F472087

General Info

Members Datasets Scaffolds Average Seq Length
644 370 600 289

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8002745576|8002746204
Length 307
Sequence TNHAAIIEAQGLHKQYGDFKALNDVSFRVLPGRIVGLIGPNGAGKTSLLKGILGLSTLDGGLSVLGLKPMKERTKLLEQVSFIADTAILPSWLKVHQAIDYVAGVHPRFNREKAQAFLAKTTINPKSRIKALSKGMVTQLHLALVMAIDSKLLVLDEPTLGLDIMYRKQFYSSLLEDYFDEQKTILITTHQVEEVENLLTDVLFIDRGHLVLDSSMDDISQRFCQLSVSTEGRHQVLEAGFQPIYEETRLGGASLLFEGVDPETLAAFGKLHTPSIADLFVAKVSSANERRHDESTVSNMQWKEAGQ

Samples

Sample ID Description Type Environment
1 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
8 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221612 Lysobacter sp. Root76 Isolate Unclassified
12 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
13 2643221695 Lysobacter sp. Root494 Isolate Unclassified
14 2643221720 Lysobacter sp. Root916 Isolate Unclassified
15 2643221727 Lysobacter sp. Root96 Isolate Unclassified
16 2643221728 Lysobacter sp. Root983 Isolate Unclassified
17 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
18 2738543009 Luteibacter sp. OK325 Isolate Unclassified
19 2739367700 Dyella sp. YR388 Isolate Unclassified
20 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
21 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
22 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
23 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
24 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
25 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
26 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
27 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
28 2919085039 Luteibacter sp. 1214 Isolate Unclassified
29 2919404418 Luteibacter sp. 3190 Isolate Unclassified
30 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
31 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
32 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
33 2941471342 Luteibacter sp. 621 Isolate Unclassified
34 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
35 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
36 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
37 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
38 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
39 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
40 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
41 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
42 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
43 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
44 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
58 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
114 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
117 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
118 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
203 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
204 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
207 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
231 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
234 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
235 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
236 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
237 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
238 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
239 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
240 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
241 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
242 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
243 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
244 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
245 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
246 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
247 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
248 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
249 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
250 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
251 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
293 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
294 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
309 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
312 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
334 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
335 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
336 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
337 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
344 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
354 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
355 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
358 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
359 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
362 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
368 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
369 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
370 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.17
Metatranscriptomes 0
Isolates 6.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 13.66
Nodule 0
Rhizoplane 1.55
Rhizosphere 72.05
Stem 0
Stem Tuber 0
Unclassified 12.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001100 3300001904 Bacteria 4948
2 JGI25152J39213_1000294 3300002773 Bacteria 32905
3 JGI25152J39213_1025832 3300002773 Bacteria 967
4 JGI25150J39212_1000272 3300002774 Bacteria 27404
5 JGI25151J46595_10000148 3300003187 Bacteria 92040
6 JGI25151J46595_10000380 3300003187 Bacteria 46059
7 JGI25165J46597_1015751 3300003214 Bacteria 1018
8 JGI25153J46596_10000240 3300003215 Bacteria 46059
9 rootH2_10014367 3300003320 Bacteria 1215
10 Ga0055526_1000032 3300003771 Bacteria 143118
11 Ga0055526_1004730 3300003771 Bacteria 8064
12 Ga0055526_1008358 3300003771 Bacteria 5184
13 Ga0055537_1000308 3300003773 Bacteria 33643
14 Ga0055537_1001514 3300003773 Bacteria 8934
15 Ga0055524_1000054 3300003775 Bacteria 143118
16 Ga0055524_1019184 3300003775 Bacteria 2346
17 Ga0055534_1000073 3300003784 Bacteria 77473
18 Ga0055534_1000224 3300003784 Bacteria 41130
19 Ga0055528_1000021 3300003790 Bacteria 143118
20 Ga0055528_1000080 3300003790 Bacteria 75390
21 Ga0055528_1018251 3300003790 Bacteria 2385
22 Ga0055530_10009430 3300003791 Bacteria 3752
23 Ga0055531_10008715 3300003794 Bacteria 5298
24 Ga0055531_10013111 3300003794 Bacteria 3846
25 Ga0055531_10023050 3300003794 Bacteria 2350
26 Ga0065714_10073995 3300005288 Bacteria 3098
27 Ga0070683_100143047 3300005329 Bacteria 2266
28 Ga0070690_100111990 3300005330 Bacteria 1822
29 Ga0070666_10001419 3300005335 Bacteria 14514
30 Ga0070666_10014671 3300005335 Bacteria 4990
31 Ga0070666_10042227 3300005335 Bacteria 3050
32 Ga0070680_100051193 3300005336 Bacteria 3369
33 Ga0070682_100207131 3300005337 Bacteria 1388
34 Ga0068868_100151594 3300005338 Bacteria 1909
35 Ga0070660_100151860 3300005339 Bacteria 1862
36 Ga0070661_100071859 3300005344 Bacteria 2546
37 Ga0070661_100208297 3300005344 Bacteria 1496
38 Ga0070668_100006634 3300005347 Bacteria 8579
39 Ga0070668_100529690 3300005347 Bacteria 1023
40 Ga0070669_100163965 3300005353 Bacteria 1729
41 Ga0070675_100052632 3300005354 Bacteria 3348
42 Ga0070675_100180021 3300005354 Bacteria 1827
43 Ga0070675_100422159 3300005354 Bacteria 1192
44 Ga0070671_100065050 3300005355 Bacteria 3037
45 Ga0070671_100178302 3300005355 Bacteria 1798
46 Ga0070688_100069421 3300005365 Bacteria 2250
47 Ga0070667_100186491 3300005367 Bacteria 1836
48 Ga0070709_10008561 3300005434 Bacteria 5624
49 Ga0070710_10064647 3300005437 Bacteria 2093
50 Ga0070663_100150711 3300005455 Bacteria 1783
51 Ga0070663_100185229 3300005455 Bacteria 1617
52 Ga0070662_100008730 3300005457 Bacteria 6609
53 Ga0068867_100020303 3300005459 Bacteria 4734
54 Ga0070685_10001357 3300005466 Bacteria 12835
55 Ga0068853_100552989 3300005539 Bacteria 1090
56 Ga0070695_100233358 3300005545 Bacteria 1331
57 Ga0070693_100048012 3300005547 Bacteria 2430
58 Ga0070665_100002186 3300005548 Bacteria 21805
59 Ga0070704_100118479 3300005549 Bacteria 2029
60 Ga0070664_100048582 3300005564 Bacteria 3586
61 Ga0070664_100149160 3300005564 Bacteria 2064
62 Ga0068854_100003726 3300005578 Bacteria 9530
63 Ga0068856_100048310 3300005614 Bacteria 4192
64 Ga0070702_100261353 3300005615 Bacteria 1179
65 Ga0068852_100007423 3300005616 Bacteria 8002
66 Ga0068852_100186170 3300005616 Bacteria 1955
67 Ga0068864_100169381 3300005618 Bacteria 1990
68 Ga0068864_100236506 3300005618 Bacteria 1691
69 Ga0068851_10071334 3300005834 Bacteria 1797
70 Ga0068863_100030981 3300005841 Bacteria 5107
71 Ga0068858_100002248 3300005842 Bacteria 19510
72 Ga0068858_100140069 3300005842 Bacteria 2270
73 Ga0068860_100012548 3300005843 Bacteria 8342
74 Ga0068862_100098307 3300005844 Bacteria 2557
75 Ga0075364_10055884 3300006051 Bacteria 2583
76 Ga0075367_10060521 3300006178 Bacteria 2258
77 Ga0075369_10023439 3300006186 Bacteria 2552
78 Ga0097621_100098562 3300006237 Bacteria 2455
79 Ga0075428_100004151 3300006844 Bacteria 15943
80 Ga0075428_100023196 3300006844 Bacteria 6864
81 Ga0075430_100127914 3300006846 Bacteria 2118
82 Ga0075431_100488703 3300006847 Bacteria 1223
83 Ga0075433_10002485 3300006852 Bacteria 14022
84 Ga0075434_100007796 3300006871 Bacteria 9916
85 Ga0068865_100022084 3300006881 Bacteria 4145
86 Ga0068865_100081305 3300006881 Bacteria 2326
87 Ga0068865_100451244 3300006881 Bacteria 1063
88 Ga0105251_10002382 3300009011 Bacteria 14871
89 Ga0105240_10000961 3300009093 Bacteria 51366
90 Ga0105240_10003082 3300009093 Bacteria 26204
91 Ga0105240_10019507 3300009093 Bacteria 9058
92 Ga0111539_10000362 3300009094 Bacteria 55860
93 Ga0105247_10006331 3300009101 Bacteria 7332
94 Ga0114129_10392702 3300009147 Bacteria 1829
95 Ga0105243_10151836 3300009148 Bacteria 1988
96 Ga0105248_10053413 3300009177 Bacteria 4534
97 Ga0105248_10589969 3300009177 Bacteria 1254
98 Ga0105237_10206519 3300009545 Bacteria 1964
99 Ga0105237_10237459 3300009545 Bacteria 1824
100 Ga0105238_10005696 3300009551 Bacteria 12313
101 Ga0105238_10007146 3300009551 Bacteria 11166
102 Ga0105238_10109505 3300009551 Bacteria 2743
103 Ga0105238_10412819 3300009551 Bacteria 1344
104 Ga0105249_10001497 3300009553 Bacteria 20490
105 Ga0105249_10279848 3300009553 Bacteria 1666
106 Ga0105032_101018 3300009979 Bacteria 2612
107 Ga0105030_100226 3300009987 Bacteria 4852
108 Ga0105239_10000041 3300010375 Bacteria 200922
109 Ga0105239_10118967 3300010375 Bacteria 2932
110 Ga0105239_10231843 3300010375 Bacteria 2071
111 Ga0157321_1000872 3300012487 Bacteria 1429
112 Ga0157327_1000290 3300012512 Bacteria 2620
113 Ga0157338_1008877 3300012515 Bacteria 984
114 Ga0157371_10000985 3300013102 Bacteria 31537
115 Ga0157371_10055246 3300013102 Bacteria 2818
116 Ga0157371_10076727 3300013102 Bacteria 2366
117 Ga0157370_10005426 3300013104 Bacteria 14304
118 Ga0157370_10012159 3300013104 Bacteria 8950
119 Ga0157370_10047852 3300013104 Bacteria 4097
120 Ga0157370_10099505 3300013104 Bacteria 2725
121 Ga0157369_10001201 3300013105 Bacteria 32237
122 Ga0157369_10109243 3300013105 Bacteria 2941
123 Ga0157369_10219939 3300013105 Bacteria 1988
124 Ga0157374_10012378 3300013296 Bacteria 7422
125 Ga0163162_10396510 3300013306 Bacteria 1513
126 Ga0157372_10028506 3300013307 Bacteria 6094
127 Ga0157375_10122494 3300013308 Bacteria 2712
128 Ga0157375_10422413 3300013308 Bacteria 1499
129 Ga0157375_10638721 3300013308 Bacteria 1221
130 Ga0163163_10000105 3300014325 Bacteria 89594
131 Ga0163163_10028025 3300014325 Bacteria 5404
132 Ga0157380_10000921 3300014326 Bacteria 18538
133 Ga0157380_10161871 3300014326 Bacteria 1946
134 Ga0182008_10002184 3300014497 Bacteria 12428
135 Ga0182008_10016357 3300014497 Bacteria 3855
136 Ga0157377_10060510 3300014745 Bacteria 2162
137 Ga0157379_10002099 3300014968 Bacteria 16538
138 Ga0157379_10280121 3300014968 Bacteria 1517
139 Ga0157376_10040492 3300014969 Bacteria 3809
140 Ga0182006_1000074 3300015261 Bacteria 130403
141 Ga0182006_1000714 3300015261 Bacteria 22995
142 Ga0182007_10000277 3300015262 Bacteria 34005
143 Ga0182007_10010728 3300015262 Bacteria 3602
144 Ga0182007_10022612 3300015262 Bacteria 2218
145 Ga0182005_1000034 3300015265 Bacteria 180998
146 Ga0182005_1000237 3300015265 Bacteria 35530
147 Ga0182005_1003954 3300015265 Bacteria 4889
148 Ga0183360_10001 3300015689 Bacteria 3943671
149 Ga0163161_10007092 3300017792 Bacteria 7748
150 Ga0163161_10022768 3300017792 Bacteria 4414
151 Ga0209674_100583 3300025226 Bacteria 14107
152 Ga0209672_105337 3300025228 Bacteria 2222
153 Ga0207427_100112 3300025231 Bacteria 109224
154 Ga0207427_106587 3300025231 Bacteria 1453
155 Ga0209437_100020 3300025233 Bacteria 656374
156 Ga0209437_101569 3300025233 Bacteria 5319
157 Ga0209437_112201 3300025233 Bacteria 1261
158 Ga0207425_1000044 3300025245 Bacteria 195202
159 Ga0207425_1008227 3300025245 Bacteria 2686
160 Ga0209148_1002648 3300025254 Bacteria 5797
161 Ga0209129_1000044 3300025258 Bacteria 298971
162 Ga0209129_1012709 3300025258 Bacteria 1907
163 Ga0209233_1000020 3300025261 Bacteria 798224
164 Ga0209233_1001529 3300025261 Bacteria 9067
165 Ga0209233_1030781 3300025261 Bacteria 1261
166 Ga0209565_1000001 3300025263 Bacteria 2950419
167 Ga0209565_1000022 3300025263 Bacteria 390888
168 Ga0209455_1012921 3300025272 Bacteria 1969
169 Ga0209673_1000001 3300025273 Bacteria 3176258
170 Ga0209673_1003462 3300025273 Bacteria 9289
171 Ga0209673_1003800 3300025273 Bacteria 8567
172 Ga0209130_1004086 3300025284 Bacteria 5755
173 Ga0209675_1000001 3300025291 Bacteria 2950293
174 Ga0209675_1000060 3300025291 Bacteria 184316
175 Ga0209675_1021154 3300025291 Bacteria 1740
176 Ga0209675_1025225 3300025291 Bacteria 1503
177 Ga0209676_1002126 3300025292 Bacteria 15145
178 Ga0209676_1002303 3300025292 Bacteria 13908
179 Ga0209676_1027133 3300025292 Bacteria 1806
180 Ga0209025_1000005 3300025294 Bacteria 1272149
181 Ga0209025_1000012 3300025294 Bacteria 924362
182 Ga0209025_1001660 3300025294 Bacteria 27398
183 Ga0209564_1000001 3300025295 Bacteria 3176258
184 Ga0209564_1000302 3300025295 Bacteria 97770
185 Ga0209564_1005489 3300025295 Bacteria 7210
186 Ga0209758_1000018 3300025297 Bacteria 753320
187 Ga0209758_1005556 3300025297 Bacteria 9610
188 Ga0209758_1006287 3300025297 Bacteria 8630
189 Ga0209758_1008433 3300025297 Bacteria 6675
190 Ga0209758_1052595 3300025297 Bacteria 1406
191 Ga0209758_1053392 3300025297 Bacteria 1389
192 Ga0209050_1001624 3300025298 Bacteria 23068
193 Ga0209050_1033330 3300025298 Bacteria 1563
194 Ga0209256_1000002 3300025299 Bacteria 1906740
195 Ga0209051_1000816 3300025303 Bacteria 32306
196 Ga0209257_1000145 3300025304 Bacteria 195152
197 Ga0209257_1000251 3300025304 Bacteria 123796
198 Ga0209257_1003260 3300025304 Bacteria 14202
199 Ga0209257_1003726 3300025304 Bacteria 12652
200 Ga0209257_1008600 3300025304 Bacteria 5739
201 Ga0209257_1011752 3300025304 Bacteria 4161
202 Ga0209257_1041584 3300025304 Bacteria 1362
203 Ga0207656_10001973 3300025321 Bacteria 6834
204 Ga0207713_1025756 3300025735 Bacteria 2708
205 Ga0207710_10041379 3300025900 Bacteria 2044
206 Ga0207680_10001048 3300025903 Bacteria 13045
207 Ga0207647_10000077 3300025904 Bacteria 74952
208 Ga0207647_10000571 3300025904 Bacteria 28746
209 Ga0207645_10135673 3300025907 Bacteria 1602
210 Ga0207654_10000432 3300025911 Bacteria 24010
211 Ga0207695_10000032 3300025913 Bacteria 521283
212 Ga0207695_10004121 3300025913 Bacteria 19965
213 Ga0207695_10033630 3300025913 Bacteria 5587
214 Ga0207695_10063497 3300025913 Bacteria 3807
215 Ga0207671_10056194 3300025914 Bacteria 2916
216 Ga0207657_10047409 3300025919 Bacteria 3758
217 Ga0207649_10029268 3300025920 Bacteria 3252
218 Ga0207649_10081088 3300025920 Bacteria 2100
219 Ga0207681_10462918 3300025923 Bacteria 1033
220 Ga0207694_10000663 3300025924 Bacteria 30981
221 Ga0207694_10002603 3300025924 Bacteria 14630
222 Ga0207659_10087623 3300025926 Bacteria 2318
223 Ga0207659_10166056 3300025926 Bacteria 1737
224 Ga0207706_10002097 3300025933 Bacteria 19509
225 Ga0207704_10024004 3300025938 Bacteria 3297
226 Ga0207704_10180458 3300025938 Bacteria 1525
227 Ga0207691_10011883 3300025940 Bacteria 8355
228 Ga0207691_10105600 3300025940 Bacteria 2509
229 Ga0207711_10070760 3300025941 Bacteria 3026
230 Ga0207689_10085963 3300025942 Bacteria 2585
231 Ga0207689_10091985 3300025942 Bacteria 2492
232 Ga0207661_10494802 3300025944 Bacteria 1117
233 Ga0207712_10000241 3300025961 Bacteria 53803
234 Ga0207712_10422273 3300025961 Bacteria 1125
235 Ga0207668_10022807 3300025972 Bacteria 4012
236 Ga0207668_10580698 3300025972 Bacteria 974
237 Ga0207640_10009475 3300025981 Bacteria 5454
238 Ga0207658_10027641 3300025986 Bacteria 3988
239 Ga0207658_10249181 3300025986 Bacteria 1508
240 Ga0207703_10001114 3300026035 Bacteria 25397
241 Ga0207703_10166415 3300026035 Bacteria 1935
242 Ga0207639_10000627 3300026041 Bacteria 24355
243 Ga0207678_10005139 3300026067 Bacteria 11727
244 Ga0207678_10355806 3300026067 Bacteria 1263
245 Ga0207702_10241864 3300026078 Bacteria 1691
246 Ga0207641_10057652 3300026088 Bacteria 3303
247 Ga0207676_10394099 3300026095 Bacteria 1292
248 Ga0207674_10016915 3300026116 Bacteria 7965
249 Ga0207683_10102543 3300026121 Bacteria 2555
250 Ga0207698_10042654 3300026142 Bacteria 3392
251 Ga0207698_10042677 3300026142 Bacteria 3391
252 Ga0207698_10098064 3300026142 Bacteria 2421
253 Ga0210000_1011151 3300027462 Bacteria 1330
254 Ga0209995_1005493 3300027471 Bacteria 2034
255 Ga0209968_1014418 3300027526 Bacteria 1244
256 Ga0209982_1001130 3300027552 Bacteria 3568
257 Ga0209970_1001680 3300027614 Bacteria 3850
258 Ga0209983_1001362 3300027665 Bacteria 5436
259 Ga0209971_1005234 3300027682 Bacteria 3082
260 Ga0209971_1011062 3300027682 Bacteria 2137
261 Ga0209974_10014205 3300027876 Bacteria 2653
262 Ga0207428_10001201 3300027907 Bacteria 27753
263 Ga0268266_10000013 3300028379 Bacteria 649715
264 Ga0268266_10038006 3300028379 Bacteria 4099
265 Ga0268265_10078558 3300028380 Bacteria 2596
266 Ga0316177_1175444 3300030731 Bacteria 3915
267 Ga0314311_1113969 3300030733 Bacteria 1870
268 Ga0316178_1116314 3300030735 Bacteria 2135
269 Ga0307408_100022099 3300031548 Bacteria 4317
270 Ga0307408_100295415 3300031548 Bacteria 1355
271 Ga0316575_10029031 3300031665 Bacteria 2158
272 Ga0316576_10026298 3300031727 Bacteria 4083
273 Ga0316576_10084245 3300031727 Bacteria 2362
274 Ga0316576_10110016 3300031727 Bacteria 2065
275 Ga0307413_10073931 3300031824 Bacteria 2156
276 Ga0307413_10131826 3300031824 Bacteria 1712
277 Ga0307410_10207838 3300031852 Bacteria 1498
278 Ga0307410_10508453 3300031852 Bacteria 992
279 Ga0307406_10080208 3300031901 Bacteria 2166
280 Ga0307406_10234964 3300031901 Bacteria 1371
281 Ga0307407_10020697 3300031903 Bacteria 3376
282 Ga0307412_10002109 3300031911 Bacteria 11040
283 Ga0307412_10072671 3300031911 Bacteria 2351
284 Ga0307412_10348900 3300031911 Bacteria 1187
285 Ga0307412_10395346 3300031911 Bacteria 1123
286 Ga0307409_100450889 3300031995 Bacteria 1242
287 Ga0307409_100466715 3300031995 Bacteria 1222
288 Ga0307414_10000412 3300032004 Bacteria 23093
289 Ga0307414_10004347 3300032004 Bacteria 7692
290 Ga0307414_10006872 3300032004 Bacteria 6367
291 Ga0307414_10028824 3300032004 Bacteria 3605
292 Ga0307414_10136033 3300032004 Bacteria 1916
293 Ga0307414_10383780 3300032004 Bacteria 1215
294 Ga0307411_10062595 3300032005 Bacteria 2482
295 Ga0307411_10272286 3300032005 Bacteria 1343
296 Ga0307415_100113180 3300032126 Bacteria 2017
297 Ga0307415_100366564 3300032126 Bacteria 1218
298 Ga0373944_0001655 3300035089 Bacteria 5634
299 Ga0373923_0050741 3300035111 Bacteria 1739
300 Ga0316574_0073254 3300035398 Bacteria 2165
301 Ga0316574_0080149 3300035398 Bacteria 2072
302 Ga0316574_0146766 3300035398 Bacteria 1520
303 Ga0316574_0211076 3300035398 Bacteria 1246
304 Ga0316574_0316944 3300035398 Bacteria 990
305 Ga0373935_0366495 3300035692 Bacteria 1030
306 Ga0316584_0076702 3300036712 Bacteria 2504
307 Ga0316584_0102094 3300036712 Bacteria 2148
308 Ga0395899_0011157 3300037312 Bacteria 6885
309 Ga0395900_0140311 3300037418 Bacteria 2475
310 Ga0395900_0258126 3300037418 Bacteria 1741
311 Ga0395898_0051520 3300037466 Bacteria 4025
312 Ga0395905_0001851 3300037471 Bacteria 24380
313 Ga0395905_0039962 3300037471 Bacteria 4401
314 Ga0237816_00339 3300039145 Bacteria 3959
315 Ga0436360_0083929 3300039438 Bacteria 2043
316 Ga0439436_0000010 3300041404 Bacteria 104480
317 Ga0439436_0011982 3300041404 Bacteria 2633
318 Ga0439436_0020163 3300041404 Bacteria 1986
319 Ga0439465_0000702 3300041413 Bacteria 10279
320 Ga0439465_0010662 3300041413 Bacteria 2884
321 Ga0451837_0284343 3300041494 Bacteria 2346
322 Ga0451837_1188535 3300041494 Bacteria 2494
323 Ga0451843_0168248 3300041509 Bacteria 6794
324 Ga0439431_0038662 3300041997 Bacteria 1208
325 Ga0439443_005301 3300042003 Bacteria 1718
326 Ga0439445_0004287 3300042004 Bacteria 3227
327 Ga0439432_011364 3300042006 Bacteria 3069
328 Ga0439449_0051328 3300042007 Bacteria 1525
329 Ga0439452_002612 3300042010 Bacteria 6591
330 Ga0439462_0009397 3300042015 Bacteria 2473
331 Ga0450914_005910 3300042118 Bacteria 1055
332 Ga0450920_000805 3300042122 Bacteria 5054
333 Ga0450923_000215 3300042125 Bacteria 5522
334 Ga0450923_003573 3300042125 Bacteria 2364
335 Ga0450894_001444 3300042131 Bacteria 3416
336 Ga0450894_002707 3300042131 Bacteria 2352
337 Ga0450896_001045 3300042133 Bacteria 3248
338 Ga0450906_005714 3300042145 Bacteria 2541
339 Ga0439446_0007777 3300042156 Bacteria 2825
340 Ga0450908_000103 3300042184 Bacteria 17093
341 Ga0450908_000171 3300042184 Bacteria 13660
342 Ga0439434_0005876 3300042435 Bacteria 3585
343 Ga0439434_0033625 3300042435 Bacteria 1564
344 Ga0439435_0017960 3300042436 Bacteria 1794
345 Ga0439444_0001571 3300042437 Bacteria 3004
346 Ga0439460_0033576 3300042461 Bacteria 1474
347 Ga0450918_006925 3300042531 Bacteria 2014
348 Ga0451577_0003018 3300042876 Bacteria 19168
349 Ga0451577_0004523 3300042876 Bacteria 14640
350 Ga0451577_0826231 3300042876 Bacteria 836
351 Ga0466982_0000114 3300044672 Bacteria 19966
352 Ga0453684_0002629 3300044712 Bacteria 42920
353 Ga0451576_0001728 3300045051 Bacteria 35952
354 Ga0466967_0037847 3300045976 Bacteria 4133
355 Ga0466967_0507747 3300045976 Bacteria 1184
356 Ga0495638_0000122 3300046460 Bacteria 125872
357 Ga0495638_0000458 3300046460 Bacteria 48869
358 Ga0495638_0001580 3300046460 Bacteria 20408
359 Ga0495638_0013747 3300046460 Bacteria 5498
360 Ga0495650_0000381 3300046471 Bacteria 76364
361 Ga0495584_0001848 3300046491 Bacteria 12259
362 Ga0495585_0000046 3300046492 Bacteria 120969
363 Ga0495607_0000640 3300046501 Bacteria 34013
364 Ga0495607_0001181 3300046501 Bacteria 23575
365 Ga0495583_0001184 3300046506 Bacteria 28099
366 Ga0495606_0000203 3300046507 Bacteria 103887
367 Ga0495606_0000348 3300046507 Bacteria 79254
368 Ga0495606_0011126 3300046507 Bacteria 7374
369 Ga0495606_0012465 3300046507 Bacteria 6812
370 Ga0495606_0015136 3300046507 Bacteria 5966
371 Ga0495606_0092844 3300046507 Bacteria 1853
372 Ga0495610_0005537 3300046512 Bacteria 8937
373 Ga0495610_0029071 3300046512 Bacteria 2915
374 Ga0495616_0000116 3300046513 Bacteria 70266
375 Ga0495620_0001776 3300046515 Bacteria 12690
376 Ga0495631_0000477 3300046518 Bacteria 26777
377 Ga0495631_0001682 3300046518 Bacteria 13157
378 Ga0495632_0106178 3300046519 Bacteria 1321
379 Ga0495637_0030148 3300046520 Bacteria 2407
380 Ga0495643_0001155 3300046522 Bacteria 25858
381 Ga0495643_0057370 3300046522 Bacteria 2075
382 Ga0495648_0011255 3300046524 Bacteria 6753
383 Ga0495609_0007688 3300046538 Bacteria 5350
384 Ga0495621_0085911 3300046539 Bacteria 1179
385 Ga0495645_0016277 3300046543 Bacteria 5306
386 Ga0495622_0005779 3300046557 Bacteria 5740
387 Ga0495633_0004487 3300046558 Bacteria 8855
388 Ga0495656_0001524 3300046615 Bacteria 7572
389 Ga0495656_0050481 3300046615 Bacteria 1776
390 Ga0495656_0063067 3300046615 Bacteria 1623
391 Ga0495668_0015091 3300046616 Bacteria 4518
392 Ga0495611_0000001 3300046648 Bacteria 2628469
393 Ga0495611_0000109 3300046648 Bacteria 57832
394 Ga0495625_0000001 3300046660 Bacteria 1641829
395 Ga0495625_0062922 3300046660 Bacteria 2621
396 Ga0495625_0197231 3300046660 Bacteria 1330
397 Ga0495659_0025447 3300046664 Bacteria 2026
398 Ga0495661_0001093 3300046665 Bacteria 23831
399 Ga0495670_0000779 3300046691 Bacteria 15299
400 Ga0495670_0006987 3300046691 Bacteria 5563
401 Ga0495670_0100122 3300046691 Bacteria 1492
402 Ga0495671_0000409 3300046692 Bacteria 34512
403 Ga0495649_0007061 3300046694 Bacteria 6911
404 Ga0495589_0000295 3300046794 Bacteria 39752
405 Ga0495660_0000109 3300046810 Bacteria 88780
406 Ga0495660_0004337 3300046810 Bacteria 8589
407 Ga0495636_0000956 3300047318 Bacteria 10762
408 Ga0495636_0042661 3300047318 Bacteria 1885
409 Ga0495672_0000344 3300047320 Bacteria 59479
410 Ga0495672_0000455 3300047320 Bacteria 48439
411 Ga0495672_0128909 3300047320 Bacteria 1333
412 Ga0495683_0001272 3300047323 Bacteria 17077
413 Ga0495675_0044198 3300047444 Bacteria 2838
414 Ga0495679_000004 3300047446 Bacteria 748056
415 Ga0495673_0000001 3300047469 Bacteria 1630730
416 Ga0495673_0000018 3300047469 Bacteria 569190
417 Ga0495673_0000257 3300047469 Bacteria 73959
418 Ga0495681_0063699 3300047470 Bacteria 1691
419 Ga0495684_0094919 3300047471 Bacteria 2258
420 Ga0495686_0004163 3300047472 Bacteria 12032
421 Ga0495686_0005681 3300047472 Bacteria 9758
422 Ga0495686_0009284 3300047472 Bacteria 7101
423 Ga0496101_0020446 3300048904 Bacteria 4532
424 Ga0496101_0253184 3300048904 Bacteria 1372
425 Ga0496102_0316263 3300048905 Bacteria 1471
426 Ga0496104_0165012 3300048907 Bacteria 2124
427 Ga0496106_0006126 3300048909 Bacteria 8896
428 Ga0496106_0256970 3300048909 Bacteria 1397
429 Ga0496107_0105660 3300048910 Bacteria 2067
430 Ga0496108_0024090 3300048911 Bacteria 5010
431 Ga0496109_0370196 3300048912 Bacteria 1353
432 Ga0496111_0135551 3300048914 Bacteria 1823
433 Ga0496116_0021823 3300048919 Bacteria 4816
434 Ga0496116_0044159 3300048919 Bacteria 3030
435 Ga0496116_0052004 3300048919 Bacteria 2717
436 Ga0496116_0175437 3300048919 Bacteria 1155
437 Ga0496117_0001326 3300048920 Bacteria 36388
438 Ga0496117_0003433 3300048920 Bacteria 18430
439 Ga0496117_0020067 3300048920 Bacteria 5464
440 Ga0496117_0038566 3300048920 Bacteria 3538
441 Ga0496117_0064822 3300048920 Bacteria 2488
442 Ga0496118_0000998 3300048921 Bacteria 44121
443 Ga0496118_0002175 3300048921 Bacteria 27277
444 Ga0496118_0003475 3300048921 Bacteria 19765
445 Ga0496118_0020671 3300048921 Bacteria 5829
446 Ga0496118_0024282 3300048921 Bacteria 5239
447 Ga0496118_0029670 3300048921 Bacteria 4582
448 Ga0496118_0045015 3300048921 Bacteria 3450
449 Ga0496119_0000377 3300048922 Bacteria 61561
450 Ga0496119_0000984 3300048922 Bacteria 36651
451 Ga0496119_0015652 3300048922 Bacteria 5821
452 Ga0496120_0000535 3300048923 Bacteria 58503
453 Ga0496120_0000573 3300048923 Bacteria 56179
454 Ga0496121_0000045 3300048924 Bacteria 336130
455 Ga0496121_0000420 3300048924 Bacteria 83995
456 Ga0496121_0008877 3300048924 Bacteria 11687
457 Ga0496121_0010922 3300048924 Bacteria 10146
458 Ga0496121_0012054 3300048924 Bacteria 9497
459 Ga0496122_0001711 3300048925 Bacteria 34031
460 Ga0496122_0053750 3300048925 Bacteria 3032
461 Ga0496122_0170448 3300048925 Bacteria 1313
462 Ga0496122_0210506 3300048925 Bacteria 1126
463 Ga0496123_0000624 3300048926 Bacteria 59382
464 Ga0496123_0011448 3300048926 Bacteria 7686
465 Ga0496124_0000880 3300048927 Bacteria 48881
466 Ga0496124_0007843 3300048927 Bacteria 11259
467 Ga0496124_0017423 3300048927 Bacteria 6769
468 Ga0496124_0024504 3300048927 Bacteria 5483
469 Ga0496124_0123529 3300048927 Bacteria 2065
470 Ga0496125_0013298 3300048928 Bacteria 8098
471 Ga0496125_0015163 3300048928 Bacteria 7465
472 Ga0496125_0017277 3300048928 Bacteria 6889
473 Ga0496125_0025722 3300048928 Bacteria 5384
474 Ga0496125_0116954 3300048928 Bacteria 1913
475 Ga0496126_0001979 3300048929 Bacteria 29032
476 Ga0496126_0028861 3300048929 Bacteria 5279
477 Ga0496126_0187708 3300048929 Bacteria 1752
478 Ga0495678_000312 3300049459 Bacteria 52223
479 Ga0495682_0043352 3300049460 Bacteria 1647
480 Ga0501031_0031664 3300049568 Bacteria 3450
481 Ga0501031_0360890 3300049568 Bacteria 940
482 Ga0501032_0011389 3300049569 Bacteria 6389
483 Ga0501032_0031997 3300049569 Bacteria 3606
484 Ga0501033_0000696 3300049570 Bacteria 31087
485 Ga0501034_0000083 3300049571 Bacteria 169656
486 Ga0501034_0000383 3300049571 Bacteria 75632
487 Ga0501034_0000605 3300049571 Bacteria 56544
488 Ga0501034_0009142 3300049571 Bacteria 10400
489 Ga0501034_0016614 3300049571 Bacteria 7547
490 Ga0501034_0024812 3300049571 Bacteria 6100
491 Ga0501034_0063663 3300049571 Bacteria 3702
492 Ga0501034_0096426 3300049571 Bacteria 2953
493 Ga0501034_0149869 3300049571 Bacteria 2309
494 Ga0501036_0026653 3300049572 Bacteria 4881
495 Ga0501036_0029315 3300049572 Bacteria 4652
496 Ga0501036_0153922 3300049572 Bacteria 1939
497 Ga0501036_0171996 3300049572 Bacteria 1825
498 Ga0501036_0183551 3300049572 Bacteria 1761
499 Ga0501036_0419925 3300049572 Bacteria 1115
500 Ga0501037_0056062 3300049573 Bacteria 2879
501 Ga0501037_0081207 3300049573 Bacteria 2351
502 Ga0501037_0194010 3300049573 Bacteria 1437
503 Ga0501038_0045963 3300049574 Bacteria 3787
504 Ga0501038_0051497 3300049574 Bacteria 3552
505 Ga0501038_0079719 3300049574 Bacteria 2760
506 Ga0501039_0010242 3300049575 Bacteria 7144
507 Ga0501039_0023892 3300049575 Bacteria 4693
508 Ga0501039_0146133 3300049575 Bacteria 1858
509 Ga0501040_0001619 3300049576 Bacteria 14346
510 Ga0501040_0094695 3300049576 Bacteria 2078
511 Ga0501041_0023310 3300049577 Bacteria 3712
512 Ga0501042_0020878 3300049578 Bacteria 4560
513 Ga0501042_0086212 3300049578 Bacteria 2252
514 Ga0501042_0110423 3300049578 Bacteria 1980
515 Ga0501043_0150754 3300049579 Bacteria 1820
516 Ga0501046_0008656 3300049580 Bacteria 8848
517 Ga0501046_0038984 3300049580 Bacteria 3809
518 Ga0501046_0099306 3300049580 Bacteria 2235
519 Ga0501047_0000329 3300049581 Bacteria 54632
520 Ga0501048_0026833 3300049582 Bacteria 4192
521 Ga0501067_0007059 3300049583 Bacteria 6238
522 Ga0501067_0012712 3300049583 Bacteria 4667
523 Ga0501068_0005260 3300049584 Bacteria 7065
524 Ga0501068_0030679 3300049584 Bacteria 3191
525 Ga0501068_0257221 3300049584 Bacteria 1113
526 Ga0501070_0003388 3300049586 Bacteria 13830
527 Ga0501070_0006687 3300049586 Bacteria 9820
528 Ga0501070_0025672 3300049586 Bacteria 4943
529 Ga0501070_0072985 3300049586 Bacteria 2840
530 Ga0501070_0122820 3300049586 Bacteria 2146
531 Ga0501071_0001551 3300049587 Bacteria 13430
532 Ga0501071_0023045 3300049587 Bacteria 4345
533 Ga0501071_0115889 3300049587 Bacteria 1983
534 Ga0501071_0137354 3300049587 Bacteria 1819
535 Ga0501072_0007169 3300049588 Bacteria 8454
536 Ga0501072_0034000 3300049588 Bacteria 3993
537 Ga0501072_0051598 3300049588 Bacteria 3238
538 Ga0501072_0072863 3300049588 Bacteria 2715
539 Ga0501073_0004211 3300049589 Bacteria 10784
540 Ga0501073_0007079 3300049589 Bacteria 8356
541 Ga0501073_0053296 3300049589 Bacteria 2832
542 Ga0501073_0074968 3300049589 Bacteria 2355
543 Ga0501073_0089078 3300049589 Bacteria 2145
544 Ga0501074_0017509 3300049590 Bacteria 5201
545 Ga0501074_0086866 3300049590 Bacteria 2241
546 Ga0501074_0122585 3300049590 Bacteria 1859
547 Ga0501074_0434604 3300049590 Bacteria 931
548 Ga0501075_0033209 3300049591 Bacteria 3838
549 Ga0501075_0056702 3300049591 Bacteria 2950
550 Ga0501076_0008787 3300049592 Bacteria 7422
551 Ga0501076_0012052 3300049592 Bacteria 6461
552 Ga0501076_0115667 3300049592 Bacteria 2170
553 Ga0501077_0032482 3300049593 Bacteria 3322
554 Ga0501077_0102143 3300049593 Bacteria 1817
555 Ga0501217_020871 3300049661 Bacteria 1543
556 Ga0501225_0002077 3300049705 Bacteria 6225
557 Ga0501079_0007069 3300049741 Bacteria 8470
558 Ga0501079_0018659 3300049741 Bacteria 5299
559 Ga0501079_0193152 3300049741 Bacteria 1589
560 Ga0501080_0000831 3300049742 Bacteria 25188
561 Ga0501080_0006072 3300049742 Bacteria 10828
562 Ga0501080_0043093 3300049742 Bacteria 4201
563 Ga0501080_0047373 3300049742 Bacteria 4001
564 Ga0501080_0306181 3300049742 Bacteria 1440
565 Ga0501081_0001812 3300049743 Bacteria 13265
566 Ga0501081_0023856 3300049743 Bacteria 4103
567 Ga0501083_0000763 3300049744 Bacteria 21055
568 Ga0501035_0031769 3300049822 Bacteria 4809
569 Ga0501035_0056395 3300049822 Bacteria 3505
570 Ga0501035_0101172 3300049822 Bacteria 2529
571 Ga0501035_0336563 3300049822 Bacteria 1265
572 Ga0501044_0008158 3300049823 Bacteria 11493
573 Ga0501044_0043010 3300049823 Bacteria 4695
574 Ga0501044_0052936 3300049823 Bacteria 4178
575 Ga0501044_0253843 3300049823 Bacteria 1698
576 Ga0501045_0031909 3300049824 Bacteria 3816
577 nmdc:mga06z11_97613_c1 3300050494 Bacteria 1606
578 nmdc:mga06r32_335741_c1 3300050510 Bacteria 1496
579 nmdc:mga08y16_6375_c1 3300050511 Bacteria 12372
580 nmdc:mga0n895_25067_c1 3300050512 Bacteria 5631
581 nmdc:mga0a205_1685_c1 3300050515 Bacteria 19075
582 Ga0500643_000075 3300053087 Bacteria 111465
583 Ga0500555_000099 3300053103 Bacteria 40706
584 Ga0500562_028288 3300053108 Bacteria 1473
585 Ga0500568_0001378 3300053139 Bacteria 15779
586 Ga0500568_0009406 3300053139 Bacteria 4647
587 Ga0500616_0012566 3300053153 Bacteria 4952
588 Ga0500634_0000105 3300053161 Bacteria 32265
589 Ga0500645_002986 3300053730 Bacteria 7166
590 Ga0500565_000099 3300053734 Bacteria 4098
591 Ga0501084_0055026 3300054114 Bacteria 3329
592 Ga0501084_0195146 3300054114 Bacteria 1708
593 Ga0501084_0212881 3300054114 Bacteria 1631
594 Ga0501082_0000144 3300060353 Bacteria 59165
595 Ga0501082_0003883 3300060353 Bacteria 13054
596 Ga0501082_0012419 3300060353 Bacteria 7319
597 Ga0501082_0029480 3300060353 Bacteria 4727
598 Ga0501082_0143669 3300060353 Bacteria 2071
599 Ga0530510_0031172 3300061734 Bacteria 3833
600 Ga0530510_0075906 3300061734 Bacteria 2441

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0366495 Ga0373935_0366495_280_1020 239
2 3300042876 Ga0451577_0826231 Ga0451577_0826231_81_818 239
3 3300046615 Ga0495656_0063067 Ga0495656_0063067_122_994 253
4 3300049589 Ga0501073_0074968 Ga0501073_0074968_361_1140 259
5 3300048927 Ga0496124_0017423 Ga0496124_0017423_2481_3341 278
6 3300049593 Ga0501077_0102143 Ga0501077_0102143_511_1353 280
7 3300031901 Ga0307406_10234964 Ga0307406_102349642 281
8 iso_pu_bacteria 2593339238 2595446547 281
9 iso_pu_bacteria 2593339239 2595451927 281
10 iso_pu_bacteria 2643221577 2643894969 281
11 iso_pu_bacteria 2643221685 2644477127 281
12 iso_pu_bacteria 2718218334 2721026802 281
13 iso_pu_bacteria 2738543009 2739228250 281
14 iso_pu_bacteria 2739367700 2739731632 281
15 iso_pu_bacteria 2818991440 2819563121 281
16 iso_pu_bacteria 2842918807 2842919656 281
17 iso_pu_bacteria 2904463128 2904463737 281
18 iso_pu_bacteria 2919085039 2919087771 281
19 iso_pu_bacteria 2919404418 2919405007 281
20 iso_pu_bacteria 2941471342 2941472675 281
21 iso_pu_bacteria 2953994433 2953994956 281
22 3300031852 Ga0307410_10207838 Ga0307410_102078382 282
23 3300031903 Ga0307407_10020697 Ga0307407_100206975 282
24 3300031995 Ga0307409_100450889 Ga0307409_1004508892 282
25 3300046558 Ga0495633_0004487 Ga0495633_0004487_5948_6820 282
26 3300053161 Ga0500634_0000105 Ga0500634_0000105_10513_11385 282
27 iso_pu_bacteria 2576861471 2578457844 282
28 iso_pu_bacteria 2747842501 2748015834 282
29 iso_pu_bacteria 2852649853 2852650282 282
30 iso_pu_bacteria 2857442823 2857446989 282
31 iso_pu_bacteria 2939589442 2939592906 282
32 iso_pu_bacteria 2939622612 2939626754 282
33 iso_pu_bacteria 2941475908 2941476413 282
34 iso_pu_bacteria 2974307012 2974308445 282
35 iso_pu_bacteria 2977247770 2977249201 282
36 iso_pu_bacteria 2984514374 2984516345 282
37 iso_pu_bacteria 2987605356 2987607295 282
38 3300002773 JGI25152J39213_1000294 JGI25152J39213_100029429 283
39 3300002774 JGI25150J39212_1000272 JGI25150J39212_10002725 283
40 3300003187 JGI25151J46595_10000380 JGI25151J46595_1000038014 283
41 3300003215 JGI25153J46596_10000240 JGI25153J46596_1000024014 283
42 3300003771 Ga0055526_1004730 Ga0055526_10047306 283
43 3300003773 Ga0055537_1001514 Ga0055537_10015146 283
44 3300003775 Ga0055524_1019184 Ga0055524_10191844 283
45 3300003784 Ga0055534_1000073 Ga0055534_100007359 283
46 3300003790 Ga0055528_1000080 Ga0055528_10000806 283
47 3300003794 Ga0055531_10008715 Ga0055531_100087152 283
48 3300003794 Ga0055531_10023050 Ga0055531_100230504 283
49 3300005344 Ga0070661_100208297 Ga0070661_1002082972 283
50 3300005354 Ga0070675_100422159 Ga0070675_1004221591 283
51 3300005434 Ga0070709_10008561 Ga0070709_100085614 283
52 3300005564 Ga0070664_100048582 Ga0070664_1000485824 283
53 3300005615 Ga0070702_100261353 Ga0070702_1002613531 283
54 3300006051 Ga0075364_10055884 Ga0075364_100558843 283
55 3300006178 Ga0075367_10060521 Ga0075367_100605213 283
56 3300009011 Ga0105251_10002382 Ga0105251_1000238211 283
57 3300009148 Ga0105243_10151836 Ga0105243_101518362 283
58 3300009979 Ga0105032_101018 Ga0105032_1010184 283
59 3300012487 Ga0157321_1000872 Ga0157321_10008722 283
60 3300013102 Ga0157371_10000985 Ga0157371_1000098517 283
61 3300013102 Ga0157371_10055246 Ga0157371_100552462 283
62 3300013102 Ga0157371_10076727 Ga0157371_100767272 283
63 3300013104 Ga0157370_10012159 Ga0157370_100121598 283
64 3300013105 Ga0157369_10109243 Ga0157369_101092432 283
65 3300014497 Ga0182008_10002184 Ga0182008_100021842 283
66 3300015262 Ga0182007_10000277 Ga0182007_1000027711 283
67 3300015262 Ga0182007_10010728 Ga0182007_100107282 283
68 3300015265 Ga0182005_1000237 Ga0182005_100023711 283
69 3300017792 Ga0163161_10007092 Ga0163161_100070922 283
70 3300017792 Ga0163161_10022768 Ga0163161_100227682 283
71 3300025245 Ga0207425_1000044 Ga0207425_10000446 283
72 3300025258 Ga0209129_1000044 Ga0209129_1000044271 283
73 3300025263 Ga0209565_1000022 Ga0209565_100002280 283
74 3300025273 Ga0209673_1003462 Ga0209673_10034628 283
75 3300025291 Ga0209675_1000060 Ga0209675_100006038 283
76 3300025291 Ga0209675_1025225 Ga0209675_10252252 283
77 3300025292 Ga0209676_1002126 Ga0209676_10021262 283
78 3300025294 Ga0209025_1000012 Ga0209025_1000012230 283
79 3300025295 Ga0209564_1000302 Ga0209564_100030223 283
80 3300025297 Ga0209758_1000018 Ga0209758_1000018428 283
81 3300025297 Ga0209758_1008433 Ga0209758_10084338 283
82 3300025304 Ga0209257_1000251 Ga0209257_100025196 283
83 3300025304 Ga0209257_1008600 Ga0209257_10086004 283
84 3300025735 Ga0207713_1025756 Ga0207713_10257563 283
85 3300025907 Ga0207645_10135673 Ga0207645_101356732 283
86 3300025926 Ga0207659_10087623 Ga0207659_100876232 283
87 3300026121 Ga0207683_10102543 Ga0207683_101025433 283
88 3300028379 Ga0268266_10038006 Ga0268266_100380062 283
89 3300030731 Ga0316177_1175444 Ga0316177_11754442 283
90 3300030733 Ga0314311_1113969 Ga0314311_11139692 283
91 3300030735 Ga0316178_1116314 Ga0316178_11163143 283
92 3300031727 Ga0316576_10026298 Ga0316576_100262982 283
93 3300031727 Ga0316576_10110016 Ga0316576_101100162 283
94 3300032004 Ga0307414_10004347 Ga0307414_100043474 283
95 3300035398 Ga0316574_0080149 Ga0316574_0080149_534_1391 283
96 3300035398 Ga0316574_0146766 Ga0316574_0146766_16_873 283
97 3300035398 Ga0316574_0211076 Ga0316574_0211076_112_969 283
98 3300035398 Ga0316574_0316944 Ga0316574_0316944_25_885 283
99 3300036712 Ga0316584_0102094 Ga0316584_0102094_1264_2121 283
100 3300039438 Ga0436360_0083929 Ga0436360_0083929_1018_1890 283
101 3300041404 Ga0439436_0011982 Ga0439436_0011982_922_1800 283
102 3300042876 Ga0451577_0004523 Ga0451577_0004523_12339_13199 283
103 3300044712 Ga0453684_0002629 Ga0453684_0002629_9556_10413 283
104 3300045051 Ga0451576_0001728 Ga0451576_0001728_25540_26397 283
105 3300045976 Ga0466967_0037847 Ga0466967_0037847_1994_2869 283
106 3300046460 Ga0495638_0001580 Ga0495638_0001580_12466_13341 283
107 3300046460 Ga0495638_0013747 Ga0495638_0013747_3088_3963 283
108 3300046506 Ga0495583_0001184 Ga0495583_0001184_18996_19853 283
109 3300046519 Ga0495632_0106178 Ga0495632_0106178_169_1026 283
110 3300046522 Ga0495643_0001155 Ga0495643_0001155_11179_12054 283
111 3300046810 Ga0495660_0004337 Ga0495660_0004337_2799_3656 283
112 3300047320 Ga0495672_0000344 Ga0495672_0000344_46305_47162 283
113 3300047320 Ga0495672_0000455 Ga0495672_0000455_36123_36998 283
114 3300047320 Ga0495672_0128909 Ga0495672_0128909_196_1071 283
115 3300047444 Ga0495675_0044198 Ga0495675_0044198_1199_2101 283
116 3300047470 Ga0495681_0063699 Ga0495681_0063699_373_1248 283
117 3300047472 Ga0495686_0004163 Ga0495686_0004163_2359_3234 283
118 3300047472 Ga0495686_0009284 Ga0495686_0009284_1636_2511 283
119 3300048919 Ga0496116_0021823 Ga0496116_0021823_731_1606 283
120 3300048919 Ga0496116_0044159 Ga0496116_0044159_2096_2971 283
121 3300048919 Ga0496116_0175437 Ga0496116_0175437_56_931 283
122 3300048920 Ga0496117_0001326 Ga0496117_0001326_22874_23749 283
123 3300048920 Ga0496117_0003433 Ga0496117_0003433_13893_14768 283
124 3300048920 Ga0496117_0038566 Ga0496117_0038566_408_1283 283
125 3300048920 Ga0496117_0064822 Ga0496117_0064822_636_1511 283
126 3300048921 Ga0496118_0002175 Ga0496118_0002175_21959_22834 283
127 3300048921 Ga0496118_0003475 Ga0496118_0003475_3607_4482 283
128 3300048921 Ga0496118_0020671 Ga0496118_0020671_3173_4048 283
129 3300048921 Ga0496118_0029670 Ga0496118_0029670_510_1385 283
130 3300048922 Ga0496119_0000984 Ga0496119_0000984_11259_12134 283
131 3300048923 Ga0496120_0000535 Ga0496120_0000535_33109_33984 283
132 3300048924 Ga0496121_0010922 Ga0496121_0010922_3902_4777 283
133 3300048925 Ga0496122_0001711 Ga0496122_0001711_10081_10953 283
134 3300048925 Ga0496122_0210506 Ga0496122_0210506_62_937 283
135 3300048926 Ga0496123_0000624 Ga0496123_0000624_45396_46268 283
136 3300048926 Ga0496123_0011448 Ga0496123_0011448_4387_5262 283
137 3300048927 Ga0496124_0007843 Ga0496124_0007843_3374_4249 283
138 3300048927 Ga0496124_0024504 Ga0496124_0024504_4346_5221 283
139 3300048928 Ga0496125_0015163 Ga0496125_0015163_3043_3918 283
140 3300048928 Ga0496125_0017277 Ga0496125_0017277_2842_3714 283
141 3300048928 Ga0496125_0025722 Ga0496125_0025722_4457_5332 283
142 3300048928 Ga0496125_0116954 Ga0496125_0116954_1004_1879 283
143 3300048929 Ga0496126_0001979 Ga0496126_0001979_20832_21707 283
144 3300048929 Ga0496126_0187708 Ga0496126_0187708_636_1511 283
145 3300049570 Ga0501033_0000696 Ga0501033_0000696_28336_29199 283
146 3300049571 Ga0501034_0016614 Ga0501034_0016614_3272_4144 283
147 3300049571 Ga0501034_0149869 Ga0501034_0149869_537_1400 283
148 3300049574 Ga0501038_0051497 Ga0501038_0051497_683_1558 283
149 3300049586 Ga0501070_0025672 Ga0501070_0025672_2589_3464 283
150 3300049822 Ga0501035_0336563 Ga0501035_0336563_219_1094 283
151 3300050494 nmdc:mga06z11_97613_c1 nmdc:mga06z11_97613_c1_538_1413 283
152 3300053139 Ga0500568_0009406 Ga0500568_0009406_906_1766 283
153 3300053153 Ga0500616_0012566 Ga0500616_0012566_1473_2333 283
154 3300053734 Ga0500565_000099 Ga0500565_000099_2844_3719 283
155 iso_pu_bacteria 2571042365 2572255063 283
156 iso_pu_bacteria 2643221559 2643817661 283
157 iso_pu_bacteria 2643221573 2643878883 283
158 iso_pu_bacteria 2643221581 2643915931 283
159 iso_pu_bacteria 2643221586 2643940371 283
160 iso_pu_bacteria 2643221593 2643976666 283
161 iso_pu_bacteria 2643221612 2644079446 283
162 iso_pu_bacteria 2643221695 2644529450 283
163 iso_pu_bacteria 2643221720 2644660199 283
164 iso_pu_bacteria 2643221727 2644694888 283
165 iso_pu_bacteria 2643221728 2644697501 283
166 iso_pu_bacteria 2842780639 2842783827 283
167 iso_pu_bacteria 2894414249 2894415720 283
168 iso_pu_bacteria 2923516293 2923518537 283
169 iso_pu_bacteria 2941489479 2941490517 283
170 iso_pu_bacteria 2995948881 2995951525 283
171 iso_pu_bacteria 8002745576 8002746204 283
172 iso_pu_bacteria 8002869464 8002871934 283
173 iso_pu_bacteria 8003014200 8003014437 283
174 3300003187 JGI25151J46595_10000148 JGI25151J46595_1000014846 284
175 3300003771 Ga0055526_1000032 Ga0055526_100003234 284
176 3300003771 Ga0055526_1008358 Ga0055526_10083586 284
177 3300003773 Ga0055537_1000308 Ga0055537_100030819 284
178 3300003775 Ga0055524_1000054 Ga0055524_100005434 284
179 3300003784 Ga0055534_1000224 Ga0055534_10002244 284
180 3300003790 Ga0055528_1000021 Ga0055528_100002182 284
181 3300003790 Ga0055528_1018251 Ga0055528_10182512 284
182 3300003791 Ga0055530_10009430 Ga0055530_100094304 284
183 3300003794 Ga0055531_10013111 Ga0055531_100131111 284
184 3300005288 Ga0065714_10073995 Ga0065714_100739953 284
185 3300005330 Ga0070690_100111990 Ga0070690_1001119902 284
186 3300005335 Ga0070666_10014671 Ga0070666_100146712 284
187 3300005336 Ga0070680_100051193 Ga0070680_1000511932 284
188 3300005339 Ga0070660_100151860 Ga0070660_1001518602 284
189 3300005347 Ga0070668_100006634 Ga0070668_1000066347 284
190 3300005347 Ga0070668_100529690 Ga0070668_1005296901 284
191 3300005353 Ga0070669_100163965 Ga0070669_1001639653 284
192 3300005354 Ga0070675_100052632 Ga0070675_1000526324 284
193 3300005354 Ga0070675_100180021 Ga0070675_1001800212 284
194 3300005355 Ga0070671_100065050 Ga0070671_1000650502 284
195 3300005545 Ga0070695_100233358 Ga0070695_1002333582 284
196 3300005549 Ga0070704_100118479 Ga0070704_1001184791 284
197 3300005564 Ga0070664_100149160 Ga0070664_1001491603 284
198 3300005618 Ga0068864_100236506 Ga0068864_1002365063 284
199 3300005841 Ga0068863_100030981 Ga0068863_1000309815 284
200 3300005843 Ga0068860_100012548 Ga0068860_1000125485 284
201 3300005844 Ga0068862_100098307 Ga0068862_1000983073 284
202 3300006844 Ga0075428_100004151 Ga0075428_10000415110 284
203 3300006844 Ga0075428_100023196 Ga0075428_1000231964 284
204 3300006846 Ga0075430_100127914 Ga0075430_1001279142 284
205 3300006847 Ga0075431_100488703 Ga0075431_1004887032 284
206 3300006852 Ga0075433_10002485 Ga0075433_1000248511 284
207 3300006871 Ga0075434_100007796 Ga0075434_10000779610 284
208 3300009094 Ga0111539_10000362 Ga0111539_1000036210 284
209 3300009147 Ga0114129_10392702 Ga0114129_103927022 284
210 3300009177 Ga0105248_10053413 Ga0105248_100534135 284
211 3300009177 Ga0105248_10589969 Ga0105248_105899692 284
212 3300009553 Ga0105249_10279848 Ga0105249_102798481 284
213 3300009987 Ga0105030_100226 Ga0105030_1002265 284
214 3300012512 Ga0157327_1000290 Ga0157327_10002903 284
215 3300012515 Ga0157338_1008877 Ga0157338_10088772 284
216 3300013306 Ga0163162_10396510 Ga0163162_103965102 284
217 3300013308 Ga0157375_10422413 Ga0157375_104224132 284
218 3300014325 Ga0163163_10000105 Ga0163163_1000010522 284
219 3300014325 Ga0163163_10028025 Ga0163163_100280255 284
220 3300014326 Ga0157380_10000921 Ga0157380_1000092120 284
221 3300014745 Ga0157377_10060510 Ga0157377_100605104 284
222 3300014968 Ga0157379_10002099 Ga0157379_100020992 284
223 3300015689 Ga0183360_10001 Ga0183360_100011677 284
224 3300025245 Ga0207425_1008227 Ga0207425_10082273 284
225 3300025263 Ga0209565_1000001 Ga0209565_10000012134 284
226 3300025273 Ga0209673_1000001 Ga0209673_10000012134 284
227 3300025273 Ga0209673_1003800 Ga0209673_10038007 284
228 3300025284 Ga0209130_1004086 Ga0209130_10040863 284
229 3300025291 Ga0209675_1000001 Ga0209675_1000001398 284
230 3300025291 Ga0209675_1021154 Ga0209675_10211543 284
231 3300025292 Ga0209676_1002303 Ga0209676_10023033 284
232 3300025292 Ga0209676_1027133 Ga0209676_10271332 284
233 3300025294 Ga0209025_1000005 Ga0209025_1000005605 284
234 3300025294 Ga0209025_1001660 Ga0209025_100166014 284
235 3300025295 Ga0209564_1000001 Ga0209564_1000001560 284
236 3300025295 Ga0209564_1005489 Ga0209564_10054896 284
237 3300025297 Ga0209758_1005556 Ga0209758_10055569 284
238 3300025297 Ga0209758_1052595 Ga0209758_10525952 284
239 3300025297 Ga0209758_1053392 Ga0209758_10533922 284
240 3300025298 Ga0209050_1001624 Ga0209050_10016244 284
241 3300025298 Ga0209050_1033330 Ga0209050_10333302 284
242 3300025299 Ga0209256_1000002 Ga0209256_1000002992 284
243 3300025304 Ga0209257_1000145 Ga0209257_100014536 284
244 3300025304 Ga0209257_1003260 Ga0209257_10032603 284
245 3300025304 Ga0209257_1003726 Ga0209257_10037262 284
246 3300025304 Ga0209257_1011752 Ga0209257_10117525 284
247 3300025919 Ga0207657_10047409 Ga0207657_100474092 284
248 3300025923 Ga0207681_10462918 Ga0207681_104629182 284
249 3300025940 Ga0207691_10105600 Ga0207691_101056002 284
250 3300025941 Ga0207711_10070760 Ga0207711_100707602 284
251 3300025942 Ga0207689_10085963 Ga0207689_100859632 284
252 3300025944 Ga0207661_10494802 Ga0207661_104948022 284
253 3300025961 Ga0207712_10422273 Ga0207712_104222732 284
254 3300025972 Ga0207668_10022807 Ga0207668_100228073 284
255 3300025972 Ga0207668_10580698 Ga0207668_105806982 284
256 3300026035 Ga0207703_10166415 Ga0207703_101664152 284
257 3300026088 Ga0207641_10057652 Ga0207641_100576522 284
258 3300027462 Ga0210000_1011151 Ga0210000_10111512 284
259 3300027471 Ga0209995_1005493 Ga0209995_10054932 284
260 3300027552 Ga0209982_1001130 Ga0209982_10011302 284
261 3300027614 Ga0209970_1001680 Ga0209970_10016802 284
262 3300027665 Ga0209983_1001362 Ga0209983_10013626 284
263 3300027682 Ga0209971_1005234 Ga0209971_10052344 284
264 3300027682 Ga0209971_1011062 Ga0209971_10110623 284
265 3300027876 Ga0209974_10014205 Ga0209974_100142053 284
266 3300027907 Ga0207428_10001201 Ga0207428_1000120119 284
267 3300028380 Ga0268265_10078558 Ga0268265_100785583 284
268 3300031548 Ga0307408_100022099 Ga0307408_1000220994 284
269 3300031548 Ga0307408_100295415 Ga0307408_1002954152 284
270 3300031665 Ga0316575_10029031 Ga0316575_100290314 284
271 3300031727 Ga0316576_10084245 Ga0316576_100842453 284
272 3300031824 Ga0307413_10073931 Ga0307413_100739313 284
273 3300031824 Ga0307413_10131826 Ga0307413_101318262 284
274 3300031852 Ga0307410_10508453 Ga0307410_105084531 284
275 3300031901 Ga0307406_10080208 Ga0307406_100802082 284
276 3300031911 Ga0307412_10072671 Ga0307412_100726714 284
277 3300031911 Ga0307412_10348900 Ga0307412_103489002 284
278 3300031911 Ga0307412_10395346 Ga0307412_103953462 284
279 3300031995 Ga0307409_100466715 Ga0307409_1004667152 284
280 3300032004 Ga0307414_10000412 Ga0307414_100004126 284
281 3300032004 Ga0307414_10006872 Ga0307414_100068722 284
282 3300032004 Ga0307414_10028824 Ga0307414_100288242 284
283 3300032004 Ga0307414_10136033 Ga0307414_101360334 284
284 3300032004 Ga0307414_10383780 Ga0307414_103837802 284
285 3300032005 Ga0307411_10062595 Ga0307411_100625952 284
286 3300032005 Ga0307411_10272286 Ga0307411_102722861 284
287 3300032126 Ga0307415_100113180 Ga0307415_1001131802 284
288 3300032126 Ga0307415_100366564 Ga0307415_1003665642 284
289 3300035398 Ga0316574_0073254 Ga0316574_0073254_47_904 284
290 3300036712 Ga0316584_0076702 Ga0316584_0076702_688_1545 284
291 3300037312 Ga0395899_0011157 Ga0395899_0011157_1437_2339 284
292 3300037418 Ga0395900_0140311 Ga0395900_0140311_440_1321 284
293 3300037418 Ga0395900_0258126 Ga0395900_0258126_678_1580 284
294 3300037466 Ga0395898_0051520 Ga0395898_0051520_1011_1913 284
295 3300037471 Ga0395905_0001851 Ga0395905_0001851_10942_11844 284
296 3300037471 Ga0395905_0039962 Ga0395905_0039962_1662_2564 284
297 3300039145 Ga0237816_00339 Ga0237816_00339_167_1054 284
298 3300041404 Ga0439436_0020163 Ga0439436_0020163_825_1709 284
299 3300041413 Ga0439465_0000702 Ga0439465_0000702_5701_6588 284
300 3300041413 Ga0439465_0010662 Ga0439465_0010662_719_1609 284
301 3300041494 Ga0451837_0284343 Ga0451837_0284343_273_1184 284
302 3300041494 Ga0451837_1188535 Ga0451837_1188535_1464_2333 284
303 3300041997 Ga0439431_0038662 Ga0439431_0038662_236_1093 284
304 3300042003 Ga0439443_005301 Ga0439443_005301_445_1335 284
305 3300042004 Ga0439445_0004287 Ga0439445_0004287_1154_2038 284
306 3300042006 Ga0439432_011364 Ga0439432_011364_1058_1951 284
307 3300042010 Ga0439452_002612 Ga0439452_002612_5328_6218 284
308 3300042015 Ga0439462_0009397 Ga0439462_0009397_1134_2027 284
309 3300042118 Ga0450914_005910 Ga0450914_005910_85_942 284
310 3300042122 Ga0450920_000805 Ga0450920_000805_3450_4307 284
311 3300042125 Ga0450923_000215 Ga0450923_000215_1616_2506 284
312 3300042125 Ga0450923_003573 Ga0450923_003573_798_1673 284
313 3300042131 Ga0450894_001444 Ga0450894_001444_1872_2747 284
314 3300042131 Ga0450894_002707 Ga0450894_002707_872_1762 284
315 3300042133 Ga0450896_001045 Ga0450896_001045_1968_2825 284
316 3300042145 Ga0450906_005714 Ga0450906_005714_704_1594 284
317 3300042156 Ga0439446_0007777 Ga0439446_0007777_1666_2556 284
318 3300042184 Ga0450908_000171 Ga0450908_000171_10646_11503 284
319 3300042435 Ga0439434_0005876 Ga0439434_0005876_1338_2228 284
320 3300042435 Ga0439434_0033625 Ga0439434_0033625_15_872 284
321 3300042436 Ga0439435_0017960 Ga0439435_0017960_229_1119 284
322 3300042437 Ga0439444_0001571 Ga0439444_0001571_1710_2567 284
323 3300042461 Ga0439460_0033576 Ga0439460_0033576_313_1203 284
324 3300042531 Ga0450918_006925 Ga0450918_006925_16_873 284
325 3300042876 Ga0451577_0003018 Ga0451577_0003018_3843_4730 284
326 3300046507 Ga0495606_0012465 Ga0495606_0012465_3339_4226 284
327 3300046539 Ga0495621_0085911 Ga0495621_0085911_273_1157 284
328 3300046615 Ga0495656_0001524 Ga0495656_0001524_2020_2919 284
329 3300046615 Ga0495656_0050481 Ga0495656_0050481_209_1093 284
330 3300046664 Ga0495659_0025447 Ga0495659_0025447_989_1873 284
331 3300046691 Ga0495670_0100122 Ga0495670_0100122_160_1059 284
332 3300047318 Ga0495636_0000956 Ga0495636_0000956_9433_10317 284
333 3300047318 Ga0495636_0042661 Ga0495636_0042661_259_1158 284
334 3300048904 Ga0496101_0253184 Ga0496101_0253184_263_1165 284
335 3300048909 Ga0496106_0256970 Ga0496106_0256970_48_932 284
336 3300048911 Ga0496108_0024090 Ga0496108_0024090_440_1324 284
337 3300048912 Ga0496109_0370196 Ga0496109_0370196_99_983 284
338 3300048914 Ga0496111_0135551 Ga0496111_0135551_312_1196 284
339 3300048924 Ga0496121_0012054 Ga0496121_0012054_1880_2764 284
340 3300048927 Ga0496124_0000880 Ga0496124_0000880_27744_28631 284
341 3300049568 Ga0501031_0031664 Ga0501031_0031664_1982_2845 284
342 3300049568 Ga0501031_0360890 Ga0501031_0360890_37_894 284
343 3300049569 Ga0501032_0031997 Ga0501032_0031997_743_1600 284
344 3300049571 Ga0501034_0000083 Ga0501034_0000083_156864_157739 284
345 3300049571 Ga0501034_0000383 Ga0501034_0000383_43296_44180 284
346 3300049571 Ga0501034_0009142 Ga0501034_0009142_3186_4046 284
347 3300049571 Ga0501034_0096426 Ga0501034_0096426_1017_1880 284
348 3300049572 Ga0501036_0026653 Ga0501036_0026653_2039_2896 284
349 3300049572 Ga0501036_0153922 Ga0501036_0153922_375_1238 284
350 3300049572 Ga0501036_0171996 Ga0501036_0171996_46_903 284
351 3300049572 Ga0501036_0419925 Ga0501036_0419925_219_1076 284
352 3300049573 Ga0501037_0056062 Ga0501037_0056062_758_1621 284
353 3300049573 Ga0501037_0081207 Ga0501037_0081207_256_1113 284
354 3300049574 Ga0501038_0045963 Ga0501038_0045963_2322_3179 284
355 3300049574 Ga0501038_0079719 Ga0501038_0079719_824_1687 284
356 3300049575 Ga0501039_0010242 Ga0501039_0010242_898_1755 284
357 3300049575 Ga0501039_0023892 Ga0501039_0023892_3204_4061 284
358 3300049575 Ga0501039_0146133 Ga0501039_0146133_280_1137 284
359 3300049576 Ga0501040_0001619 Ga0501040_0001619_11003_11860 284
360 3300049576 Ga0501040_0094695 Ga0501040_0094695_888_1745 284
361 3300049577 Ga0501041_0023310 Ga0501041_0023310_949_1806 284
362 3300049578 Ga0501042_0020878 Ga0501042_0020878_1853_2710 284
363 3300049578 Ga0501042_0086212 Ga0501042_0086212_607_1464 284
364 3300049578 Ga0501042_0110423 Ga0501042_0110423_189_1046 284
365 3300049579 Ga0501043_0150754 Ga0501043_0150754_743_1600 284
366 3300049580 Ga0501046_0038984 Ga0501046_0038984_265_1122 284
367 3300049580 Ga0501046_0099306 Ga0501046_0099306_1157_2014 284
368 3300049582 Ga0501048_0026833 Ga0501048_0026833_1205_2062 284
369 3300049583 Ga0501067_0012712 Ga0501067_0012712_2854_3711 284
370 3300049584 Ga0501068_0030679 Ga0501068_0030679_935_1792 284
371 3300049584 Ga0501068_0257221 Ga0501068_0257221_225_1082 284
372 3300049586 Ga0501070_0122820 Ga0501070_0122820_815_1678 284
373 3300049587 Ga0501071_0001551 Ga0501071_0001551_5490_6347 284
374 3300049587 Ga0501071_0023045 Ga0501071_0023045_1642_2499 284
375 3300049587 Ga0501071_0115889 Ga0501071_0115889_190_1047 284
376 3300049587 Ga0501071_0137354 Ga0501071_0137354_30_887 284
377 3300049588 Ga0501072_0034000 Ga0501072_0034000_973_1830 284
378 3300049588 Ga0501072_0051598 Ga0501072_0051598_402_1259 284
379 3300049588 Ga0501072_0072863 Ga0501072_0072863_861_1718 284
380 3300049589 Ga0501073_0007079 Ga0501073_0007079_7153_8010 284
381 3300049589 Ga0501073_0053296 Ga0501073_0053296_950_1807 284
382 3300049590 Ga0501074_0086866 Ga0501074_0086866_1181_2038 284
383 3300049590 Ga0501074_0434604 Ga0501074_0434604_35_892 284
384 3300049591 Ga0501075_0033209 Ga0501075_0033209_375_1232 284
385 3300049591 Ga0501075_0056702 Ga0501075_0056702_215_1081 284
386 3300049592 Ga0501076_0008787 Ga0501076_0008787_3505_4362 284
387 3300049592 Ga0501076_0012052 Ga0501076_0012052_4493_5350 284
388 3300049592 Ga0501076_0115667 Ga0501076_0115667_878_1735 284
389 3300049593 Ga0501077_0032482 Ga0501077_0032482_745_1602 284
390 3300049661 Ga0501217_020871 Ga0501217_020871_535_1419 284
391 3300049705 Ga0501225_0002077 Ga0501225_0002077_497_1390 284
392 3300049741 Ga0501079_0007069 Ga0501079_0007069_4347_5204 284
393 3300049741 Ga0501079_0018659 Ga0501079_0018659_1258_2115 284
394 3300049741 Ga0501079_0193152 Ga0501079_0193152_714_1571 284
395 3300049742 Ga0501080_0043093 Ga0501080_0043093_3156_4013 284
396 3300049742 Ga0501080_0047373 Ga0501080_0047373_1368_2231 284
397 3300049743 Ga0501081_0001812 Ga0501081_0001812_7951_8808 284
398 3300049743 Ga0501081_0023856 Ga0501081_0023856_700_1557 284
399 3300049822 Ga0501035_0031769 Ga0501035_0031769_3781_4638 284
400 3300049822 Ga0501035_0056395 Ga0501035_0056395_493_1356 284
401 3300049822 Ga0501035_0101172 Ga0501035_0101172_995_1852 284
402 3300049823 Ga0501044_0052936 Ga0501044_0052936_1616_2479 284
403 3300049824 Ga0501045_0031909 Ga0501045_0031909_1513_2370 284
404 3300050510 nmdc:mga06r32_335741_c1 nmdc:mga06r32_335741_c1_265_1122 284
405 3300050511 nmdc:mga08y16_6375_c1 nmdc:mga08y16_6375_c1_10565_11428 284
406 3300050512 nmdc:mga0n895_25067_c1 nmdc:mga0n895_25067_c1_4686_5543 284
407 3300050515 nmdc:mga0a205_1685_c1 nmdc:mga0a205_1685_c1_17833_18690 284
408 3300054114 Ga0501084_0212881 Ga0501084_0212881_438_1295 284
409 3300060353 Ga0501082_0003883 Ga0501082_0003883_2793_3650 284
410 3300060353 Ga0501082_0012419 Ga0501082_0012419_399_1256 284
411 3300060353 Ga0501082_0029480 Ga0501082_0029480_2779_3636 284
412 3300061734 Ga0530510_0031172 Ga0530510_0031172_2669_3529 284
413 3300061734 Ga0530510_0075906 Ga0530510_0075906_640_1497 284
414 3300001904 JGI24736J21556_1001100 JGI24736J21556_10011006 285
415 3300002773 JGI25152J39213_1025832 JGI25152J39213_10258321 285
416 3300003214 JGI25165J46597_1015751 JGI25165J46597_10157511 285
417 3300003320 rootH2_10014367 rootH2_100143671 285
418 3300005329 Ga0070683_100143047 Ga0070683_1001430472 285
419 3300005335 Ga0070666_10001419 Ga0070666_1000141916 285
420 3300005335 Ga0070666_10042227 Ga0070666_100422273 285
421 3300005337 Ga0070682_100207131 Ga0070682_1002071312 285
422 3300005338 Ga0068868_100151594 Ga0068868_1001515942 285
423 3300005344 Ga0070661_100071859 Ga0070661_1000718592 285
424 3300005355 Ga0070671_100178302 Ga0070671_1001783022 285
425 3300005365 Ga0070688_100069421 Ga0070688_1000694212 285
426 3300005367 Ga0070667_100186491 Ga0070667_1001864913 285
427 3300005437 Ga0070710_10064647 Ga0070710_100646473 285
428 3300005455 Ga0070663_100150711 Ga0070663_1001507113 285
429 3300005455 Ga0070663_100185229 Ga0070663_1001852292 285
430 3300005457 Ga0070662_100008730 Ga0070662_1000087305 285
431 3300005459 Ga0068867_100020303 Ga0068867_1000203032 285
432 3300005466 Ga0070685_10001357 Ga0070685_1000135714 285
433 3300005539 Ga0068853_100552989 Ga0068853_1005529891 285
434 3300005547 Ga0070693_100048012 Ga0070693_1000480122 285
435 3300005548 Ga0070665_100002186 Ga0070665_10000218619 285
436 3300005578 Ga0068854_100003726 Ga0068854_1000037266 285
437 3300005614 Ga0068856_100048310 Ga0068856_1000483105 285
438 3300005616 Ga0068852_100007423 Ga0068852_1000074233 285
439 3300005616 Ga0068852_100186170 Ga0068852_1001861702 285
440 3300005618 Ga0068864_100169381 Ga0068864_1001693814 285
441 3300005834 Ga0068851_10071334 Ga0068851_100713342 285
442 3300005842 Ga0068858_100002248 Ga0068858_10000224811 285
443 3300005842 Ga0068858_100140069 Ga0068858_1001400692 285
444 3300006186 Ga0075369_10023439 Ga0075369_100234395 285
445 3300006237 Ga0097621_100098562 Ga0097621_1000985624 285
446 3300006881 Ga0068865_100022084 Ga0068865_1000220843 285
447 3300006881 Ga0068865_100081305 Ga0068865_1000813053 285
448 3300006881 Ga0068865_100451244 Ga0068865_1004512442 285
449 3300009093 Ga0105240_10000961 Ga0105240_1000096112 285
450 3300009093 Ga0105240_10003082 Ga0105240_1000308215 285
451 3300009093 Ga0105240_10019507 Ga0105240_100195074 285
452 3300009101 Ga0105247_10006331 Ga0105247_100063314 285
453 3300009545 Ga0105237_10206519 Ga0105237_102065192 285
454 3300009545 Ga0105237_10237459 Ga0105237_102374592 285
455 3300009551 Ga0105238_10005696 Ga0105238_100056963 285
456 3300009551 Ga0105238_10007146 Ga0105238_100071466 285
457 3300009551 Ga0105238_10109505 Ga0105238_101095053 285
458 3300009551 Ga0105238_10412819 Ga0105238_104128192 285
459 3300009553 Ga0105249_10001497 Ga0105249_100014976 285
460 3300010375 Ga0105239_10000041 Ga0105239_10000041158 285
461 3300010375 Ga0105239_10118967 Ga0105239_101189672 285
462 3300010375 Ga0105239_10231843 Ga0105239_102318433 285
463 3300013104 Ga0157370_10005426 Ga0157370_100054264 285
464 3300013104 Ga0157370_10047852 Ga0157370_100478523 285
465 3300013104 Ga0157370_10099505 Ga0157370_100995051 285
466 3300013105 Ga0157369_10001201 Ga0157369_1000120130 285
467 3300013105 Ga0157369_10219939 Ga0157369_102199393 285
468 3300013296 Ga0157374_10012378 Ga0157374_100123786 285
469 3300013307 Ga0157372_10028506 Ga0157372_100285064 285
470 3300013308 Ga0157375_10122494 Ga0157375_101224942 285
471 3300013308 Ga0157375_10638721 Ga0157375_106387212 285
472 3300014326 Ga0157380_10161871 Ga0157380_101618713 285
473 3300014497 Ga0182008_10016357 Ga0182008_100163575 285
474 3300014968 Ga0157379_10280121 Ga0157379_102801212 285
475 3300014969 Ga0157376_10040492 Ga0157376_100404924 285
476 3300015261 Ga0182006_1000074 Ga0182006_100007424 285
477 3300015261 Ga0182006_1000714 Ga0182006_10007149 285
478 3300015262 Ga0182007_10022612 Ga0182007_100226121 285
479 3300015265 Ga0182005_1000034 Ga0182005_100003430 285
480 3300015265 Ga0182005_1003954 Ga0182005_10039542 285
481 3300025226 Ga0209674_100583 Ga0209674_1005835 285
482 3300025228 Ga0209672_105337 Ga0209672_1053372 285
483 3300025231 Ga0207427_100112 Ga0207427_10011292 285
484 3300025231 Ga0207427_106587 Ga0207427_1065872 285
485 3300025233 Ga0209437_100020 Ga0209437_10002074 285
486 3300025233 Ga0209437_101569 Ga0209437_1015694 285
487 3300025233 Ga0209437_112201 Ga0209437_1122012 285
488 3300025254 Ga0209148_1002648 Ga0209148_10026485 285
489 3300025258 Ga0209129_1012709 Ga0209129_10127093 285
490 3300025261 Ga0209233_1000020 Ga0209233_1000020551 285
491 3300025261 Ga0209233_1001529 Ga0209233_10015296 285
492 3300025261 Ga0209233_1030781 Ga0209233_10307812 285
493 3300025272 Ga0209455_1012921 Ga0209455_10129212 285
494 3300025297 Ga0209758_1006287 Ga0209758_10062873 285
495 3300025303 Ga0209051_1000816 Ga0209051_10008165 285
496 3300025304 Ga0209257_1041584 Ga0209257_10415842 285
497 3300025321 Ga0207656_10001973 Ga0207656_100019736 285
498 3300025900 Ga0207710_10041379 Ga0207710_100413792 285
499 3300025903 Ga0207680_10001048 Ga0207680_1000104813 285
500 3300025904 Ga0207647_10000077 Ga0207647_1000007749 285
501 3300025904 Ga0207647_10000571 Ga0207647_1000057125 285
502 3300025911 Ga0207654_10000432 Ga0207654_1000043214 285
503 3300025913 Ga0207695_10000032 Ga0207695_10000032378 285
504 3300025913 Ga0207695_10004121 Ga0207695_100041217 285
505 3300025913 Ga0207695_10033630 Ga0207695_100336305 285
506 3300025913 Ga0207695_10063497 Ga0207695_100634973 285
507 3300025914 Ga0207671_10056194 Ga0207671_100561943 285
508 3300025920 Ga0207649_10029268 Ga0207649_100292683 285
509 3300025920 Ga0207649_10081088 Ga0207649_100810882 285
510 3300025924 Ga0207694_10000663 Ga0207694_1000066328 285
511 3300025924 Ga0207694_10002603 Ga0207694_100026034 285
512 3300025926 Ga0207659_10166056 Ga0207659_101660563 285
513 3300025933 Ga0207706_10002097 Ga0207706_100020974 285
514 3300025938 Ga0207704_10024004 Ga0207704_100240042 285
515 3300025938 Ga0207704_10180458 Ga0207704_101804583 285
516 3300025940 Ga0207691_10011883 Ga0207691_100118833 285
517 3300025942 Ga0207689_10091985 Ga0207689_100919852 285
518 3300025961 Ga0207712_10000241 Ga0207712_1000024116 285
519 3300025981 Ga0207640_10009475 Ga0207640_100094754 285
520 3300025986 Ga0207658_10027641 Ga0207658_100276413 285
521 3300025986 Ga0207658_10249181 Ga0207658_102491813 285
522 3300026035 Ga0207703_10001114 Ga0207703_1000111414 285
523 3300026041 Ga0207639_10000627 Ga0207639_1000062719 285
524 3300026067 Ga0207678_10005139 Ga0207678_100051397 285
525 3300026067 Ga0207678_10355806 Ga0207678_103558061 285
526 3300026078 Ga0207702_10241864 Ga0207702_102418642 285
527 3300026095 Ga0207676_10394099 Ga0207676_103940992 285
528 3300026116 Ga0207674_10016915 Ga0207674_100169154 285
529 3300026142 Ga0207698_10042654 Ga0207698_100426544 285
530 3300026142 Ga0207698_10042677 Ga0207698_100426773 285
531 3300026142 Ga0207698_10098064 Ga0207698_100980642 285
532 3300027526 Ga0209968_1014418 Ga0209968_10144181 285
533 3300028379 Ga0268266_10000013 Ga0268266_10000013490 285
534 3300031911 Ga0307412_10002109 Ga0307412_100021097 285
535 3300035089 Ga0373944_0001655 Ga0373944_0001655_1563_2450 285
536 3300035111 Ga0373923_0050741 Ga0373923_0050741_220_1107 285
537 3300041404 Ga0439436_0000010 Ga0439436_0000010_13518_14375 285
538 3300041509 Ga0451843_0168248 Ga0451843_0168248_4299_5171 285
539 3300042007 Ga0439449_0051328 Ga0439449_0051328_406_1281 285
540 3300042184 Ga0450908_000103 Ga0450908_000103_10543_11400 285
541 3300044672 Ga0466982_0000114 Ga0466982_0000114_14971_15828 285
542 3300045976 Ga0466967_0507747 Ga0466967_0507747_190_1062 285
543 3300046460 Ga0495638_0000122 Ga0495638_0000122_93190_94047 285
544 3300046460 Ga0495638_0000458 Ga0495638_0000458_22448_23305 285
545 3300046471 Ga0495650_0000381 Ga0495650_0000381_59036_59893 285
546 3300046491 Ga0495584_0001848 Ga0495584_0001848_11101_11958 285
547 3300046492 Ga0495585_0000046 Ga0495585_0000046_52770_53627 285
548 3300046501 Ga0495607_0000640 Ga0495607_0000640_32424_33281 285
549 3300046501 Ga0495607_0001181 Ga0495607_0001181_17662_18519 285
550 3300046507 Ga0495606_0000203 Ga0495606_0000203_21876_22733 285
551 3300046507 Ga0495606_0000348 Ga0495606_0000348_6068_6925 285
552 3300046507 Ga0495606_0011126 Ga0495606_0011126_6051_6908 285
553 3300046507 Ga0495606_0015136 Ga0495606_0015136_873_1730 285
554 3300046507 Ga0495606_0092844 Ga0495606_0092844_467_1324 285
555 3300046512 Ga0495610_0005537 Ga0495610_0005537_2540_3397 285
556 3300046512 Ga0495610_0029071 Ga0495610_0029071_706_1563 285
557 3300046513 Ga0495616_0000116 Ga0495616_0000116_10623_11480 285
558 3300046515 Ga0495620_0001776 Ga0495620_0001776_9754_10611 285
559 3300046518 Ga0495631_0000477 Ga0495631_0000477_25407_26264 285
560 3300046518 Ga0495631_0001682 Ga0495631_0001682_11916_12773 285
561 3300046520 Ga0495637_0030148 Ga0495637_0030148_817_1674 285
562 3300046522 Ga0495643_0057370 Ga0495643_0057370_838_1695 285
563 3300046524 Ga0495648_0011255 Ga0495648_0011255_405_1262 285
564 3300046538 Ga0495609_0007688 Ga0495609_0007688_801_1658 285
565 3300046543 Ga0495645_0016277 Ga0495645_0016277_3128_4009 285
566 3300046557 Ga0495622_0005779 Ga0495622_0005779_2150_3007 285
567 3300046616 Ga0495668_0015091 Ga0495668_0015091_607_1464 285
568 3300046648 Ga0495611_0000001 Ga0495611_0000001_1828505_1829362 285
569 3300046648 Ga0495611_0000109 Ga0495611_0000109_24192_25049 285
570 3300046660 Ga0495625_0000001 Ga0495625_0000001_86689_87546 285
571 3300046660 Ga0495625_0062922 Ga0495625_0062922_829_1686 285
572 3300046660 Ga0495625_0197231 Ga0495625_0197231_458_1315 285
573 3300046665 Ga0495661_0001093 Ga0495661_0001093_5347_6204 285
574 3300046691 Ga0495670_0000779 Ga0495670_0000779_298_1155 285
575 3300046691 Ga0495670_0006987 Ga0495670_0006987_3511_4368 285
576 3300046692 Ga0495671_0000409 Ga0495671_0000409_20060_20917 285
577 3300046694 Ga0495649_0007061 Ga0495649_0007061_4963_5820 285
578 3300046794 Ga0495589_0000295 Ga0495589_0000295_1400_2257 285
579 3300046810 Ga0495660_0000109 Ga0495660_0000109_63633_64490 285
580 3300047323 Ga0495683_0001272 Ga0495683_0001272_6459_7316 285
581 3300047446 Ga0495679_000004 Ga0495679_000004_1183_2040 285
582 3300047469 Ga0495673_0000001 Ga0495673_0000001_15476_16333 285
583 3300047469 Ga0495673_0000018 Ga0495673_0000018_535425_536282 285
584 3300047469 Ga0495673_0000257 Ga0495673_0000257_21398_22255 285
585 3300047471 Ga0495684_0094919 Ga0495684_0094919_555_1436 285
586 3300047472 Ga0495686_0005681 Ga0495686_0005681_8652_9509 285
587 3300048904 Ga0496101_0020446 Ga0496101_0020446_904_1761 285
588 3300048905 Ga0496102_0316263 Ga0496102_0316263_194_1051 285
589 3300048907 Ga0496104_0165012 Ga0496104_0165012_755_1612 285
590 3300048909 Ga0496106_0006126 Ga0496106_0006126_2494_3351 285
591 3300048910 Ga0496107_0105660 Ga0496107_0105660_504_1361 285
592 3300048919 Ga0496116_0052004 Ga0496116_0052004_1542_2399 285
593 3300048920 Ga0496117_0020067 Ga0496117_0020067_2233_3090 285
594 3300048921 Ga0496118_0000998 Ga0496118_0000998_11365_12222 285
595 3300048921 Ga0496118_0024282 Ga0496118_0024282_4327_5184 285
596 3300048921 Ga0496118_0045015 Ga0496118_0045015_2285_3163 285
597 3300048922 Ga0496119_0000377 Ga0496119_0000377_14596_15453 285
598 3300048922 Ga0496119_0015652 Ga0496119_0015652_1418_2275 285
599 3300048923 Ga0496120_0000573 Ga0496120_0000573_22915_23772 285
600 3300048924 Ga0496121_0000045 Ga0496121_0000045_92786_93643 285
601 3300048924 Ga0496121_0000420 Ga0496121_0000420_7414_8271 285
602 3300048924 Ga0496121_0008877 Ga0496121_0008877_10558_11415 285
603 3300048925 Ga0496122_0053750 Ga0496122_0053750_687_1544 285
604 3300048925 Ga0496122_0170448 Ga0496122_0170448_335_1192 285
605 3300048927 Ga0496124_0123529 Ga0496124_0123529_250_1107 285
606 3300048928 Ga0496125_0013298 Ga0496125_0013298_3070_3927 285
607 3300048929 Ga0496126_0028861 Ga0496126_0028861_4156_5013 285
608 3300049459 Ga0495678_000312 Ga0495678_000312_33105_33962 285
609 3300049460 Ga0495682_0043352 Ga0495682_0043352_45_902 285
610 3300049569 Ga0501032_0011389 Ga0501032_0011389_852_1709 285
611 3300049571 Ga0501034_0000605 Ga0501034_0000605_1475_2332 285
612 3300049571 Ga0501034_0024812 Ga0501034_0024812_1082_1939 285
613 3300049571 Ga0501034_0063663 Ga0501034_0063663_411_1277 285
614 3300049572 Ga0501036_0029315 Ga0501036_0029315_797_1654 285
615 3300049572 Ga0501036_0183551 Ga0501036_0183551_642_1508 285
616 3300049573 Ga0501037_0194010 Ga0501037_0194010_494_1366 285
617 3300049580 Ga0501046_0008656 Ga0501046_0008656_2997_3863 285
618 3300049581 Ga0501047_0000329 Ga0501047_0000329_39314_40171 285
619 3300049583 Ga0501067_0007059 Ga0501067_0007059_3989_4846 285
620 3300049584 Ga0501068_0005260 Ga0501068_0005260_4759_5616 285
621 3300049586 Ga0501070_0003388 Ga0501070_0003388_8773_9630 285
622 3300049586 Ga0501070_0006687 Ga0501070_0006687_273_1130 285
623 3300049586 Ga0501070_0072985 Ga0501070_0072985_480_1337 285
624 3300049588 Ga0501072_0007169 Ga0501072_0007169_1855_2712 285
625 3300049589 Ga0501073_0004211 Ga0501073_0004211_9019_9876 285
626 3300049589 Ga0501073_0089078 Ga0501073_0089078_788_1654 285
627 3300049590 Ga0501074_0017509 Ga0501074_0017509_700_1557 285
628 3300049590 Ga0501074_0122585 Ga0501074_0122585_224_1093 285
629 3300049742 Ga0501080_0000831 Ga0501080_0000831_3171_4028 285
630 3300049742 Ga0501080_0006072 Ga0501080_0006072_5417_6274 285
631 3300049742 Ga0501080_0306181 Ga0501080_0306181_317_1183 285
632 3300049744 Ga0501083_0000763 Ga0501083_0000763_8536_9393 285
633 3300049823 Ga0501044_0008158 Ga0501044_0008158_10521_11378 285
634 3300049823 Ga0501044_0043010 Ga0501044_0043010_292_1149 285
635 3300049823 Ga0501044_0253843 Ga0501044_0253843_426_1292 285
636 3300053087 Ga0500643_000075 Ga0500643_000075_96658_97515 285
637 3300053103 Ga0500555_000099 Ga0500555_000099_38662_39519 285
638 3300053108 Ga0500562_028288 Ga0500562_028288_471_1328 285
639 3300053139 Ga0500568_0001378 Ga0500568_0001378_2837_3703 285
640 3300053730 Ga0500645_002986 Ga0500645_002986_5318_6175 285
641 3300054114 Ga0501084_0055026 Ga0501084_0055026_1707_2564 285
642 3300054114 Ga0501084_0195146 Ga0501084_0195146_245_1102 285
643 3300060353 Ga0501082_0000144 Ga0501082_0000144_50416_51282 285
644 3300060353 Ga0501082_0143669 Ga0501082_0143669_246_1103 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

22

160

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.8971 4 217
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.8771 4 217
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.8728 4 219
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.871 2 217
6xjh-assembly1.cif.gz_D pmtcd abc exporter without the basket domain at c2 symmetry 0.8694 6 214
ID Description Score Start End Superfamily
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9326 3 217 3.40.50.300
af_Q2FWW7_2_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9317 4 217 3.40.50.300
af_Q2G1V4_2_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9137 2 217 3.40.50.300
af_Q1RS86_918_1157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9073 1 203 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9068 2 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V6L005-F1-model_v4 ABC transporter domain-containing protein 0.96 2 126 GO:0005524
GO:0016887
AF-A0A2V9WVQ3-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9542 2 144 GO:0005524
GO:0016887
AF-A0A2V6L005-F1-model_v4 ABC transporter domain-containing protein 0.9527 2 126 GO:0005524
GO:0016887
AF-A0A496QEB7-F1-model_v4 ABC transporter ATP-binding protein 0.9435 2 217 GO:0005524
GO:0016887
AF-A0A2G2M205-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9429 1 219 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.12 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map