iso_pu_bacteria | 2643221573 | 2643878883 | 283 |
| 158 | iso_pu_bacteria | 2643221581 | 2643915931 | 283 |
| 159 | iso_pu_bacteria | 2643221586 | 2643940371 | 283 |
| 160 | iso_pu_bacteria | 2643221593 | 2643976666 | 283 |
| 161 | iso_pu_bacteria | 2643221612 | 2644079446 | 283 |
| 162 | iso_pu_bacteria | 2643221695 | 2644529450 | 283 |
| 163 | iso_pu_bacteria | 2643221720 | 2644660199 | 283 |
| 164 | iso_pu_bacteria | 2643221727 | 2644694888 | 283 |
| 165 | iso_pu_bacteria | 2643221728 | 2644697501 | 283 |
| 166 | iso_pu_bacteria | 2842780639 | 2842783827 | 283 |
| 167 | iso_pu_bacteria | 2894414249 | 2894415720 | 283 |
| 168 | iso_pu_bacteria | 2923516293 | 2923518537 | 283 |
| 169 | iso_pu_bacteria | 2941489479 | 2941490517 | 283 |
| 170 | iso_pu_bacteria | 2995948881 | 2995951525 | 283 |
| 171 | iso_pu_bacteria | 8002745576 | 8002746204 | 283 |
| 172 | iso_pu_bacteria | 8002869464 | 8002871934 | 283 |
| 173 | iso_pu_bacteria | 8003014200 | 8003014437 | 283 |
| 174 | 3300003187 | JGI25151J46595_10000148 | JGI25151J46595_1000014846 | 284 |
| 175 | 3300003771 | Ga0055526_1000032 | Ga0055526_100003234 | 284 |
| 176 | 3300003771 | Ga0055526_1008358 | Ga0055526_10083586 | 284 |
| 177 | 3300003773 | Ga0055537_1000308 | Ga0055537_100030819 | 284 |
| 178 | 3300003775 | Ga0055524_1000054 | Ga0055524_100005434 | 284 |
| 179 | 3300003784 | Ga0055534_1000224 | Ga0055534_10002244 | 284 |
| 180 | 3300003790 | Ga0055528_1000021 | Ga0055528_100002182 | 284 |
| 181 | 3300003790 | Ga0055528_1018251 | Ga0055528_10182512 | 284 |
| 182 | 3300003791 | Ga0055530_10009430 | Ga0055530_100094304 | 284 |
| 183 | 3300003794 | Ga0055531_10013111 | Ga0055531_100131111 | 284 |
| 184 | 3300005288 | Ga0065714_10073995 | Ga0065714_100739953 | 284 |
| 185 | 3300005330 | Ga0070690_100111990 | Ga0070690_1001119902 | 284 |
| 186 | 3300005335 | Ga0070666_10014671 | Ga0070666_100146712 | 284 |
| 187 | 3300005336 | Ga0070680_100051193 | Ga0070680_1000511932 | 284 |
| 188 | 3300005339 | Ga0070660_100151860 | Ga0070660_1001518602 | 284 |
| 189 | 3300005347 | Ga0070668_100006634 | Ga0070668_1000066347 | 284 |
| 190 | 3300005347 | Ga0070668_100529690 | Ga0070668_1005296901 | 284 |
| 191 | 3300005353 | Ga0070669_100163965 | Ga0070669_1001639653 | 284 |
| 192 | 3300005354 | Ga0070675_100052632 | Ga0070675_1000526324 | 284 |
| 193 | 3300005354 | Ga0070675_100180021 | Ga0070675_1001800212 | 284 |
| 194 | 3300005355 | Ga0070671_100065050 | Ga0070671_1000650502 | 284 |
| 195 | 3300005545 | Ga0070695_100233358 | Ga0070695_1002333582 | 284 |
| 196 | 3300005549 | Ga0070704_100118479 | Ga0070704_1001184791 | 284 |
| 197 | 3300005564 | Ga0070664_100149160 | Ga0070664_1001491603 | 284 |
| 198 | 3300005618 | Ga0068864_100236506 | Ga0068864_1002365063 | 284 |
| 199 | 3300005841 | Ga0068863_100030981 | Ga0068863_1000309815 | 284 |
| 200 | 3300005843 | Ga0068860_100012548 | Ga0068860_1000125485 | 284 |
| 201 | 3300005844 | Ga0068862_100098307 | Ga0068862_1000983073 | 284 |
| 202 | 3300006844 | Ga0075428_100004151 | Ga0075428_10000415110 | 284 |
| 203 | 3300006844 | Ga0075428_100023196 | Ga0075428_1000231964 | 284 |
| 204 | 3300006846 | Ga0075430_100127914 | Ga0075430_1001279142 | 284 |
| 205 | 3300006847 | Ga0075431_100488703 | Ga0075431_1004887032 | 284 |
| 206 | 3300006852 | Ga0075433_10002485 | Ga0075433_1000248511 | 284 |
| 207 | 3300006871 | Ga0075434_100007796 | Ga0075434_10000779610 | 284 |
| 208 | 3300009094 | Ga0111539_10000362 | Ga0111539_1000036210 | 284 |
| 209 | 3300009147 | Ga0114129_10392702 | Ga0114129_103927022 | 284 |
| 210 | 3300009177 | Ga0105248_10053413 | Ga0105248_100534135 | 284 |
| 211 | 3300009177 | Ga0105248_10589969 | Ga0105248_105899692 | 284 |
| 212 | 3300009553 | Ga0105249_10279848 | Ga0105249_102798481 | 284 |
| 213 | 3300009987 | Ga0105030_100226 | Ga0105030_1002265 | 284 |
| 214 | 3300012512 | Ga0157327_1000290 | Ga0157327_10002903 | 284 |
| 215 | 3300012515 | Ga0157338_1008877 | Ga0157338_10088772 | 284 |
| 216 | 3300013306 | Ga0163162_10396510 | Ga0163162_103965102 | 284 |
| 217 | 3300013308 | Ga0157375_10422413 | Ga0157375_104224132 | 284 |
| 218 | 3300014325 | Ga0163163_10000105 | Ga0163163_1000010522 | 284 |
| 219 | 3300014325 | Ga0163163_10028025 | Ga0163163_100280255 | 284 |
| 220 | 3300014326 | Ga0157380_10000921 | Ga0157380_1000092120 | 284 |
| 221 | 3300014745 | Ga0157377_10060510 | Ga0157377_100605104 | 284 |
| 222 | 3300014968 | Ga0157379_10002099 | Ga0157379_100020992 | 284 |
| 223 | 3300015689 | Ga0183360_10001 | Ga0183360_100011677 | 284 |
| 224 | 3300025245 | Ga0207425_1008227 | Ga0207425_10082273 | 284 |
| 225 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000012134 | 284 |
| 226 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000012134 | 284 |
| 227 | 3300025273 | Ga0209673_1003800 | Ga0209673_10038007 | 284 |
| 228 | 3300025284 | Ga0209130_1004086 | Ga0209130_10040863 | 284 |
| 229 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001398 | 284 |
| 230 | 3300025291 | Ga0209675_1021154 | Ga0209675_10211543 | 284 |
| 231 | 3300025292 | Ga0209676_1002303 | Ga0209676_10023033 | 284 |
| 232 | 3300025292 | Ga0209676_1027133 | Ga0209676_10271332 | 284 |
| 233 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005605 | 284 |
| 234 | 3300025294 | Ga0209025_1001660 | Ga0209025_100166014 | 284 |
| 235 | 3300025295 | Ga0209564_1000001 | Ga0209564_1000001560 | 284 |
| 236 | 3300025295 | Ga0209564_1005489 | Ga0209564_10054896 | 284 |
| 237 | 3300025297 | Ga0209758_1005556 | Ga0209758_10055569 | 284 |
| 238 | 3300025297 | Ga0209758_1052595 | Ga0209758_10525952 | 284 |
| 239 | 3300025297 | Ga0209758_1053392 | Ga0209758_10533922 | 284 |
| 240 | 3300025298 | Ga0209050_1001624 | Ga0209050_10016244 | 284 |
| 241 | 3300025298 | Ga0209050_1033330 | Ga0209050_10333302 | 284 |
| 242 | 3300025299 | Ga0209256_1000002 | Ga0209256_1000002992 | 284 |
| 243 | 3300025304 | Ga0209257_1000145 | Ga0209257_100014536 | 284 |
| 244 | 3300025304 | Ga0209257_1003260 | Ga0209257_10032603 | 284 |
| 245 | 3300025304 | Ga0209257_1003726 | Ga0209257_10037262 | 284 |
| 246 | 3300025304 | Ga0209257_1011752 | Ga0209257_10117525 | 284 |
| 247 | 3300025919 | Ga0207657_10047409 | Ga0207657_100474092 | 284 |
| 248 | 3300025923 | Ga0207681_10462918 | Ga0207681_104629182 | 284 |
| 249 | 3300025940 | Ga0207691_10105600 | Ga0207691_101056002 | 284 |
| 250 | 3300025941 | Ga0207711_10070760 | Ga0207711_100707602 | 284 |
| 251 | 3300025942 | Ga0207689_10085963 | Ga0207689_100859632 | 284 |
| 252 | 3300025944 | Ga0207661_10494802 | Ga0207661_104948022 | 284 |
| 253 | 3300025961 | Ga0207712_10422273 | Ga0207712_104222732 | 284 |
| 254 | 3300025972 | Ga0207668_10022807 | Ga0207668_100228073 | 284 |
| 255 | 3300025972 | Ga0207668_10580698 | Ga0207668_105806982 | 284 |
| 256 | 3300026035 | Ga0207703_10166415 | Ga0207703_101664152 | 284 |
| 257 | 3300026088 | Ga0207641_10057652 | Ga0207641_100576522 | 284 |
| 258 | 3300027462 | Ga0210000_1011151 | Ga0210000_10111512 | 284 |
| 259 | 3300027471 | Ga0209995_1005493 | Ga0209995_10054932 | 284 |
| 260 | 3300027552 | Ga0209982_1001130 | Ga0209982_10011302 | 284 |
| 261 | 3300027614 | Ga0209970_1001680 | Ga0209970_10016802 | 284 |
| 262 | 3300027665 | Ga0209983_1001362 | Ga0209983_10013626 | 284 |
| 263 | 3300027682 | Ga0209971_1005234 | Ga0209971_10052344 | 284 |
| 264 | 3300027682 | Ga0209971_1011062 | Ga0209971_10110623 | 284 |
| 265 | 3300027876 | Ga0209974_10014205 | Ga0209974_100142053 | 284 |
| 266 | 3300027907 | Ga0207428_10001201 | Ga0207428_1000120119 | 284 |
| 267 | 3300028380 | Ga0268265_10078558 | Ga0268265_100785583 | 284 |
| 268 | 3300031548 | Ga0307408_100022099 | Ga0307408_1000220994 | 284 |
| 269 | 3300031548 | Ga0307408_100295415 | Ga0307408_1002954152 | 284 |
| 270 | 3300031665 | Ga0316575_10029031 | Ga0316575_100290314 | 284 |
| 271 | 3300031727 | Ga0316576_10084245 | Ga0316576_100842453 | 284 |
| 272 | 3300031824 | Ga0307413_10073931 | Ga0307413_100739313 | 284 |
| 273 | 3300031824 | Ga0307413_10131826 | Ga0307413_101318262 | 284 |
| 274 | 3300031852 | Ga0307410_10508453 | Ga0307410_105084531 | 284 |
| 275 | 3300031901 | Ga0307406_10080208 | Ga0307406_100802082 | 284 |
| 276 | 3300031911 | Ga0307412_10072671 | Ga0307412_100726714 | 284 |
| 277 | 3300031911 | Ga0307412_10348900 | Ga0307412_103489002 | 284 |
| 278 | 3300031911 | Ga0307412_10395346 | Ga0307412_103953462 | 284 |
| 279 | 3300031995 | Ga0307409_100466715 | Ga0307409_1004667152 | 284 |
| 280 | 3300032004 | Ga0307414_10000412 | Ga0307414_100004126 | 284 |
| 281 | 3300032004 | Ga0307414_10006872 | Ga0307414_100068722 | 284 |
| 282 | 3300032004 | Ga0307414_10028824 | Ga0307414_100288242 | 284 |
| 283 | 3300032004 | Ga0307414_10136033 | Ga0307414_101360334 | 284 |
| 284 | 3300032004 | Ga0307414_10383780 | Ga0307414_103837802 | 284 |
| 285 | 3300032005 | Ga0307411_10062595 | Ga0307411_100625952 | 284 |
| 286 | 3300032005 | Ga0307411_10272286 | Ga0307411_102722861 | 284 |
| 287 | 3300032126 | Ga0307415_100113180 | Ga0307415_1001131802 | 284 |
| 288 | 3300032126 | Ga0307415_100366564 | Ga0307415_1003665642 | 284 |
| 289 | 3300035398 | Ga0316574_0073254 | Ga0316574_0073254_47_904 | 284 |
| 290 | 3300036712 | Ga0316584_0076702 | Ga0316584_0076702_688_1545 | 284 |
| 291 | 3300037312 | Ga0395899_0011157 | Ga0395899_0011157_1437_2339 | 284 |
| 292 | 3300037418 | Ga0395900_0140311 | Ga0395900_0140311_440_1321 | 284 |
| 293 | 3300037418 | Ga0395900_0258126 | Ga0395900_0258126_678_1580 | 284 |
| 294 | 3300037466 | Ga0395898_0051520 | Ga0395898_0051520_1011_1913 | 284 |
| 295 | 3300037471 | Ga0395905_0001851 | Ga0395905_0001851_10942_11844 | 284 |
| 296 | 3300037471 | Ga0395905_0039962 | Ga0395905_0039962_1662_2564 | 284 |
| 297 | 3300039145 | Ga0237816_00339 | Ga0237816_00339_167_1054 | 284 |
| 298 | 3300041404 | Ga0439436_0020163 | Ga0439436_0020163_825_1709 | 284 |
| 299 | 3300041413 | Ga0439465_0000702 | Ga0439465_0000702_5701_6588 | 284 |
| 300 | 3300041413 | Ga0439465_0010662 | Ga0439465_0010662_719_1609 | 284 |
| 301 | 3300041494 | Ga0451837_0284343 | Ga0451837_0284343_273_1184 | 284 |
| 302 | 3300041494 | Ga0451837_1188535 | Ga0451837_1188535_1464_2333 | 284 |
| 303 | 3300041997 | Ga0439431_0038662 | Ga0439431_0038662_236_1093 | 284 |
| 304 | 3300042003 | Ga0439443_005301 | Ga0439443_005301_445_1335 | 284 |
| 305 | 3300042004 | Ga0439445_0004287 | Ga0439445_0004287_1154_2038 | 284 |
| 306 | 3300042006 | Ga0439432_011364 | Ga0439432_011364_1058_1951 | 284 |
| 307 | 3300042010 | Ga0439452_002612 | Ga0439452_002612_5328_6218 | 284 |
| 308 | 3300042015 | Ga0439462_0009397 | Ga0439462_0009397_1134_2027 | 284 |
| 309 | 3300042118 | Ga0450914_005910 | Ga0450914_005910_85_942 | 284 |
| 310 | 3300042122 | Ga0450920_000805 | Ga0450920_000805_3450_4307 | 284 |
| 311 | 3300042125 | Ga0450923_000215 | Ga0450923_000215_1616_2506 | 284 |
| 312 | 3300042125 | Ga0450923_003573 | Ga0450923_003573_798_1673 | 284 |
| 313 | 3300042131 | Ga0450894_001444 | Ga0450894_001444_1872_2747 | 284 |
| 314 | 3300042131 | Ga0450894_002707 | Ga0450894_002707_872_1762 | 284 |
| 315 | 3300042133 | Ga0450896_001045 | Ga0450896_001045_1968_2825 | 284 |
| 316 | 3300042145 | Ga0450906_005714 | Ga0450906_005714_704_1594 | 284 |
| 317 | 3300042156 | Ga0439446_0007777 | Ga0439446_0007777_1666_2556 | 284 |
| 318 | 3300042184 | Ga0450908_000171 | Ga0450908_000171_10646_11503 | 284 |
| 319 | 3300042435 | Ga0439434_0005876 | Ga0439434_0005876_1338_2228 | 284 |
| 320 | 3300042435 | Ga0439434_0033625 | Ga0439434_0033625_15_872 | 284 |
| 321 | 3300042436 | Ga0439435_0017960 | Ga0439435_0017960_229_1119 | 284 |
| 322 | 3300042437 | Ga0439444_0001571 | Ga0439444_0001571_1710_2567 | 284 |
| 323 | 3300042461 | Ga0439460_0033576 | Ga0439460_0033576_313_1203 | 284 |
| 324 | 3300042531 | Ga0450918_006925 | Ga0450918_006925_16_873 | 284 |
| 325 | 3300042876 | Ga0451577_0003018 | Ga0451577_0003018_3843_4730 | 284 |
| 326 | 3300046507 | Ga0495606_0012465 | Ga0495606_0012465_3339_4226 | 284 |
| 327 | 3300046539 | Ga0495621_0085911 | Ga0495621_0085911_273_1157 | 284 |
| 328 | 3300046615 | Ga0495656_0001524 | Ga0495656_0001524_2020_2919 | 284 |
| 329 | 3300046615 | Ga0495656_0050481 | Ga0495656_0050481_209_1093 | 284 |
| 330 | 3300046664 | Ga0495659_0025447 | Ga0495659_0025447_989_1873 | 284 |
| 331 | 3300046691 | Ga0495670_0100122 | Ga0495670_0100122_160_1059 | 284 |
| 332 | 3300047318 | Ga0495636_0000956 | Ga0495636_0000956_9433_10317 | 284 |
| 333 | 3300047318 | Ga0495636_0042661 | Ga0495636_0042661_259_1158 | 284 |
| 334 | 3300048904 | Ga0496101_0253184 | Ga0496101_0253184_263_1165 | 284 |
| 335 | 3300048909 | Ga0496106_0256970 | Ga0496106_0256970_48_932 | 284 |
| 336 | 3300048911 | Ga0496108_0024090 | Ga0496108_0024090_440_1324 | 284 |
| 337 | 3300048912 | Ga0496109_0370196 | Ga0496109_0370196_99_983 | 284 |
| 338 | 3300048914 | Ga0496111_0135551 | Ga0496111_0135551_312_1196 | 284 |
| 339 | 3300048924 | Ga0496121_0012054 | Ga0496121_0012054_1880_2764 | 284 |
| 340 | 3300048927 | Ga0496124_0000880 | Ga0496124_0000880_27744_28631 | 284 |
| 341 | 3300049568 | Ga0501031_0031664 | Ga0501031_0031664_1982_2845 | 284 |
| 342 | 3300049568 | Ga0501031_0360890 | Ga0501031_0360890_37_894 | 284 |
| 343 | 3300049569 | Ga0501032_0031997 | Ga0501032_0031997_743_1600 | 284 |
| 344 | 3300049571 | Ga0501034_0000083 | Ga0501034_0000083_156864_157739 | 284 |
| 345 | 3300049571 | Ga0501034_0000383 | Ga0501034_0000383_43296_44180 | 284 |
| 346 | 3300049571 | Ga0501034_0009142 | Ga0501034_0009142_3186_4046 | 284 |
| 347 | 3300049571 | Ga0501034_0096426 | Ga0501034_0096426_1017_1880 | 284 |
| 348 | 3300049572 | Ga0501036_0026653 | Ga0501036_0026653_2039_2896 | 284 |
| 349 | 3300049572 | Ga0501036_0153922 | Ga0501036_0153922_375_1238 | 284 |
| 350 | 3300049572 | Ga0501036_0171996 | Ga0501036_0171996_46_903 | 284 |
| 351 | 3300049572 | Ga0501036_0419925 | Ga0501036_0419925_219_1076 | 284 |
| 352 | 3300049573 | Ga0501037_0056062 | Ga0501037_0056062_758_1621 | 284 |
| 353 | 3300049573 | Ga0501037_0081207 | Ga0501037_0081207_256_1113 | 284 |
| 354 | 3300049574 | Ga0501038_0045963 | Ga0501038_0045963_2322_3179 | 284 |
| 355 | 3300049574 | Ga0501038_0079719 | Ga0501038_0079719_824_1687 | 284 |
| 356 | 3300049575 | Ga0501039_0010242 | Ga0501039_0010242_898_1755 | 284 |
| 357 | 3300049575 | Ga0501039_0023892 | Ga0501039_0023892_3204_4061 | 284 |
| 358 | 3300049575 | Ga0501039_0146133 | Ga0501039_0146133_280_1137 | 284 |
| 359 | 3300049576 | Ga0501040_0001619 | Ga0501040_0001619_11003_11860 | 284 |
| 360 | 3300049576 | Ga0501040_0094695 | Ga0501040_0094695_888_1745 | 284 |
| 361 | 3300049577 | Ga0501041_0023310 | Ga0501041_0023310_949_1806 | 284 |
| 362 | 3300049578 | Ga0501042_0020878 | Ga0501042_0020878_1853_2710 | 284 |
| 363 | 3300049578 | Ga0501042_0086212 | Ga0501042_0086212_607_1464 | 284 |
| 364 | 3300049578 | Ga0501042_0110423 | Ga0501042_0110423_189_1046 | 284 |
| 365 | 3300049579 | Ga0501043_0150754 | Ga0501043_0150754_743_1600 | 284 |
| 366 | 3300049580 | Ga0501046_0038984 | Ga0501046_0038984_265_1122 | 284 |
| 367 | 3300049580 | Ga0501046_0099306 | Ga0501046_0099306_1157_2014 | 284 |
| 368 | 3300049582 | Ga0501048_0026833 | Ga0501048_0026833_1205_2062 | 284 |
| 369 | 3300049583 | Ga0501067_0012712 | Ga0501067_0012712_2854_3711 | 284 |
| 370 | 3300049584 | Ga0501068_0030679 | Ga0501068_0030679_935_1792 | 284 |
| 371 | 3300049584 | Ga0501068_0257221 | Ga0501068_0257221_225_1082 | 284 |
| 372 | 3300049586 | Ga0501070_0122820 | Ga0501070_0122820_815_1678 | 284 |
| 373 | 3300049587 | Ga0501071_0001551 | Ga0501071_0001551_5490_6347 | 284 |
| 374 | 3300049587 | Ga0501071_0023045 | Ga0501071_0023045_1642_2499 | 284 |
| 375 | 3300049587 | Ga0501071_0115889 | Ga0501071_0115889_190_1047 | 284 |
| 376 | 3300049587 | Ga0501071_0137354 | Ga0501071_0137354_30_887 | 284 |
| 377 | 3300049588 | Ga0501072_0034000 | Ga0501072_0034000_973_1830 | 284 |
| 378 | 3300049588 | Ga0501072_0051598 | Ga0501072_0051598_402_1259 | 284 |
| 379 | 3300049588 | Ga0501072_0072863 | Ga0501072_0072863_861_1718 | 284 |
| 380 | 3300049589 | Ga0501073_0007079 | Ga0501073_0007079_7153_8010 | 284 |
| 381 | 3300049589 | Ga0501073_0053296 | Ga0501073_0053296_950_1807 | 284 |
| 382 | 3300049590 | Ga0501074_0086866 | Ga0501074_0086866_1181_2038 | 284 |
| 383 | 3300049590 | Ga0501074_0434604 | Ga0501074_0434604_35_892 | 284 |
| 384 | 3300049591 | Ga0501075_0033209 | Ga0501075_0033209_375_1232 | 284 |
| 385 | 3300049591 | Ga0501075_0056702 | Ga0501075_0056702_215_1081 | 284 |
| 386 | 3300049592 | Ga0501076_0008787 | Ga0501076_0008787_3505_4362 | 284 |
| 387 | 3300049592 | Ga0501076_0012052 | Ga0501076_0012052_4493_5350 | 284 |
| 388 | 3300049592 | Ga0501076_0115667 | Ga0501076_0115667_878_1735 | 284 |
| 389 | 3300049593 | Ga0501077_0032482 | Ga0501077_0032482_745_1602 | 284 |
| 390 | 3300049661 | Ga0501217_020871 | Ga0501217_020871_535_1419 | 284 |
| 391 | 3300049705 | Ga0501225_0002077 | Ga0501225_0002077_497_1390 | 284 |
| 392 | 3300049741 | Ga0501079_0007069 | Ga0501079_0007069_4347_5204 | 284 |
| 393 | 3300049741 | Ga0501079_0018659 | Ga0501079_0018659_1258_2115 | 284 |
| 394 | 3300049741 | Ga0501079_0193152 | Ga0501079_0193152_714_1571 | 284 |
| 395 | 3300049742 | Ga0501080_0043093 | Ga0501080_0043093_3156_4013 | 284 |
| 396 | 3300049742 | Ga0501080_0047373 | Ga0501080_0047373_1368_2231 | 284 |
| 397 | 3300049743 | Ga0501081_0001812 | Ga0501081_0001812_7951_8808 | 284 |
| 398 | 3300049743 | Ga0501081_0023856 | Ga0501081_0023856_700_1557 | 284 |
| 399 | 3300049822 | Ga0501035_0031769 | Ga0501035_0031769_3781_4638 | 284 |
| 400 | 3300049822 | Ga0501035_0056395 | Ga0501035_0056395_493_1356 | 284 |
| 401 | 3300049822 | Ga0501035_0101172 | Ga0501035_0101172_995_1852 | 284 |
| 402 | 3300049823 | Ga0501044_0052936 | Ga0501044_0052936_1616_2479 | 284 |
| 403 | 3300049824 | Ga0501045_0031909 | Ga0501045_0031909_1513_2370 | 284 |
| 404 | 3300050510 | nmdc:mga06r32_335741_c1 | nmdc:mga06r32_335741_c1_265_1122 | 284 |
| 405 | 3300050511 | nmdc:mga08y16_6375_c1 | nmdc:mga08y16_6375_c1_10565_11428 | 284 |
| 406 | 3300050512 | nmdc:mga0n895_25067_c1 | nmdc:mga0n895_25067_c1_4686_5543 | 284 |
| 407 | 3300050515 | nmdc:mga0a205_1685_c1 | nmdc:mga0a205_1685_c1_17833_18690 | 284 |
| 408 | 3300054114 | Ga0501084_0212881 | Ga0501084_0212881_438_1295 | 284 |
| 409 | 3300060353 | Ga0501082_0003883 | Ga0501082_0003883_2793_3650 | 284 |
| 410 | 3300060353 | Ga0501082_0012419 | Ga0501082_0012419_399_1256 | 284 |
| 411 | 3300060353 | Ga0501082_0029480 | Ga0501082_0029480_2779_3636 | 284 |
| 412 | 3300061734 | Ga0530510_0031172 | Ga0530510_0031172_2669_3529 | 284 |
| 413 | 3300061734 | Ga0530510_0075906 | Ga0530510_0075906_640_1497 | 284 |
| 414 | 3300001904 | JGI24736J21556_1001100 | JGI24736J21556_10011006 | 285 |
| 415 | 3300002773 | JGI25152J39213_1025832 | JGI25152J39213_10258321 | 285 |
| 416 | 3300003214 | JGI25165J46597_1015751 | JGI25165J46597_10157511 | 285 |
| 417 | 3300003320 | rootH2_10014367 | rootH2_100143671 | 285 |
| 418 | 3300005329 | Ga0070683_100143047 | Ga0070683_1001430472 | 285 |
| 419 | 3300005335 | Ga0070666_10001419 | Ga0070666_1000141916 | 285 |
| 420 | 3300005335 | Ga0070666_10042227 | Ga0070666_100422273 | 285 |
| 421 | 3300005337 | Ga0070682_100207131 | Ga0070682_1002071312 | 285 |
| 422 | 3300005338 | Ga0068868_100151594 | Ga0068868_1001515942 | 285 |
| 423 | 3300005344 | Ga0070661_100071859 | Ga0070661_1000718592 | 285 |
| 424 | 3300005355 | Ga0070671_100178302 | Ga0070671_1001783022 | 285 |
| 425 | 3300005365 | Ga0070688_100069421 | Ga0070688_1000694212 | 285 |
| 426 | 3300005367 | Ga0070667_100186491 | Ga0070667_1001864913 | 285 |
| 427 | 3300005437 | Ga0070710_10064647 | Ga0070710_100646473 | 285 |
| 428 | 3300005455 | Ga0070663_100150711 | Ga0070663_1001507113 | 285 |
| 429 | 3300005455 | Ga0070663_100185229 | Ga0070663_1001852292 | 285 |
| 430 | 3300005457 | Ga0070662_100008730 | Ga0070662_1000087305 | 285 |
| 431 | 3300005459 | Ga0068867_100020303 | Ga0068867_1000203032 | 285 |
| 432 | 3300005466 | Ga0070685_10001357 | Ga0070685_1000135714 | 285 |
| 433 | 3300005539 | Ga0068853_100552989 | Ga0068853_1005529891 | 285 |
| 434 | 3300005547 | Ga0070693_100048012 | Ga0070693_1000480122 | 285 |
| 435 | 3300005548 | Ga0070665_100002186 | Ga0070665_10000218619 | 285 |
| 436 | 3300005578 | Ga0068854_100003726 | Ga0068854_1000037266 | 285 |
| 437 | 3300005614 | Ga0068856_100048310 | Ga0068856_1000483105 | 285 |
| 438 | 3300005616 | Ga0068852_100007423 | Ga0068852_1000074233 | 285 |
| 439 | 3300005616 | Ga0068852_100186170 | Ga0068852_1001861702 | 285 |
| 440 | 3300005618 | Ga0068864_100169381 | Ga0068864_1001693814 | 285 |
| 441 | 3300005834 | Ga0068851_10071334 | Ga0068851_100713342 | 285 |
| 442 | 3300005842 | Ga0068858_100002248 | Ga0068858_10000224811 | 285 |
| 443 | 3300005842 | Ga0068858_100140069 | Ga0068858_1001400692 | 285 |
| 444 | 3300006186 | Ga0075369_10023439 | Ga0075369_100234395 | 285 |
| 445 | 3300006237 | Ga0097621_100098562 | Ga0097621_1000985624 | 285 |
| 446 | 3300006881 | Ga0068865_100022084 | Ga0068865_1000220843 | 285 |
| 447 | 3300006881 | Ga0068865_100081305 | Ga0068865_1000813053 | 285 |
| 448 | 3300006881 | Ga0068865_100451244 | Ga0068865_1004512442 | 285 |
| 449 | 3300009093 | Ga0105240_10000961 | Ga0105240_1000096112 | 285 |
| 450 | 3300009093 | Ga0105240_10003082 | Ga0105240_1000308215 | 285 |
| 451 | 3300009093 | Ga0105240_10019507 | Ga0105240_100195074 | 285 |
| 452 | 3300009101 | Ga0105247_10006331 | Ga0105247_100063314 | 285 |
| 453 | 3300009545 | Ga0105237_10206519 | Ga0105237_102065192 | 285 |
| 454 | 3300009545 | Ga0105237_10237459 | Ga0105237_102374592 | 285 |
| 455 | 3300009551 | Ga0105238_10005696 | Ga0105238_100056963 | 285 |
| 456 | 3300009551 | Ga0105238_10007146 | Ga0105238_100071466 | 285 |
| 457 | 3300009551 | Ga0105238_10109505 | Ga0105238_101095053 | 285 |
| 458 | 3300009551 | Ga0105238_10412819 | Ga0105238_104128192 | 285 |
| 459 | 3300009553 | Ga0105249_10001497 | Ga0105249_100014976 | 285 |
| 460 | 3300010375 | Ga0105239_10000041 | Ga0105239_10000041158 | 285 |
| 461 | 3300010375 | Ga0105239_10118967 | Ga0105239_101189672 | 285 |
| 462 | 3300010375 | Ga0105239_10231843 | Ga0105239_102318433 | 285 |
| 463 | 3300013104 | Ga0157370_10005426 | Ga0157370_100054264 | 285 |
| 464 | 3300013104 | Ga0157370_10047852 | Ga0157370_100478523 | 285 |
| 465 | 3300013104 | Ga0157370_10099505 | Ga0157370_100995051 | 285 |
| 466 | 3300013105 | Ga0157369_10001201 | Ga0157369_1000120130 | 285 |
| 467 | 3300013105 | Ga0157369_10219939 | Ga0157369_102199393 | 285 |
| 468 | 3300013296 | Ga0157374_10012378 | Ga0157374_100123786 | 285 |
| 469 | 3300013307 | Ga0157372_10028506 | Ga0157372_100285064 | 285 |
| 470 | 3300013308 | Ga0157375_10122494 | Ga0157375_101224942 | 285 |
| 471 | 3300013308 | Ga0157375_10638721 | Ga0157375_106387212 | 285 |
| 472 | 3300014326 | Ga0157380_10161871 | Ga0157380_101618713 | 285 |
| 473 | 3300014497 | Ga0182008_10016357 | Ga0182008_100163575 | 285 |
| 474 | 3300014968 | Ga0157379_10280121 | Ga0157379_102801212 | 285 |
| 475 | 3300014969 | Ga0157376_10040492 | Ga0157376_100404924 | 285 |
| 476 | 3300015261 | Ga0182006_1000074 | Ga0182006_100007424 | 285 |
| 477 | 3300015261 | Ga0182006_1000714 | Ga0182006_10007149 | 285 |
| 478 | 3300015262 | Ga0182007_10022612 | Ga0182007_100226121 | 285 |
| 479 | 3300015265 | Ga0182005_1000034 | Ga0182005_100003430 | 285 |
| 480 | 3300015265 | Ga0182005_1003954 | Ga0182005_10039542 | 285 |
| 481 | 3300025226 | Ga0209674_100583 | Ga0209674_1005835 | 285 |
| 482 | 3300025228 | Ga0209672_105337 | Ga0209672_1053372 | 285 |
| 483 | 3300025231 | Ga0207427_100112 | Ga0207427_10011292 | 285 |
| 484 | 3300025231 | Ga0207427_106587 | Ga0207427_1065872 | 285 |
| 485 | 3300025233 | Ga0209437_100020 | Ga0209437_10002074 | 285 |
| 486 | 3300025233 | Ga0209437_101569 | Ga0209437_1015694 | 285 |
| 487 | 3300025233 | Ga0209437_112201 | Ga0209437_1122012 | 285 |
| 488 | 3300025254 | Ga0209148_1002648 | Ga0209148_10026485 | 285 |
| 489 | 3300025258 | Ga0209129_1012709 | Ga0209129_10127093 | 285 |
| 490 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020551 | 285 |
| 491 | 3300025261 | Ga0209233_1001529 | Ga0209233_10015296 | 285 |
| 492 | 3300025261 | Ga0209233_1030781 | Ga0209233_10307812 | 285 |
| 493 | 3300025272 | Ga0209455_1012921 | Ga0209455_10129212 | 285 |
| 494 | 3300025297 | Ga0209758_1006287 | Ga0209758_10062873 | 285 |
| 495 | 3300025303 | Ga0209051_1000816 | Ga0209051_10008165 | 285 |
| 496 | 3300025304 | Ga0209257_1041584 | Ga0209257_10415842 | 285 |
| 497 | 3300025321 | Ga0207656_10001973 | Ga0207656_100019736 | 285 |
| 498 | 3300025900 | Ga0207710_10041379 | Ga0207710_100413792 | 285 |
| 499 | 3300025903 | Ga0207680_10001048 | Ga0207680_1000104813 | 285 |
| 500 | 3300025904 | Ga0207647_10000077 | Ga0207647_1000007749 | 285 |
| 501 | 3300025904 | Ga0207647_10000571 | Ga0207647_1000057125 | 285 |
| 502 | 3300025911 | Ga0207654_10000432 | Ga0207654_1000043214 | 285 |
| 503 | 3300025913 | Ga0207695_10000032 | Ga0207695_10000032378 | 285 |
| 504 | 3300025913 | Ga0207695_10004121 | Ga0207695_100041217 | 285 |
| 505 | 3300025913 | Ga0207695_10033630 | Ga0207695_100336305 | 285 |
| 506 | 3300025913 | Ga0207695_10063497 | Ga0207695_100634973 | 285 |
| 507 | 3300025914 | Ga0207671_10056194 | Ga0207671_100561943 | 285 |
| 508 | 3300025920 | Ga0207649_10029268 | Ga0207649_100292683 | 285 |
| 509 | 3300025920 | Ga0207649_10081088 | Ga0207649_100810882 | 285 |
| 510 | 3300025924 | Ga0207694_10000663 | Ga0207694_1000066328 | 285 |
| 511 | 3300025924 | Ga0207694_10002603 | Ga0207694_100026034 | 285 |
| 512 | 3300025926 | Ga0207659_10166056 | Ga0207659_101660563 | 285 |
| 513 | 3300025933 | Ga0207706_10002097 | Ga0207706_100020974 | 285 |
| 514 | 3300025938 | Ga0207704_10024004 | Ga0207704_100240042 | 285 |
| 515 | 3300025938 | Ga0207704_10180458 | Ga0207704_101804583 | 285 |
| 516 | 3300025940 | Ga0207691_10011883 | Ga0207691_100118833 | 285 |
| 517 | 3300025942 | Ga0207689_10091985 | Ga0207689_100919852 | 285 |
| 518 | 3300025961 | Ga0207712_10000241 | Ga0207712_1000024116 | 285 |
| 519 | 3300025981 | Ga0207640_10009475 | Ga0207640_100094754 | 285 |
| 520 | 3300025986 | Ga0207658_10027641 | Ga0207658_100276413 | 285 |
| 521 | 3300025986 | Ga0207658_10249181 | Ga0207658_102491813 | 285 |
| 522 | 3300026035 | Ga0207703_10001114 | Ga0207703_1000111414 | 285 |
| 523 | 3300026041 | Ga0207639_10000627 | Ga0207639_1000062719 | 285 |
| 524 | 3300026067 | Ga0207678_10005139 | Ga0207678_100051397 | 285 |
| 525 | 3300026067 | Ga0207678_10355806 | Ga0207678_103558061 | 285 |
| 526 | 3300026078 | Ga0207702_10241864 | Ga0207702_102418642 | 285 |
| 527 | 3300026095 | Ga0207676_10394099 | Ga0207676_103940992 | 285 |
| 528 | 3300026116 | Ga0207674_10016915 | Ga0207674_100169154 | 285 |
| 529 | 3300026142 | Ga0207698_10042654 | Ga0207698_100426544 | 285 |
| 530 | 3300026142 | Ga0207698_10042677 | Ga0207698_100426773 | 285 |
| 531 | 3300026142 | Ga0207698_10098064 | Ga0207698_100980642 | 285 |
| 532 | 3300027526 | Ga0209968_1014418 | Ga0209968_10144181 | 285 |
| 533 | 3300028379 | Ga0268266_10000013 | Ga0268266_10000013490 | 285 |
| 534 | 3300031911 | Ga0307412_10002109 | Ga0307412_100021097 | 285 |
| 535 | 3300035089 | Ga0373944_0001655 | Ga0373944_0001655_1563_2450 | 285 |
| 536 | 3300035111 | Ga0373923_0050741 | Ga0373923_0050741_220_1107 | 285 |
| 537 | 3300041404 | Ga0439436_0000010 | Ga0439436_0000010_13518_14375 | 285 |
| 538 | 3300041509 | Ga0451843_0168248 | Ga0451843_0168248_4299_5171 | 285 |
| 539 | 3300042007 | Ga0439449_0051328 | Ga0439449_0051328_406_1281 | 285 |
| 540 | 3300042184 | Ga0450908_000103 | Ga0450908_000103_10543_11400 | 285 |
| 541 | 3300044672 | Ga0466982_0000114 | Ga0466982_0000114_14971_15828 | 285 |
| 542 | 3300045976 | Ga0466967_0507747 | Ga0466967_0507747_190_1062 | 285 |
| 543 | 3300046460 | Ga0495638_0000122 | Ga0495638_0000122_93190_94047 | 285 |
| 544 | 3300046460 | Ga0495638_0000458 | Ga0495638_0000458_22448_23305 | 285 |
| 545 | 3300046471 | Ga0495650_0000381 | Ga0495650_0000381_59036_59893 | 285 |
| 546 | 3300046491 | Ga0495584_0001848 | Ga0495584_0001848_11101_11958 | 285 |
| 547 | 3300046492 | Ga0495585_0000046 | Ga0495585_0000046_52770_53627 | 285 |
| 548 | 3300046501 | Ga0495607_0000640 | Ga0495607_0000640_32424_33281 | 285 |
| 549 | 3300046501 | Ga0495607_0001181 | Ga0495607_0001181_17662_18519 | 285 |
| 550 | 3300046507 | Ga0495606_0000203 | Ga0495606_0000203_21876_22733 | 285 |
| 551 | 3300046507 | Ga0495606_0000348 | Ga0495606_0000348_6068_6925 | 285 |
| 552 | 3300046507 | Ga0495606_0011126 | Ga0495606_0011126_6051_6908 | 285 |
| 553 | 3300046507 | Ga0495606_0015136 | Ga0495606_0015136_873_1730 | 285 |
| 554 | 3300046507 | Ga0495606_0092844 | Ga0495606_0092844_467_1324 | 285 |
| 555 | 3300046512 | Ga0495610_0005537 | Ga0495610_0005537_2540_3397 | 285 |
| 556 | 3300046512 | Ga0495610_0029071 | Ga0495610_0029071_706_1563 | 285 |
| 557 | 3300046513 | Ga0495616_0000116 | Ga0495616_0000116_10623_11480 | 285 |
| 558 | 3300046515 | Ga0495620_0001776 | Ga0495620_0001776_9754_10611 | 285 |
| 559 | 3300046518 | Ga0495631_0000477 | Ga0495631_0000477_25407_26264 | 285 |
| 560 | 3300046518 | Ga0495631_0001682 | Ga0495631_0001682_11916_12773 | 285 |
| 561 | 3300046520 | Ga0495637_0030148 | Ga0495637_0030148_817_1674 | 285 |
| 562 | 3300046522 | Ga0495643_0057370 | Ga0495643_0057370_838_1695 | 285 |
| 563 | 3300046524 | Ga0495648_0011255 | Ga0495648_0011255_405_1262 | 285 |
| 564 | 3300046538 | Ga0495609_0007688 | Ga0495609_0007688_801_1658 | 285 |
| 565 | 3300046543 | Ga0495645_0016277 | Ga0495645_0016277_3128_4009 | 285 |
| 566 | 3300046557 | Ga0495622_0005779 | Ga0495622_0005779_2150_3007 | 285 |
| 567 | 3300046616 | Ga0495668_0015091 | Ga0495668_0015091_607_1464 | 285 |
| 568 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_1828505_1829362 | 285 |
| 569 | 3300046648 | Ga0495611_0000109 | Ga0495611_0000109_24192_25049 | 285 |
| 570 | 3300046660 | Ga0495625_0000001 | Ga0495625_0000001_86689_87546 | 285 |
| 571 | 3300046660 | Ga0495625_0062922 | Ga0495625_0062922_829_1686 | 285 |
| 572 | 3300046660 | Ga0495625_0197231 | Ga0495625_0197231_458_1315 | 285 |
| 573 | 3300046665 | Ga0495661_0001093 | Ga0495661_0001093_5347_6204 | 285 |
| 574 | 3300046691 | Ga0495670_0000779 | Ga0495670_0000779_298_1155 | 285 |
| 575 | 3300046691 | Ga0495670_0006987 | Ga0495670_0006987_3511_4368 | 285 |
| 576 | 3300046692 | Ga0495671_0000409 | Ga0495671_0000409_20060_20917 | 285 |
| 577 | 3300046694 | Ga0495649_0007061 | Ga0495649_0007061_4963_5820 | 285 |
| 578 | 3300046794 | Ga0495589_0000295 | Ga0495589_0000295_1400_2257 | 285 |
| 579 | 3300046810 | Ga0495660_0000109 | Ga0495660_0000109_63633_64490 | 285 |
| 580 | 3300047323 | Ga0495683_0001272 | Ga0495683_0001272_6459_7316 | 285 |
| 581 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_1183_2040 | 285 |
| 582 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_15476_16333 | 285 |
| 583 | 3300047469 | Ga0495673_0000018 | Ga0495673_0000018_535425_536282 | 285 |
| 584 | 3300047469 | Ga0495673_0000257 | Ga0495673_0000257_21398_22255 | 285 |
| 585 | 3300047471 | Ga0495684_0094919 | Ga0495684_0094919_555_1436 | 285 |
| 586 | 3300047472 | Ga0495686_0005681 | Ga0495686_0005681_8652_9509 | 285 |
| 587 | 3300048904 | Ga0496101_0020446 | Ga0496101_0020446_904_1761 | 285 |
| 588 | 3300048905 | Ga0496102_0316263 | Ga0496102_0316263_194_1051 | 285 |
| 589 | 3300048907 | Ga0496104_0165012 | Ga0496104_0165012_755_1612 | 285 |
| 590 | 3300048909 | Ga0496106_0006126 | Ga0496106_0006126_2494_3351 | 285 |
| 591 | 3300048910 | Ga0496107_0105660 | Ga0496107_0105660_504_1361 | 285 |
| 592 | 3300048919 | Ga0496116_0052004 | Ga0496116_0052004_1542_2399 | 285 |
| 593 | 3300048920 | Ga0496117_0020067 | Ga0496117_0020067_2233_3090 | 285 |
| 594 | 3300048921 | Ga0496118_0000998 | Ga0496118_0000998_11365_12222 | 285 |
| 595 | 3300048921 | Ga0496118_0024282 | Ga0496118_0024282_4327_5184 | 285 |
| 596 | 3300048921 | Ga0496118_0045015 | Ga0496118_0045015_2285_3163 | 285 |
| 597 | 3300048922 | Ga0496119_0000377 | Ga0496119_0000377_14596_15453 | 285 |
| 598 | 3300048922 | Ga0496119_0015652 | Ga0496119_0015652_1418_2275 | 285 |
| 599 | 3300048923 | Ga0496120_0000573 | Ga0496120_0000573_22915_23772 | 285 |
| 600 | 3300048924 | Ga0496121_0000045 | Ga0496121_0000045_92786_93643 | 285 |
| 601 | 3300048924 | Ga0496121_0000420 | Ga0496121_0000420_7414_8271 | 285 |
| 602 | 3300048924 | Ga0496121_0008877 | Ga0496121_0008877_10558_11415 | 285 |
| 603 | 3300048925 | Ga0496122_0053750 | Ga0496122_0053750_687_1544 | 285 |
| 604 | 3300048925 | Ga0496122_0170448 | Ga0496122_0170448_335_1192 | 285 |
| 605 | 3300048927 | Ga0496124_0123529 | Ga0496124_0123529_250_1107 | 285 |
| 606 | 3300048928 | Ga0496125_0013298 | Ga0496125_0013298_3070_3927 | 285 |
| 607 | 3300048929 | Ga0496126_0028861 | Ga0496126_0028861_4156_5013 | 285 |
| 608 | 3300049459 | Ga0495678_000312 | Ga0495678_000312_33105_33962 | 285 |
| 609 | 3300049460 | Ga0495682_0043352 | Ga0495682_0043352_45_902 | 285 |
| 610 | 3300049569 | Ga0501032_0011389 | Ga0501032_0011389_852_1709 | 285 |
| 611 | 3300049571 | Ga0501034_0000605 | Ga0501034_0000605_1475_2332 | 285 |
| 612 | 3300049571 | Ga0501034_0024812 | Ga0501034_0024812_1082_1939 | 285 |
| 613 | 3300049571 | Ga0501034_0063663 | Ga0501034_0063663_411_1277 | 285 |
| 614 | 3300049572 | Ga0501036_0029315 | Ga0501036_0029315_797_1654 | 285 |
| 615 | 3300049572 | Ga0501036_0183551 | Ga0501036_0183551_642_1508 | 285 |
| 616 | 3300049573 | Ga0501037_0194010 | Ga0501037_0194010_494_1366 | 285 |
| 617 | 3300049580 | Ga0501046_0008656 | Ga0501046_0008656_2997_3863 | 285 |
| 618 | 3300049581 | Ga0501047_0000329 | Ga0501047_0000329_39314_40171 | 285 |
| 619 | 3300049583 | Ga0501067_0007059 | Ga0501067_0007059_3989_4846 | 285 |
| 620 | 3300049584 | Ga0501068_0005260 | Ga0501068_0005260_4759_5616 | 285 |
| 621 | 3300049586 | Ga0501070_0003388 | Ga0501070_0003388_8773_9630 | 285 |
| 622 | 3300049586 | Ga0501070_0006687 | Ga0501070_0006687_273_1130 | 285 |
| 623 | 3300049586 | Ga0501070_0072985 | Ga0501070_0072985_480_1337 | 285 |
| 624 | 3300049588 | Ga0501072_0007169 | Ga0501072_0007169_1855_2712 | 285 |
| 625 | 3300049589 | Ga0501073_0004211 | Ga0501073_0004211_9019_9876 | 285 |
| 626 | 3300049589 | Ga0501073_0089078 | Ga0501073_0089078_788_1654 | 285 |
| 627 | 3300049590 | Ga0501074_0017509 | Ga0501074_0017509_700_1557 | 285 |
| 628 | 3300049590 | Ga0501074_0122585 | Ga0501074_0122585_224_1093 | 285 |
| 629 | 3300049742 | Ga0501080_0000831 | Ga0501080_0000831_3171_4028 | 285 |
| 630 | 3300049742 | Ga0501080_0006072 | Ga0501080_0006072_5417_6274 | 285 |
| 631 | 3300049742 | Ga0501080_0306181 | Ga0501080_0306181_317_1183 | 285 |
| 632 | 3300049744 | Ga0501083_0000763 | Ga0501083_0000763_8536_9393 | 285 |
| 633 | 3300049823 | Ga0501044_0008158 | Ga0501044_0008158_10521_11378 | 285 |
| 634 | 3300049823 | Ga0501044_0043010 | Ga0501044_0043010_292_1149 | 285 |
| 635 | 3300049823 | Ga0501044_0253843 | Ga0501044_0253843_426_1292 | 285 |
| 636 | 3300053087 | Ga0500643_000075 | Ga0500643_000075_96658_97515 | 285 |
| 637 | 3300053103 | Ga0500555_000099 | Ga0500555_000099_38662_39519 | 285 |
| 638 | 3300053108 | Ga0500562_028288 | Ga0500562_028288_471_1328 | 285 |
| 639 | 3300053139 | Ga0500568_0001378 | Ga0500568_0001378_2837_3703 | 285 |
| 640 | 3300053730 | Ga0500645_002986 | Ga0500645_002986_5318_6175 | 285 |
| 641 | 3300054114 | Ga0501084_0055026 | Ga0501084_0055026_1707_2564 | 285 |
| 642 | 3300054114 | Ga0501084_0195146 | Ga0501084_0195146_245_1102 | 285 |
| 643 | 3300060353 | Ga0501082_0000144 | Ga0501082_0000144_50416_51282 | 285 |
| 644 | 3300060353 | Ga0501082_0143669 | Ga0501082_0143669_246_1103 | 285 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4rvc-assembly1.cif.gz_A | structure of atp binding subunit of abc transporter | 0.8971 | 4 | 217 |
| 8eop-assembly1.cif.gz_A | cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state | 0.8771 | 4 | 217 |
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.8728 | 4 | 219 |
| 8fee-assembly1.cif.gz_H | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.871 | 2 | 217 |
| 6xjh-assembly1.cif.gz_D | pmtcd abc exporter without the basket domain at c2 symmetry | 0.8694 | 6 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O86311_2_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9326 | 3 | 217 | 3.40.50.300 |
| af_Q2FWW7_2_234_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9317 | 4 | 217 | 3.40.50.300 |
| af_Q2G1V4_2_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9137 | 2 | 217 | 3.40.50.300 |
| af_Q1RS86_918_1157_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9073 | 1 | 203 | 3.40.50.300 |
| af_A4HRM7_2286_2560_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9068 | 2 | 217 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6L005-F1-model_v4 | ABC transporter domain-containing protein | 0.96 | 2 | 126 |
GO:0005524
GO:0016887 |
| AF-A0A2V9WVQ3-F1-model_v4 | Multidrug ABC transporter ATP-binding protein | 0.9542 | 2 | 144 |
GO:0005524
GO:0016887 |
| AF-A0A2V6L005-F1-model_v4 | ABC transporter domain-containing protein | 0.9527 | 2 | 126 |
GO:0005524
GO:0016887 |
| AF-A0A496QEB7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9435 | 2 | 217 |
GO:0005524
GO:0016887 |
| AF-A0A2G2M205-F1-model_v4 | Multidrug ABC transporter ATP-binding protein | 0.9429 | 1 | 219 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar