F472008

General Info

Members Datasets Scaffolds Average Seq Length
644 220 1288 82

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10193098|JGI24740J21852_101930982
Length 85
Sequence MLMGPGYFVIAILGCADGGSACTPVATLDTRYETADQCSAATGAALLEHNDFDFPSLVARCRSAKPAEAAENARAKPLRQRARRS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 4.97
Rhizosphere 94.25
Stem 0
Stem Tuber 0
Unclassified 12.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10193098 3300001979 Unclassified 505
2 JGI24752J21851_1051018 3300001976 Unclassified 562
3 JGI24746J21847_1016930 3300001977 Bacteria 1037
4 JGI24747J21853_1006818 3300001978 Bacteria 1088
5 JGI24740J21852_10000977 3300001979 Bacteria 12757
6 JGI24739J22299_10000244 3300001989 Bacteria 18398
7 JGI24739J22299_10003397 3300001989 Bacteria 6074
8 JGI24737J22298_10000021 3300001990 Bacteria 45543
9 JGI24737J22298_10002931 3300001990 Bacteria 6046
10 JGI24737J22298_10125656 3300001990 Bacteria 758
11 JGI24737J22298_10203469 3300001990 Bacteria 584
12 JGI24743J22301_10127476 3300001991 Unclassified 561
13 JGI24735J21928_10002755 3300002067 Bacteria 6060
14 JGI24735J21928_10008217 3300002067 Bacteria 3384
15 JGI24735J21928_10027750 3300002067 Bacteria 1695
16 JGI24735J21928_10030031 3300002067 Bacteria 1616
17 JGI24735J21928_10045848 3300002067 Bacteria 1269
18 JGI24745J21846_1003272 3300002073 Unclassified 1688
19 JGI24738J21930_10000082 3300002075 Bacteria 21091
20 JGI24738J21930_10000308 3300002075 Bacteria 13430
21 JGI24749J21850_1036949 3300002076 Unclassified 710
22 JGI24034J26672_10008380 3300002239 Bacteria 1511
23 Ga0070658_10002766 3300005327 Bacteria 14589
24 Ga0070658_10083018 3300005327 Bacteria 2633
25 Ga0070658_10085658 3300005327 Bacteria 2592
26 Ga0070658_10159106 3300005327 Bacteria 1894
27 Ga0070658_10271535 3300005327 Bacteria 1442
28 Ga0070658_10361327 3300005327 Bacteria 1243
29 Ga0070658_10549251 3300005327 Bacteria 1000
30 Ga0070676_10001550 3300005328 Bacteria 11633
31 Ga0070676_10154958 3300005328 Bacteria 1470
32 Ga0070676_10600560 3300005328 Bacteria 794
33 Ga0070683_100012482 3300005329 Bacteria 7383
34 Ga0070683_100032089 3300005329 Bacteria 4780
35 Ga0070683_100055007 3300005329 Bacteria 3691
36 Ga0070683_100857102 3300005329 Bacteria 871
37 Ga0070683_101061225 3300005329 Bacteria 778
38 Ga0070690_100002787 3300005330 Bacteria 9434
39 Ga0070690_100600022 3300005330 Bacteria 836
40 Ga0070670_100341252 3300005331 Bacteria 1315
41 Ga0070670_101089598 3300005331 Unclassified 728
42 Ga0070670_101565609 3300005331 Unclassified 606
43 Ga0070677_10111647 3300005333 Unclassified 1221
44 Ga0068869_100000896 3300005334 Bacteria 17172
45 Ga0070666_10000591 3300005335 Bacteria 21857
46 Ga0070666_10033887 3300005335 Bacteria 3383
47 Ga0070666_11301066 3300005335 Unclassified 542
48 Ga0070680_100002786 3300005336 Bacteria 12974
49 Ga0070680_100085243 3300005336 Bacteria 2610
50 Ga0070680_100186052 3300005336 Bacteria 1750
51 Ga0070680_100412194 3300005336 Bacteria 1152
52 Ga0070680_101105943 3300005336 Bacteria 685
53 Ga0070682_100792016 3300005337 Unclassified 769
54 Ga0068868_100000637 3300005338 Bacteria 23618
55 Ga0068868_100952022 3300005338 Bacteria 783
56 Ga0070660_100001567 3300005339 Bacteria 15721
57 Ga0070660_100006246 3300005339 Bacteria 8249
58 Ga0070660_100006915 3300005339 Bacteria 7869
59 Ga0070660_100019696 3300005339 Bacteria 4948
60 Ga0070660_100075813 3300005339 Bacteria 2634
61 Ga0070660_100125747 3300005339 Bacteria 2048
62 Ga0070660_100405607 3300005339 Bacteria 1127
63 Ga0070660_100738080 3300005339 Bacteria 826
64 Ga0070660_101174002 3300005339 Bacteria 650
65 Ga0070660_101255177 3300005339 Bacteria 628
66 Ga0070660_101711812 3300005339 Unclassified 535
67 Ga0070689_100063943 3300005340 Bacteria 2863
68 Ga0070687_100207904 3300005343 Bacteria 1190
69 Ga0070661_100000354 3300005344 Bacteria 36155
70 Ga0070661_100005769 3300005344 Bacteria 8518
71 Ga0070661_100073362 3300005344 Bacteria 2520
72 Ga0070661_100100777 3300005344 Bacteria 2148
73 Ga0070661_100116977 3300005344 Bacteria 1994
74 Ga0070661_100119660 3300005344 Bacteria 1972
75 Ga0070661_100380746 3300005344 Bacteria 1112
76 Ga0070661_100449761 3300005344 Bacteria 1025
77 Ga0070661_100775966 3300005344 Unclassified 785
78 Ga0070661_101577593 3300005344 Unclassified 555
79 Ga0070692_10315834 3300005345 Bacteria 959
80 Ga0070692_10961652 3300005345 Bacteria 595
81 Ga0070668_100013342 3300005347 Bacteria 6132
82 Ga0070668_100860998 3300005347 Bacteria 808
83 Ga0070669_100013883 3300005353 Bacteria 5728
84 Ga0070669_100453755 3300005353 Bacteria 1057
85 Ga0070675_100010773 3300005354 Bacteria 7151
86 Ga0070671_100001348 3300005355 Bacteria 18388
87 Ga0070671_100003822 3300005355 Bacteria 11824
88 Ga0070671_100012669 3300005355 Bacteria 6797
89 Ga0070671_100021608 3300005355 Bacteria 5257
90 Ga0070671_100143911 3300005355 Bacteria 2012
91 Ga0070671_101858869 3300005355 Unclassified 535
92 Ga0070674_100145370 3300005356 Bacteria 1784
93 Ga0070674_100246229 3300005356 Bacteria 1402
94 Ga0070673_100000209 3300005364 Bacteria 29078
95 Ga0070673_100028268 3300005364 Bacteria 4168
96 Ga0070673_100060711 3300005364 Bacteria 2997
97 Ga0070673_100195628 3300005364 Bacteria 1739
98 Ga0070673_100480494 3300005364 Bacteria 1121
99 Ga0070673_100726459 3300005364 Bacteria 913
100 Ga0070673_101408951 3300005364 Bacteria 656
101 Ga0070688_100091703 3300005365 Bacteria 1986
102 Ga0070659_100000311 3300005366 Bacteria 37881
103 Ga0070659_100001928 3300005366 Bacteria 14819
104 Ga0070659_100008027 3300005366 Bacteria 7695
105 Ga0070659_100281499 3300005366 Bacteria 1383
106 Ga0070659_100424925 3300005366 Bacteria 1124
107 Ga0070659_100517511 3300005366 Bacteria 1018
108 Ga0070659_100540610 3300005366 Bacteria 997
109 Ga0070659_101417056 3300005366 Bacteria 618
110 Ga0070659_101533094 3300005366 Unclassified 594
111 Ga0070667_100001148 3300005367 Bacteria 24009
112 Ga0070667_100048873 3300005367 Bacteria 3562
113 Ga0070667_100250044 3300005367 Bacteria 1585
114 Ga0070667_100715409 3300005367 Bacteria 927
115 Ga0070714_101008560 3300005435 Bacteria 810
116 Ga0070713_101301690 3300005436 Bacteria 704
117 Ga0070663_100009045 3300005455 Bacteria 6154
118 Ga0070663_100088777 3300005455 Bacteria 2286
119 Ga0070663_100156469 3300005455 Bacteria 1751
120 Ga0070663_100447001 3300005455 Bacteria 1065
121 Ga0070663_100695394 3300005455 Bacteria 864
122 Ga0070663_100695409 3300005455 Bacteria 864
123 Ga0070663_100808802 3300005455 Bacteria 804
124 Ga0070663_101005860 3300005455 Bacteria 725
125 Ga0070678_100000804 3300005456 Bacteria 15821
126 Ga0070678_101285493 3300005456 Unclassified 680
127 Ga0070678_101321416 3300005456 Bacteria 671
128 Ga0070662_100001149 3300005457 Bacteria 16221
129 Ga0070662_100001649 3300005457 Bacteria 13729
130 Ga0070662_100024916 3300005457 Bacteria 4127
131 Ga0070662_100267232 3300005457 Bacteria 1380
132 Ga0070662_100511334 3300005457 Bacteria 1003
133 Ga0070662_100516610 3300005457 Bacteria 997
134 Ga0070681_10040080 3300005458 Bacteria 4696
135 Ga0070681_10045157 3300005458 Bacteria 4409
136 Ga0070681_11030193 3300005458 Unclassified 743
137 Ga0068867_100000633 3300005459 Bacteria 23213
138 Ga0068867_100002541 3300005459 Bacteria 12847
139 Ga0070679_100062128 3300005530 Bacteria 3723
140 Ga0070679_100148250 3300005530 Bacteria 2324
141 Ga0070679_100157722 3300005530 Bacteria 2244
142 Ga0070679_100430898 3300005530 Bacteria 1264
143 Ga0070679_100670423 3300005530 Bacteria 980
144 Ga0070679_100851969 3300005530 Bacteria 855
145 Ga0070684_100001845 3300005535 Bacteria 15508
146 Ga0070684_100107100 3300005535 Bacteria 2503
147 Ga0070684_100213303 3300005535 Bacteria 1760
148 Ga0070684_100348104 3300005535 Bacteria 1363
149 Ga0070684_101076862 3300005535 Bacteria 755
150 Ga0068853_100000404 3300005539 Bacteria 29662
151 Ga0068853_100001473 3300005539 Bacteria 17091
152 Ga0068853_100010121 3300005539 Bacteria 7620
153 Ga0068853_100140588 3300005539 Bacteria 2167
154 Ga0068853_100663735 3300005539 Bacteria 993
155 Ga0068853_100738332 3300005539 Bacteria 940
156 Ga0068853_100756327 3300005539 Bacteria 929
157 Ga0070672_100004346 3300005543 Bacteria 9275
158 Ga0070672_100031449 3300005543 Bacteria 3995
159 Ga0070686_101065290 3300005544 Unclassified 666
160 Ga0070686_101922228 3300005544 Unclassified 505
161 Ga0070693_100014631 3300005547 Bacteria 4024
162 Ga0070693_100572298 3300005547 Bacteria 812
163 Ga0070665_100000590 3300005548 Bacteria 50563
164 Ga0070665_100059124 3300005548 Bacteria 3842
165 Ga0070665_100123581 3300005548 Bacteria 2590
166 Ga0070665_100163802 3300005548 Bacteria 2226
167 Ga0070665_100603228 3300005548 Bacteria 1111
168 Ga0068855_100004167 3300005563 Bacteria 17641
169 Ga0068855_100017154 3300005563 Bacteria 8710
170 Ga0068855_100043857 3300005563 Bacteria 5296
171 Ga0068855_100407780 3300005563 Bacteria 1488
172 Ga0068855_101077928 3300005563 Unclassified 841
173 Ga0068855_101317417 3300005563 Bacteria 747
174 Ga0070664_100000128 3300005564 Bacteria 50589
175 Ga0070664_100021543 3300005564 Bacteria 5314
176 Ga0070664_100099814 3300005564 Bacteria 2523
177 Ga0070664_100181939 3300005564 Bacteria 1868
178 Ga0070664_100353725 3300005564 Bacteria 1337
179 Ga0070664_101032785 3300005564 Bacteria 773
180 Ga0070664_101429535 3300005564 Bacteria 654
181 Ga0070664_101454443 3300005564 Bacteria 648
182 Ga0070664_101833979 3300005564 Unclassified 575
183 Ga0068857_100000570 3300005577 Bacteria 26956
184 Ga0068857_100017002 3300005577 Bacteria 6372
185 Ga0068854_100005081 3300005578 Bacteria 8288
186 Ga0068854_100102966 3300005578 Bacteria 2143
187 Ga0068854_100169471 3300005578 Bacteria 1698
188 Ga0068854_101552024 3300005578 Unclassified 602
189 Ga0068856_100001416 3300005614 Bacteria 25152
190 Ga0068856_100044598 3300005614 Bacteria 4364
191 Ga0068856_100239690 3300005614 Bacteria 1829
192 Ga0068856_100468394 3300005614 Bacteria 1281
193 Ga0068856_101050579 3300005614 Bacteria 832
194 Ga0068856_101612640 3300005614 Unclassified 662
195 Ga0068856_102719801 3300005614 Unclassified 500
196 Ga0068852_100000446 3300005616 Bacteria 27187
197 Ga0068852_100001523 3300005616 Bacteria 15692
198 Ga0068852_100071660 3300005616 Bacteria 3044
199 Ga0068852_100110928 3300005616 Bacteria 2494
200 Ga0068852_100322179 3300005616 Bacteria 1501
201 Ga0068852_100787600 3300005616 Bacteria 964
202 Ga0068852_100882112 3300005616 Bacteria 911
203 Ga0068852_101022789 3300005616 Bacteria 845
204 Ga0068852_101378494 3300005616 Unclassified 727
205 Ga0068859_100000478 3300005617 Bacteria 39430
206 Ga0068859_100533264 3300005617 Bacteria 1269
207 Ga0068864_100000174 3300005618 Bacteria 59338
208 Ga0068864_100002622 3300005618 Bacteria 14849
209 Ga0068864_100088808 3300005618 Bacteria 2723
210 Ga0068864_100667860 3300005618 Bacteria 1013
211 Ga0068866_10041886 3300005718 Unclassified 2275
212 Ga0068861_100058275 3300005719 Bacteria 2953
213 Ga0068851_10005314 3300005834 Bacteria 5846
214 Ga0068851_10011295 3300005834 Bacteria 4186
215 Ga0068851_10071746 3300005834 Bacteria 1793
216 Ga0068870_10007747 3300005840 Bacteria 4803
217 Ga0068863_100001778 3300005841 Bacteria 21381
218 Ga0068863_100206476 3300005841 Bacteria 1891
219 Ga0068863_100459670 3300005841 Bacteria 1250
220 Ga0068858_100000600 3300005842 Bacteria 37662
221 Ga0068858_100249150 3300005842 Bacteria 1687
222 Ga0068858_101319806 3300005842 Bacteria 710
223 Ga0068860_100005305 3300005843 Bacteria 13087
224 Ga0068860_100783368 3300005843 Bacteria 966
225 Ga0068860_101666758 3300005843 Bacteria 660
226 Ga0068862_100103908 3300005844 Unclassified 2488
227 Ga0068862_100931291 3300005844 Bacteria 856
228 Ga0097621_100010999 3300006237 Bacteria 6648
229 Ga0097621_100016747 3300006237 Bacteria 5552
230 Ga0097621_100129486 3300006237 Bacteria 2147
231 Ga0097621_100825347 3300006237 Unclassified 860
232 Ga0097621_101353518 3300006237 Bacteria 673
233 Ga0075370_10401537 3300006353 Unclassified 822
234 Ga0068871_100080563 3300006358 Bacteria 2696
235 Ga0068871_100160604 3300006358 Bacteria 1922
236 Ga0068865_100000240 3300006881 Bacteria 30384
237 Ga0097620_100000478 3300006931 Bacteria 39430
238 Ga0097620_100533273 3300006931 Bacteria 1269
239 Ga0105240_10041889 3300009093 Bacteria 5839
240 Ga0105240_12002143 3300009093 Unclassified 602
241 Ga0105245_10000300 3300009098 Bacteria 47446
242 Ga0105247_10609242 3300009101 Unclassified 811
243 Ga0105247_11602487 3300009101 Bacteria 535
244 Ga0105243_10073988 3300009148 Bacteria 2762
245 Ga0105241_10002793 3300009174 Bacteria 13069
246 Ga0105241_10022450 3300009174 Bacteria 4675
247 Ga0105241_10458482 3300009174 Bacteria 1129
248 Ga0105241_11532947 3300009174 Bacteria 642
249 Ga0105248_10000206 3300009177 Bacteria 67932
250 Ga0105248_10013573 3300009177 Bacteria 8970
251 Ga0105248_10446362 3300009177 Bacteria 1457
252 Ga0105248_13024577 3300009177 Unclassified 535
253 Ga0105237_10039873 3300009545 Bacteria 4738
254 Ga0105237_11729907 3300009545 Unclassified 633
255 Ga0105238_10008651 3300009551 Bacteria 10187
256 Ga0105238_10145938 3300009551 Bacteria 2342
257 Ga0105238_10231353 3300009551 Bacteria 1825
258 Ga0105238_10326247 3300009551 Bacteria 1521
259 Ga0105238_10455296 3300009551 Bacteria 1277
260 Ga0105238_10487749 3300009551 Bacteria 1232
261 Ga0105239_10343935 3300010375 Bacteria 1684
262 Ga0105239_11100936 3300010375 Unclassified 914
263 Ga0105239_11170533 3300010375 Bacteria 886
264 Ga0105239_12906260 3300010375 Bacteria 559
265 Ga0105246_10175843 3300011119 Bacteria 1644
266 Ga0157327_1057974 3300012512 Unclassified 570
267 Ga0157373_10008760 3300013100 Bacteria 7497
268 Ga0157373_10011632 3300013100 Bacteria 6464
269 Ga0157373_10012272 3300013100 Bacteria 6299
270 Ga0157373_10030591 3300013100 Bacteria 3874
271 Ga0157373_10311529 3300013100 Bacteria 1118
272 Ga0157373_10704962 3300013100 Bacteria 740
273 Ga0157371_10000677 3300013102 Bacteria 40414
274 Ga0157371_10005841 3300013102 Bacteria 10295
275 Ga0157371_10076624 3300013102 Bacteria 2368
276 Ga0157371_10111377 3300013102 Bacteria 1943
277 Ga0157371_10245960 3300013102 Bacteria 1287
278 Ga0157370_10036773 3300013104 Bacteria 4749
279 Ga0157370_10074626 3300013104 Bacteria 3199
280 Ga0157370_10078115 3300013104 Bacteria 3117
281 Ga0157370_10325993 3300013104 Bacteria 1416
282 Ga0157370_11550416 3300013104 Unclassified 595
283 Ga0157369_10054264 3300013105 Bacteria 4328
284 Ga0157369_10086074 3300013105 Bacteria 3357
285 Ga0157369_10098687 3300013105 Bacteria 3114
286 Ga0157369_10165136 3300013105 Bacteria 2336
287 Ga0157369_10478496 3300013105 Bacteria 1289
288 Ga0157374_10023109 3300013296 Bacteria 5556
289 Ga0157374_10594014 3300013296 Bacteria 1117
290 Ga0157374_10669240 3300013296 Bacteria 1050
291 Ga0157374_11074170 3300013296 Bacteria 825
292 Ga0157374_12193689 3300013296 Bacteria 579
293 Ga0157378_10021724 3300013297 Bacteria 5643
294 Ga0163162_10270186 3300013306 Bacteria 1832
295 Ga0157372_10006715 3300013307 Bacteria 12236
296 Ga0157372_10113373 3300013307 Unclassified 3107
297 Ga0157372_10800906 3300013307 Bacteria 1095
298 Ga0157372_11077936 3300013307 Bacteria 930
299 Ga0157372_11570667 3300013307 Bacteria 757
300 Ga0157372_11894517 3300013307 Bacteria 685
301 Ga0157372_12521808 3300013307 Bacteria 590
302 Ga0157375_11473267 3300013308 Unclassified 803
303 Ga0163163_10000286 3300014325 Bacteria 50173
304 Ga0157377_10039076 3300014745 Bacteria 2623
305 Ga0157377_11239667 3300014745 Unclassified 579
306 Ga0157379_10054139 3300014968 Bacteria 3585
307 Ga0213875_10004474 3300021388 Bacteria 7651
308 Ga0207673_1007860 3300025290 Bacteria 1343
309 Ga0207697_10000026 3300025315 Bacteria 52498
310 Ga0207697_10143531 3300025315 Bacteria 1036
311 Ga0207656_10002865 3300025321 Bacteria 5877
312 Ga0207656_10006218 3300025321 Bacteria 4278
313 Ga0207656_10026868 3300025321 Bacteria 2350
314 Ga0207682_10064074 3300025893 Bacteria 1544
315 Ga0207642_10462555 3300025899 Unclassified 770
316 Ga0207688_10000055 3300025901 Bacteria 41067
317 Ga0207680_10000679 3300025903 Bacteria 16102
318 Ga0207680_10019109 3300025903 Bacteria 3660
319 Ga0207680_10492880 3300025903 Bacteria 872
320 Ga0207647_10000090 3300025904 Bacteria 69395
321 Ga0207647_10002311 3300025904 Bacteria 14524
322 Ga0207647_10009474 3300025904 Bacteria 6916
323 Ga0207647_10032637 3300025904 Bacteria 3342
324 Ga0207645_10006293 3300025907 Bacteria 8533
325 Ga0207645_10239232 3300025907 Bacteria 1199
326 Ga0207645_10381759 3300025907 Bacteria 946
327 Ga0207643_10025179 3300025908 Bacteria 3288
328 Ga0207705_10001534 3300025909 Bacteria 18330
329 Ga0207705_10010864 3300025909 Bacteria 6612
330 Ga0207705_10023773 3300025909 Bacteria 4372
331 Ga0207705_10037946 3300025909 Bacteria 3448
332 Ga0207705_10129892 3300025909 Bacteria 1874
333 Ga0207705_10161512 3300025909 Bacteria 1683
334 Ga0207705_10202273 3300025909 Bacteria 1505
335 Ga0207705_10225832 3300025909 Bacteria 1423
336 Ga0207705_10485281 3300025909 Bacteria 959
337 Ga0207705_10546714 3300025909 Bacteria 900
338 Ga0207705_10872900 3300025909 Bacteria 697
339 Ga0207654_10018852 3300025911 Bacteria 3628
340 Ga0207654_10193808 3300025911 Unclassified 1334
341 Ga0207654_10724396 3300025911 Bacteria 715
342 Ga0207654_10842814 3300025911 Unclassified 663
343 Ga0207707_10080228 3300025912 Bacteria 2849
344 Ga0207707_10218828 3300025912 Bacteria 1658
345 Ga0207695_10213188 3300025913 Bacteria 1841
346 Ga0207695_10809002 3300025913 Unclassified 817
347 Ga0207671_10028857 3300025914 Bacteria 4145
348 Ga0207660_10000789 3300025917 Bacteria 20979
349 Ga0207660_10039840 3300025917 Bacteria 3287
350 Ga0207662_10223148 3300025918 Bacteria 1228
351 Ga0207657_10000398 3300025919 Bacteria 46000
352 Ga0207657_10004604 3300025919 Bacteria 14577
353 Ga0207657_10008025 3300025919 Bacteria 10765
354 Ga0207657_10013799 3300025919 Bacteria 7908
355 Ga0207657_10019096 3300025919 Bacteria 6520
356 Ga0207657_10073495 3300025919 Bacteria 2889
357 Ga0207657_10149665 3300025919 Bacteria 1902
358 Ga0207657_10263181 3300025919 Bacteria 1372
359 Ga0207657_10890940 3300025919 Bacteria 686
360 Ga0207649_10009260 3300025920 Bacteria 5387
361 Ga0207649_10013380 3300025920 Bacteria 4580
362 Ga0207649_10032184 3300025920 Bacteria 3124
363 Ga0207649_10072415 3300025920 Bacteria 2205
364 Ga0207649_10366405 3300025920 Bacteria 1071
365 Ga0207649_10462961 3300025920 Bacteria 959
366 Ga0207649_10488590 3300025920 Bacteria 935
367 Ga0207649_10947762 3300025920 Unclassified 676
368 Ga0207652_10064449 3300025921 Bacteria 3171
369 Ga0207652_10117979 3300025921 Bacteria 2358
370 Ga0207652_10279466 3300025921 Bacteria 1506
371 Ga0207652_10456152 3300025921 Bacteria 1152
372 Ga0207652_11073014 3300025921 Unclassified 705
373 Ga0207652_11491180 3300025921 Bacteria 580
374 Ga0207681_10007365 3300025923 Bacteria 6739
375 Ga0207694_10001947 3300025924 Bacteria 17083
376 Ga0207694_10070560 3300025924 Bacteria 2730
377 Ga0207694_10208662 3300025924 Bacteria 1591
378 Ga0207694_10906134 3300025924 Bacteria 746
379 Ga0207650_10391409 3300025925 Bacteria 1149
380 Ga0207659_10191308 3300025926 Bacteria 1629
381 Ga0207687_10012804 3300025927 Bacteria 5481
382 Ga0207664_10353232 3300025929 Bacteria 1301
383 Ga0207664_11214934 3300025929 Unclassified 672
384 Ga0207664_11508453 3300025929 Unclassified 594
385 Ga0207644_10017714 3300025931 Bacteria 4816
386 Ga0207644_10027941 3300025931 Bacteria 3900
387 Ga0207644_10068266 3300025931 Bacteria 2593
388 Ga0207644_10083594 3300025931 Bacteria 2364
389 Ga0207644_10148256 3300025931 Bacteria 1813
390 Ga0207644_11413441 3300025931 Unclassified 584
391 Ga0207690_10000118 3300025932 Bacteria 65435
392 Ga0207690_10001646 3300025932 Bacteria 13801
393 Ga0207690_10037548 3300025932 Bacteria 3146
394 Ga0207690_10214637 3300025932 Bacteria 1469
395 Ga0207690_10507105 3300025932 Bacteria 976
396 Ga0207690_10566955 3300025932 Bacteria 924
397 Ga0207690_10913417 3300025932 Bacteria 728
398 Ga0207690_11298319 3300025932 Unclassified 608
399 Ga0207706_10000278 3300025933 Bacteria 55758
400 Ga0207706_10002548 3300025933 Bacteria 17760
401 Ga0207706_10008014 3300025933 Bacteria 9749
402 Ga0207706_10109956 3300025933 Bacteria 2425
403 Ga0207706_10374948 3300025933 Bacteria 1235
404 Ga0207706_10432201 3300025933 Bacteria 1140
405 Ga0207706_10457843 3300025933 Bacteria 1103
406 Ga0207706_10817779 3300025933 Bacteria 791
407 Ga0207709_10344991 3300025935 Unclassified 1122
408 Ga0207709_10579124 3300025935 Bacteria 886
409 Ga0207669_10030927 3300025937 Bacteria 2983
410 Ga0207704_10003727 3300025938 Bacteria 6937
411 Ga0207704_10392035 3300025938 Bacteria 1093
412 Ga0207691_10000045 3300025940 Bacteria 99798
413 Ga0207691_10088656 3300025940 Bacteria 2775
414 Ga0207711_10015916 3300025941 Bacteria 6238
415 Ga0207711_10020534 3300025941 Bacteria 5509
416 Ga0207711_10041870 3300025941 Bacteria 3901
417 Ga0207711_10510358 3300025941 Bacteria 1121
418 Ga0207711_12105729 3300025941 Unclassified 507
419 Ga0207689_10000182 3300025942 Bacteria 54476
420 Ga0207661_10070988 3300025944 Bacteria 2844
421 Ga0207661_10204226 3300025944 Bacteria 1739
422 Ga0207661_10296492 3300025944 Bacteria 1448
423 Ga0207661_10862034 3300025944 Bacteria 834
424 Ga0207661_10871544 3300025944 Bacteria 829
425 Ga0207661_10896264 3300025944 Bacteria 817
426 Ga0207679_10000268 3300025945 Bacteria 39812
427 Ga0207679_10026391 3300025945 Bacteria 4005
428 Ga0207679_10169833 3300025945 Bacteria 1794
429 Ga0207679_10218958 3300025945 Bacteria 1601
430 Ga0207679_10377213 3300025945 Bacteria 1242
431 Ga0207679_11074070 3300025945 Unclassified 738
432 Ga0207679_11670096 3300025945 Bacteria 583
433 Ga0207679_12187632 3300025945 Unclassified 502
434 Ga0207667_10002436 3300025949 Bacteria 23296
435 Ga0207667_10025648 3300025949 Bacteria 6450
436 Ga0207667_10085456 3300025949 Unclassified 3266
437 Ga0207651_10000633 3300025960 Bacteria 14881
438 Ga0207651_10073237 3300025960 Bacteria 2435
439 Ga0207651_10161659 3300025960 Bacteria 1756
440 Ga0207651_10221372 3300025960 Bacteria 1530
441 Ga0207668_10012342 3300025972 Bacteria 5228
442 Ga0207640_10002842 3300025981 Bacteria 9286
443 Ga0207640_10090933 3300025981 Bacteria 2113
444 Ga0207640_10105148 3300025981 Bacteria 1989
445 Ga0207640_10187116 3300025981 Bacteria 1558
446 Ga0207640_11734059 3300025981 Unclassified 564
447 Ga0207658_10004066 3300025986 Bacteria 10213
448 Ga0207658_10020543 3300025986 Bacteria 4572
449 Ga0207658_10124610 3300025986 Bacteria 2060
450 Ga0207677_10006759 3300026023 Bacteria 6300
451 Ga0207677_10672152 3300026023 Bacteria 916
452 Ga0207703_10011937 3300026035 Bacteria 6766
453 Ga0207703_10387265 3300026035 Bacteria 1294
454 Ga0207703_10548643 3300026035 Bacteria 1090
455 Ga0207639_10001100 3300026041 Bacteria 18365
456 Ga0207639_10001212 3300026041 Bacteria 17510
457 Ga0207639_10001674 3300026041 Bacteria 14956
458 Ga0207639_10799783 3300026041 Bacteria 879
459 Ga0207639_11776280 3300026041 Bacteria 577
460 Ga0207678_10004629 3300026067 Bacteria 12361
461 Ga0207678_10117594 3300026067 Bacteria 2268
462 Ga0207678_10181772 3300026067 Bacteria 1796
463 Ga0207678_10231365 3300026067 Bacteria 1582
464 Ga0207678_10711526 3300026067 Bacteria 884
465 Ga0207702_10000074 3300026078 Bacteria 113070
466 Ga0207702_10228699 3300026078 Bacteria 1737
467 Ga0207702_11804393 3300026078 Unclassified 604
468 Ga0207641_10004859 3300026088 Bacteria 11567
469 Ga0207641_10165640 3300026088 Bacteria 2013
470 Ga0207641_10434504 3300026088 Bacteria 1266
471 Ga0207648_10000222 3300026089 Bacteria 61156
472 Ga0207648_10004045 3300026089 Bacteria 15225
473 Ga0207648_10167849 3300026089 Bacteria 1939
474 Ga0207648_11979614 3300026089 Bacteria 544
475 Ga0207676_10001410 3300026095 Bacteria 17854
476 Ga0207676_10009768 3300026095 Bacteria 6824
477 Ga0207676_10012480 3300026095 Bacteria 6089
478 Ga0207674_10000793 3300026116 Bacteria 41212
479 Ga0207674_10003653 3300026116 Bacteria 18761
480 Ga0207674_10009227 3300026116 Bacteria 11305
481 Ga0207674_10019152 3300026116 Bacteria 7420
482 Ga0207674_10023276 3300026116 Bacteria 6637
483 Ga0207674_11045216 3300026116 Unclassified 786
484 Ga0207675_100078651 3300026118 Bacteria 3090
485 Ga0207683_10409215 3300026121 Bacteria 1248
486 Ga0207683_11118178 3300026121 Unclassified 731
487 Ga0207698_10001450 3300026142 Bacteria 13789
488 Ga0207698_10006563 3300026142 Bacteria 7270
489 Ga0207698_10069578 3300026142 Bacteria 2784
490 Ga0207698_10384975 3300026142 Bacteria 1335
491 Ga0207698_10412178 3300026142 Bacteria 1294
492 Ga0207698_10679784 3300026142 Bacteria 1022
493 Ga0207698_10708865 3300026142 Bacteria 1002
494 Ga0207698_11121924 3300026142 Bacteria 799
495 Ga0207698_11151438 3300026142 Bacteria 789
496 Ga0209974_10389410 3300027876 Unclassified 546
497 Ga0268266_10000200 3300028379 Bacteria 104456
498 Ga0268266_10099951 3300028379 Bacteria 2554
499 Ga0268266_10162195 3300028379 Bacteria 2023
500 Ga0268266_10544908 3300028379 Bacteria 1111
501 Ga0268266_11364042 3300028379 Unclassified 684
502 Ga0268266_11766389 3300028379 Unclassified 593
503 Ga0268265_10256415 3300028380 Unclassified 1552
504 Ga0268265_12345001 3300028380 Unclassified 540
505 Ga0268264_10034956 3300028381 Bacteria 4137
506 Ga0268264_10572768 3300028381 Bacteria 1110
507 Ga0307408_100262868 3300031548 Bacteria 1429
508 Ga0307408_101668532 3300031548 Bacteria 607
509 Ga0307405_10036289 3300031731 Bacteria 2952
510 Ga0307413_10021227 3300031824 Bacteria 3472
511 Ga0307413_10116286 3300031824 Bacteria 1801
512 Ga0307410_10013597 3300031852 Bacteria 4756
513 Ga0307410_10049945 3300031852 Bacteria 2810
514 Ga0307410_10101140 3300031852 Bacteria 2066
515 Ga0307410_10324679 3300031852 Bacteria 1222
516 Ga0307410_11047853 3300031852 Bacteria 705
517 Ga0307406_10145768 3300031901 Bacteria 1682
518 Ga0307406_11913993 3300031901 Unclassified 529
519 Ga0307412_10604398 3300031911 Bacteria 929
520 Ga0307409_100005858 3300031995 Bacteria 7138
521 Ga0307409_100144631 3300031995 Bacteria 2054
522 Ga0307409_102682516 3300031995 Bacteria 526
523 Ga0307414_10012775 3300032004 Bacteria 4981
524 Ga0307414_10294402 3300032004 Bacteria 1370
525 Ga0307414_10559567 3300032004 Bacteria 1020
526 Ga0307411_10100716 3300032005 Bacteria 2042
527 Ga0307411_11545148 3300032005 Bacteria 611
528 Ga0307411_11554499 3300032005 Bacteria 609
529 Ga0307415_100027057 3300032126 Bacteria 3628
530 Ga0373958_0157543 3300034819 Unclassified 572
531 Ga0373940_0171520 3300035088 Unclassified 701
532 Ga0373932_0405210 3300035112 Unclassified 528
533 Ga0373939_0099489 3300035114 Bacteria 996
534 Ga0373960_0059088 3300035121 Bacteria 1158
535 Ga0373961_0338057 3300035241 Unclassified 565
536 Ga0373931_0106868 3300035691 Bacteria 1582
537 Ga0395899_0001927 3300037312 Bacteria 17093
538 Ga0395899_0146000 3300037312 Bacteria 1680
539 Ga0395899_0151444 3300037312 Bacteria 1643
540 Ga0395899_0395411 3300037312 Bacteria 916
541 Ga0395899_0510795 3300037312 Bacteria 778
542 Ga0395899_0731855 3300037312 Bacteria 617
543 Ga0395900_0042488 3300037418 Bacteria 4684
544 Ga0395900_0081867 3300037418 Bacteria 3316
545 Ga0395900_0085963 3300037418 Bacteria 3232
546 Ga0395900_0386908 3300037418 Bacteria 1365
547 Ga0395900_0598780 3300037418 Bacteria 1043
548 Ga0395900_0608395 3300037418 Bacteria 1033
549 Ga0395900_0734868 3300037418 Bacteria 918
550 Ga0395898_0112239 3300037466 Bacteria 2612
551 Ga0395898_0566517 3300037466 Bacteria 1078
552 Ga0395898_0803034 3300037466 Bacteria 881
553 Ga0395905_0027180 3300037471 Bacteria 5396
554 Ga0395905_0085092 3300037471 Bacteria 2963
555 Ga0395905_0113075 3300037471 Bacteria 2550
556 Ga0395905_0121308 3300037471 Bacteria 2457
557 Ga0395905_0267786 3300037471 Bacteria 1594
558 Ga0395905_0302578 3300037471 Bacteria 1487
559 Ga0395905_0798934 3300037471 Bacteria 846
560 Ga0395905_0857879 3300037471 Bacteria 811
561 Ga0436364_0490014 3300037853 Bacteria 17577
562 Ga0395901_0002711 3300038443 Bacteria 17836
563 Ga0395901_0114670 3300038443 Bacteria 2830
564 Ga0395901_0155383 3300038443 Bacteria 2403
565 Ga0395901_1203314 3300038443 Bacteria 723
566 Ga0395901_1806518 3300038443 Unclassified 560
567 Ga0450916_083098 3300042530 Bacteria 549
568 Ga0466972_0279763 3300044658 Bacteria 780
569 Ga0466966_0003926 3300044684 Bacteria 9821
570 Ga0466966_0074004 3300044684 Bacteria 2130
571 Ga0466966_0731789 3300044684 Bacteria 596
572 Ga0466961_0107255 3300044693 Bacteria 1758
573 Ga0466971_0252558 3300044719 Bacteria 840
574 Ga0466971_0296218 3300044719 Bacteria 776
575 Ga0466970_0066874 3300044765 Bacteria 1929
576 Ga0466970_0082017 3300044765 Bacteria 1744
577 Ga0466970_0179472 3300044765 Bacteria 1175
578 Ga0466970_0936429 3300044765 Unclassified 510
579 Ga0466957_0001054 3300044842 Bacteria 14216
580 Ga0466957_0040076 3300044842 Bacteria 2828
581 Ga0466959_0010758 3300045049 Bacteria 6555
582 Ga0466959_0037659 3300045049 Bacteria 3574
583 Ga0466958_0068224 3300045836 Bacteria 2174
584 Ga0466967_0015738 3300045976 Bacteria 5941
585 Ga0466967_0051276 3300045976 Bacteria 3615
586 Ga0466967_0271695 3300045976 Bacteria 1624
587 Ga0466967_1286782 3300045976 Bacteria 728
588 Ga0466967_1932278 3300045976 Unclassified 587
589 Ga0495582_0507942 3300046473 Bacteria 697
590 Ga0495616_0127898 3300046513 Bacteria 1167
591 Ga0495620_0175079 3300046515 Bacteria 831
592 Ga0495663_0366640 3300046525 Unclassified 526
593 Ga0495654_0158855 3300046530 Bacteria 994
594 Ga0495668_0058730 3300046616 Bacteria 2122
595 Ga0495668_0187386 3300046616 Bacteria 1133
596 Ga0495661_0171900 3300046665 Bacteria 1155
597 Ga0495669_0000689 3300046684 Bacteria 14750
598 Ga0495669_0004791 3300046684 Bacteria 5611
599 Ga0495669_0027924 3300046684 Bacteria 2469
600 Ga0495669_0169773 3300046684 Bacteria 1037
601 Ga0495660_0198084 3300046810 Bacteria 961
602 Ga0495683_0330023 3300047323 Unclassified 648
603 Ga0495677_0011187 3300047445 Bacteria 3285
604 Ga0495677_0208532 3300047445 Bacteria 760
605 Ga0495685_146101 3300047447 Bacteria 769
606 Ga0495681_0372516 3300047470 Bacteria 539
607 Ga0496100_0074399 3300048903 Bacteria 2276
608 Ga0496101_0041941 3300048904 Bacteria 3266
609 Ga0496101_1303286 3300048904 Unclassified 568
610 Ga0496102_0304612 3300048905 Bacteria 1502
611 Ga0496104_0777076 3300048907 Bacteria 864
612 Ga0496104_0830551 3300048907 Bacteria 830
613 Ga0496104_1286447 3300048907 Unclassified 634
614 Ga0496105_0230345 3300048908 Bacteria 1506
615 Ga0496106_0016967 3300048909 Bacteria 5389
616 Ga0496106_0540661 3300048909 Unclassified 935
617 Ga0496107_0166690 3300048910 Bacteria 1633
618 Ga0496107_0495251 3300048910 Bacteria 907
619 Ga0496108_0006089 3300048911 Bacteria 9757
620 Ga0496108_0026600 3300048911 Bacteria 4773
621 Ga0496108_0437038 3300048911 Bacteria 1143
622 Ga0496109_0311331 3300048912 Bacteria 1485
623 Ga0496109_0936569 3300048912 Bacteria 804
624 Ga0496110_0011578 3300048913 Bacteria 7230
625 Ga0496110_0062475 3300048913 Bacteria 3289
626 Ga0496110_1231230 3300048913 Unclassified 657
627 Ga0496111_0016562 3300048914 Bacteria 5082
628 Ga0496111_0025007 3300048914 Bacteria 4212
629 Ga0496111_0235387 3300048914 Bacteria 1360
630 Ga0496111_0871120 3300048914 Bacteria 649
631 Ga0496112_0009427 3300048915 Bacteria 8797
632 Ga0496112_0012508 3300048915 Bacteria 7798
633 Ga0496112_0141618 3300048915 Bacteria 2374
634 Ga0496113_0028225 3300048916 Bacteria 4033
635 Ga0496113_0069038 3300048916 Bacteria 2683
636 Ga0496113_0275167 3300048916 Bacteria 1346
637 Ga0496114_0845899 3300048917 Bacteria 795
638 Ga0496115_0016872 3300048918 Bacteria 5568
639 Ga0501070_0760734 3300049586 Unclassified 763
640 Ga0501080_0040132 3300049742 Bacteria 4367
641 nmdc:mga07m45_280539_c1 3300050496 Unclassified 969
642 Ga0500604_0138757 3300053151 Bacteria 821
643 Ga0466962_0021288 3300061719 Bacteria 3115
644 Ga0466962_0712550 3300061719 Bacteria 515
645 JGI24740J21852_10193098
646 JGI24752J21851_1051018
647 JGI24746J21847_1016930
648 JGI24747J21853_1006818
649 JGI24740J21852_10000977
650 JGI24739J22299_10000244
651 JGI24739J22299_10003397
652 JGI24737J22298_10000021
653 JGI24737J22298_10002931
654 JGI24737J22298_10125656
655 JGI24737J22298_10203469
656 JGI24743J22301_10127476
657 JGI24735J21928_10002755
658 JGI24735J21928_10008217
659 JGI24735J21928_10027750
660 JGI24735J21928_10030031
661 JGI24735J21928_10045848
662 JGI24745J21846_1003272
663 JGI24738J21930_10000082
664 JGI24738J21930_10000308
665 JGI24749J21850_1036949
666 JGI24034J26672_10008380
667 Ga0070658_10002766
668 Ga0070658_10083018
669 Ga0070658_10085658
670 Ga0070658_10159106
671 Ga0070658_10271535
672 Ga0070658_10361327
673 Ga0070658_10549251
674 Ga0070676_10001550
675 Ga0070676_10154958
676 Ga0070676_10600560
677 Ga0070683_100012482
678 Ga0070683_100032089
679 Ga0070683_100055007
680 Ga0070683_100857102
681 Ga0070683_101061225
682 Ga0070690_100002787
683 Ga0070690_100600022
684 Ga0070670_100341252
685 Ga0070670_101089598
686 Ga0070670_101565609
687 Ga0070677_10111647
688 Ga0068869_100000896
689 Ga0070666_10000591
690 Ga0070666_10033887
691 Ga0070666_11301066
692 Ga0070680_100002786
693 Ga0070680_100085243
694 Ga0070680_100186052
695 Ga0070680_100412194
696 Ga0070680_101105943
697 Ga0070682_100792016
698 Ga0068868_100000637
699 Ga0068868_100952022
700 Ga0070660_100001567
701 Ga0070660_100006246
702 Ga0070660_100006915
703 Ga0070660_100019696
704 Ga0070660_100075813
705 Ga0070660_100125747
706 Ga0070660_100405607
707 Ga0070660_100738080
708 Ga0070660_101174002
709 Ga0070660_101255177
710 Ga0070660_101711812
711 Ga0070689_100063943
712 Ga0070687_100207904
713 Ga0070661_100000354
714 Ga0070661_100005769
715 Ga0070661_100073362
716 Ga0070661_100100777
717 Ga0070661_100116977
718 Ga0070661_100119660
719 Ga0070661_100380746
720 Ga0070661_100449761
721 Ga0070661_100775966
722 Ga0070661_101577593
723 Ga0070692_10315834
724 Ga0070692_10961652
725 Ga0070668_100013342
726 Ga0070668_100860998
727 Ga0070669_100013883
728 Ga0070669_100453755
729 Ga0070675_100010773
730 Ga0070671_100001348
731 Ga0070671_100003822
732 Ga0070671_100012669
733 Ga0070671_100021608
734 Ga0070671_100143911
735 Ga0070671_101858869
736 Ga0070674_100145370
737 Ga0070674_100246229
738 Ga0070673_100000209
739 Ga0070673_100028268
740 Ga0070673_100060711
741 Ga0070673_100195628
742 Ga0070673_100480494
743 Ga0070673_100726459
744 Ga0070673_101408951
745 Ga0070688_100091703
746 Ga0070659_100000311
747 Ga0070659_100001928
748 Ga0070659_100008027
749 Ga0070659_100281499
750 Ga0070659_100424925
751 Ga0070659_100517511
752 Ga0070659_100540610
753 Ga0070659_101417056
754 Ga0070659_101533094
755 Ga0070667_100001148
756 Ga0070667_100048873
757 Ga0070667_100250044
758 Ga0070667_100715409
759 Ga0070714_101008560
760 Ga0070713_101301690
761 Ga0070663_100009045
762 Ga0070663_100088777
763 Ga0070663_100156469
764 Ga0070663_100447001
765 Ga0070663_100695394
766 Ga0070663_100695409
767 Ga0070663_100808802
768 Ga0070663_101005860
769 Ga0070678_100000804
770 Ga0070678_101285493
771 Ga0070678_101321416
772 Ga0070662_100001149
773 Ga0070662_100001649
774 Ga0070662_100024916
775 Ga0070662_100267232
776 Ga0070662_100511334
777 Ga0070662_100516610
778 Ga0070681_10040080
779 Ga0070681_10045157
780 Ga0070681_11030193
781 Ga0068867_100000633
782 Ga0068867_100002541
783 Ga0070679_100062128
784 Ga0070679_100148250
785 Ga0070679_100157722
786 Ga0070679_100430898
787 Ga0070679_100670423
788 Ga0070679_100851969
789 Ga0070684_100001845
790 Ga0070684_100107100
791 Ga0070684_100213303
792 Ga0070684_100348104
793 Ga0070684_101076862
794 Ga0068853_100000404
795 Ga0068853_100001473
796 Ga0068853_100010121
797 Ga0068853_100140588
798 Ga0068853_100663735
799 Ga0068853_100738332
800 Ga0068853_100756327
801 Ga0070672_100004346
802 Ga0070672_100031449
803 Ga0070686_101065290
804 Ga0070686_101922228
805 Ga0070693_100014631
806 Ga0070693_100572298
807 Ga0070665_100000590
808 Ga0070665_100059124
809 Ga0070665_100123581
810 Ga0070665_100163802
811 Ga0070665_100603228
812 Ga0068855_100004167
813 Ga0068855_100017154
814 Ga0068855_100043857
815 Ga0068855_100407780
816 Ga0068855_101077928
817 Ga0068855_101317417
818 Ga0070664_100000128
819 Ga0070664_100021543
820 Ga0070664_100099814
821 Ga0070664_100181939
822 Ga0070664_100353725
823 Ga0070664_101032785
824 Ga0070664_101429535
825 Ga0070664_101454443
826 Ga0070664_101833979
827 Ga0068857_100000570
828 Ga0068857_100017002
829 Ga0068854_100005081
830 Ga0068854_100102966
831 Ga0068854_100169471
832 Ga0068854_101552024
833 Ga0068856_100001416
834 Ga0068856_100044598
835 Ga0068856_100239690
836 Ga0068856_100468394
837 Ga0068856_101050579
838 Ga0068856_101612640
839 Ga0068856_102719801
840 Ga0068852_100000446
841 Ga0068852_100001523
842 Ga0068852_100071660
843 Ga0068852_100110928
844 Ga0068852_100322179
845 Ga0068852_100787600
846 Ga0068852_100882112
847 Ga0068852_101022789
848 Ga0068852_101378494
849 Ga0068859_100000478
850 Ga0068859_100533264
851 Ga0068864_100000174
852 Ga0068864_100002622
853 Ga0068864_100088808
854 Ga0068864_100667860
855 Ga0068866_10041886
856 Ga0068861_100058275
857 Ga0068851_10005314
858 Ga0068851_10011295
859 Ga0068851_10071746
860 Ga0068870_10007747
861 Ga0068863_100001778
862 Ga0068863_100206476
863 Ga0068863_100459670
864 Ga0068858_100000600
865 Ga0068858_100249150
866 Ga0068858_101319806
867 Ga0068860_100005305
868 Ga0068860_100783368
869 Ga0068860_101666758
870 Ga0068862_100103908
871 Ga0068862_100931291
872 Ga0097621_100010999
873 Ga0097621_100016747
874 Ga0097621_100129486
875 Ga0097621_100825347
876 Ga0097621_101353518
877 Ga0075370_10401537
878 Ga0068871_100080563
879 Ga0068871_100160604
880 Ga0068865_100000240
881 Ga0097620_100000478
882 Ga0097620_100533273
883 Ga0105240_10041889
884 Ga0105240_12002143
885 Ga0105245_10000300
886 Ga0105247_10609242
887 Ga0105247_11602487
888 Ga0105243_10073988
889 Ga0105241_10002793
890 Ga0105241_10022450
891 Ga0105241_10458482
892 Ga0105241_11532947
893 Ga0105248_10000206
894 Ga0105248_10013573
895 Ga0105248_10446362
896 Ga0105248_13024577
897 Ga0105237_10039873
898 Ga0105237_11729907
899 Ga0105238_10008651
900 Ga0105238_10145938
901 Ga0105238_10231353
902 Ga0105238_10326247
903 Ga0105238_10455296
904 Ga0105238_10487749
905 Ga0105239_10343935
906 Ga0105239_11100936
907 Ga0105239_11170533
908 Ga0105239_12906260
909 Ga0105246_10175843
910 Ga0157327_1057974
911 Ga0157373_10008760
912 Ga0157373_10011632
913 Ga0157373_10012272
914 Ga0157373_10030591
915 Ga0157373_10311529
916 Ga0157373_10704962
917 Ga0157371_10000677
918 Ga0157371_10005841
919 Ga0157371_10076624
920 Ga0157371_10111377
921 Ga0157371_10245960
922 Ga0157370_10036773
923 Ga0157370_10074626
924 Ga0157370_10078115
925 Ga0157370_10325993
926 Ga0157370_11550416
927 Ga0157369_10054264
928 Ga0157369_10086074
929 Ga0157369_10098687
930 Ga0157369_10165136
931 Ga0157369_10478496
932 Ga0157374_10023109
933 Ga0157374_10594014
934 Ga0157374_10669240
935 Ga0157374_11074170
936 Ga0157374_12193689
937 Ga0157378_10021724
938 Ga0163162_10270186
939 Ga0157372_10006715
940 Ga0157372_10113373
941 Ga0157372_10800906
942 Ga0157372_11077936
943 Ga0157372_11570667
944 Ga0157372_11894517
945 Ga0157372_12521808
946 Ga0157375_11473267
947 Ga0163163_10000286
948 Ga0157377_10039076
949 Ga0157377_11239667
950 Ga0157379_10054139
951 Ga0213875_10004474
952 Ga0207673_1007860
953 Ga0207697_10000026
954 Ga0207697_10143531
955 Ga0207656_10002865
956 Ga0207656_10006218
957 Ga0207656_10026868
958 Ga0207682_10064074
959 Ga0207642_10462555
960 Ga0207688_10000055
961 Ga0207680_10000679
962 Ga0207680_10019109
963 Ga0207680_10492880
964 Ga0207647_10000090
965 Ga0207647_10002311
966 Ga0207647_10009474
967 Ga0207647_10032637
968 Ga0207645_10006293
969 Ga0207645_10239232
970 Ga0207645_10381759
971 Ga0207643_10025179
972 Ga0207705_10001534
973 Ga0207705_10010864
974 Ga0207705_10023773
975 Ga0207705_10037946
976 Ga0207705_10129892
977 Ga0207705_10161512
978 Ga0207705_10202273
979 Ga0207705_10225832
980 Ga0207705_10485281
981 Ga0207705_10546714
982 Ga0207705_10872900
983 Ga0207654_10018852
984 Ga0207654_10193808
985 Ga0207654_10724396
986 Ga0207654_10842814
987 Ga0207707_10080228
988 Ga0207707_10218828
989 Ga0207695_10213188
990 Ga0207695_10809002
991 Ga0207671_10028857
992 Ga0207660_10000789
993 Ga0207660_10039840
994 Ga0207662_10223148
995 Ga0207657_10000398
996 Ga0207657_10004604
997 Ga0207657_10008025
998 Ga0207657_10013799
999 Ga0207657_10019096
1000 Ga0207657_10073495
1001 Ga0207657_10149665
1002 Ga0207657_10263181
1003 Ga0207657_10890940
1004 Ga0207649_10009260
1005 Ga0207649_10013380
1006 Ga0207649_10032184
1007 Ga0207649_10072415
1008 Ga0207649_10366405
1009 Ga0207649_10462961
1010 Ga0207649_10488590
1011 Ga0207649_10947762
1012 Ga0207652_10064449
1013 Ga0207652_10117979
1014 Ga0207652_10279466
1015 Ga0207652_10456152
1016 Ga0207652_11073014
1017 Ga0207652_11491180
1018 Ga0207681_10007365
1019 Ga0207694_10001947
1020 Ga0207694_10070560
1021 Ga0207694_10208662
1022 Ga0207694_10906134
1023 Ga0207650_10391409
1024 Ga0207659_10191308
1025 Ga0207687_10012804
1026 Ga0207664_10353232
1027 Ga0207664_11214934
1028 Ga0207664_11508453
1029 Ga0207644_10017714
1030 Ga0207644_10027941
1031 Ga0207644_10068266
1032 Ga0207644_10083594
1033 Ga0207644_10148256
1034 Ga0207644_11413441
1035 Ga0207690_10000118
1036 Ga0207690_10001646
1037 Ga0207690_10037548
1038 Ga0207690_10214637
1039 Ga0207690_10507105
1040 Ga0207690_10566955
1041 Ga0207690_10913417
1042 Ga0207690_11298319
1043 Ga0207706_10000278
1044 Ga0207706_10002548
1045 Ga0207706_10008014
1046 Ga0207706_10109956
1047 Ga0207706_10374948
1048 Ga0207706_10432201
1049 Ga0207706_10457843
1050 Ga0207706_10817779
1051 Ga0207709_10344991
1052 Ga0207709_10579124
1053 Ga0207669_10030927
1054 Ga0207704_10003727
1055 Ga0207704_10392035
1056 Ga0207691_10000045
1057 Ga0207691_10088656
1058 Ga0207711_10015916
1059 Ga0207711_10020534
1060 Ga0207711_10041870
1061 Ga0207711_10510358
1062 Ga0207711_12105729
1063 Ga0207689_10000182
1064 Ga0207661_10070988
1065 Ga0207661_10204226
1066 Ga0207661_10296492
1067 Ga0207661_10862034
1068 Ga0207661_10871544
1069 Ga0207661_10896264
1070 Ga0207679_10000268
1071 Ga0207679_10026391
1072 Ga0207679_10169833
1073 Ga0207679_10218958
1074 Ga0207679_10377213
1075 Ga0207679_11074070
1076 Ga0207679_11670096
1077 Ga0207679_12187632
1078 Ga0207667_10002436
1079 Ga0207667_10025648
1080 Ga0207667_10085456
1081 Ga0207651_10000633
1082 Ga0207651_10073237
1083 Ga0207651_10161659
1084 Ga0207651_10221372
1085 Ga0207668_10012342
1086 Ga0207640_10002842
1087 Ga0207640_10090933
1088 Ga0207640_10105148
1089 Ga0207640_10187116
1090 Ga0207640_11734059
1091 Ga0207658_10004066
1092 Ga0207658_10020543
1093 Ga0207658_10124610
1094 Ga0207677_10006759
1095 Ga0207677_10672152
1096 Ga0207703_10011937
1097 Ga0207703_10387265
1098 Ga0207703_10548643
1099 Ga0207639_10001100
1100 Ga0207639_10001212
1101 Ga0207639_10001674
1102 Ga0207639_10799783
1103 Ga0207639_11776280
1104 Ga0207678_10004629
1105 Ga0207678_10117594
1106 Ga0207678_10181772
1107 Ga0207678_10231365
1108 Ga0207678_10711526
1109 Ga0207702_10000074
1110 Ga0207702_10228699
1111 Ga0207702_11804393
1112 Ga0207641_10004859
1113 Ga0207641_10165640
1114 Ga0207641_10434504
1115 Ga0207648_10000222
1116 Ga0207648_10004045
1117 Ga0207648_10167849
1118 Ga0207648_11979614
1119 Ga0207676_10001410
1120 Ga0207676_10009768
1121 Ga0207676_10012480
1122 Ga0207674_10000793
1123 Ga0207674_10003653
1124 Ga0207674_10009227
1125 Ga0207674_10019152
1126 Ga0207674_10023276
1127 Ga0207674_11045216
1128 Ga0207675_100078651
1129 Ga0207683_10409215
1130 Ga0207683_11118178
1131 Ga0207698_10001450
1132 Ga0207698_10006563
1133 Ga0207698_10069578
1134 Ga0207698_10384975
1135 Ga0207698_10412178
1136 Ga0207698_10679784
1137 Ga0207698_10708865
1138 Ga0207698_11121924
1139 Ga0207698_11151438
1140 Ga0209974_10389410
1141 Ga0268266_10000200
1142 Ga0268266_10099951
1143 Ga0268266_10162195
1144 Ga0268266_10544908
1145 Ga0268266_11364042
1146 Ga0268266_11766389
1147 Ga0268265_10256415
1148 Ga0268265_12345001
1149 Ga0268264_10034956
1150 Ga0268264_10572768
1151 Ga0307408_100262868
1152 Ga0307408_101668532
1153 Ga0307405_10036289
1154 Ga0307413_10021227
1155 Ga0307413_10116286
1156 Ga0307410_10013597
1157 Ga0307410_10049945
1158 Ga0307410_10101140
1159 Ga0307410_10324679
1160 Ga0307410_11047853
1161 Ga0307406_10145768
1162 Ga0307406_11913993
1163 Ga0307412_10604398
1164 Ga0307409_100005858
1165 Ga0307409_100144631
1166 Ga0307409_102682516
1167 Ga0307414_10012775
1168 Ga0307414_10294402
1169 Ga0307414_10559567
1170 Ga0307411_10100716
1171 Ga0307411_11545148
1172 Ga0307411_11554499
1173 Ga0307415_100027057
1174 Ga0373958_0157543
1175 Ga0373940_0171520
1176 Ga0373932_0405210
1177 Ga0373939_0099489
1178 Ga0373960_0059088
1179 Ga0373961_0338057
1180 Ga0373931_0106868
1181 Ga0395899_0001927
1182 Ga0395899_0146000
1183 Ga0395899_0151444
1184 Ga0395899_0395411
1185 Ga0395899_0510795
1186 Ga0395899_0731855
1187 Ga0395900_0042488
1188 Ga0395900_0081867
1189 Ga0395900_0085963
1190 Ga0395900_0386908
1191 Ga0395900_0598780
1192 Ga0395900_0608395
1193 Ga0395900_0734868
1194 Ga0395898_0112239
1195 Ga0395898_0566517
1196 Ga0395898_0803034
1197 Ga0395905_0027180
1198 Ga0395905_0085092
1199 Ga0395905_0113075
1200 Ga0395905_0121308
1201 Ga0395905_0267786
1202 Ga0395905_0302578
1203 Ga0395905_0798934
1204 Ga0395905_0857879
1205 Ga0436364_0490014
1206 Ga0395901_0002711
1207 Ga0395901_0114670
1208 Ga0395901_0155383
1209 Ga0395901_1203314
1210 Ga0395901_1806518
1211 Ga0450916_083098
1212 Ga0466972_0279763
1213 Ga0466966_0003926
1214 Ga0466966_0074004
1215 Ga0466966_0731789
1216 Ga0466961_0107255
1217 Ga0466971_0252558
1218 Ga0466971_0296218
1219 Ga0466970_0066874
1220 Ga0466970_0082017
1221 Ga0466970_0179472
1222 Ga0466970_0936429
1223 Ga0466957_0001054
1224 Ga0466957_0040076
1225 Ga0466959_0010758
1226 Ga0466959_0037659
1227 Ga0466958_0068224
1228 Ga0466967_0015738
1229 Ga0466967_0051276
1230 Ga0466967_0271695
1231 Ga0466967_1286782
1232 Ga0466967_1932278
1233 Ga0495582_0507942
1234 Ga0495616_0127898
1235 Ga0495620_0175079
1236 Ga0495663_0366640
1237 Ga0495654_0158855
1238 Ga0495668_0058730
1239 Ga0495668_0187386
1240 Ga0495661_0171900
1241 Ga0495669_0000689
1242 Ga0495669_0004791
1243 Ga0495669_0027924
1244 Ga0495669_0169773
1245 Ga0495660_0198084
1246 Ga0495683_0330023
1247 Ga0495677_0011187
1248 Ga0495677_0208532
1249 Ga0495685_146101
1250 Ga0495681_0372516
1251 Ga0496100_0074399
1252 Ga0496101_0041941
1253 Ga0496101_1303286
1254 Ga0496102_0304612
1255 Ga0496104_0777076
1256 Ga0496104_0830551
1257 Ga0496104_1286447
1258 Ga0496105_0230345
1259 Ga0496106_0016967
1260 Ga0496106_0540661
1261 Ga0496107_0166690
1262 Ga0496107_0495251
1263 Ga0496108_0006089
1264 Ga0496108_0026600
1265 Ga0496108_0437038
1266 Ga0496109_0311331
1267 Ga0496109_0936569
1268 Ga0496110_0011578
1269 Ga0496110_0062475
1270 Ga0496110_1231230
1271 Ga0496111_0016562
1272 Ga0496111_0025007
1273 Ga0496111_0235387
1274 Ga0496111_0871120
1275 Ga0496112_0009427
1276 Ga0496112_0012508
1277 Ga0496112_0141618
1278 Ga0496113_0028225
1279 Ga0496113_0069038
1280 Ga0496113_0275167
1281 Ga0496114_0845899
1282 Ga0496115_0016872
1283 Ga0501070_0760734
1284 Ga0501080_0040132
1285 nmdc:mga07m45_280539_c1
1286 Ga0500604_0138757
1287 Ga0466962_0021288
1288 Ga0466962_0712550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tzs-assembly1.cif.gz_A structure of human wls 0.5663 5 29
4iit-assembly1.cif.gz_B-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.5462 5 64
4qku-assembly2.cif.gz_D crystal structure of a putative hydrolase from burkholderia cenocepacia 0.5275 5 32
4blg-assembly1.cif.gz_B crystal structure of mhv-68 latency-associated nuclear antigen (lana) c-terminal dna binding domain 0.5021 5 64
5flg-assembly1.cif.gz_A crystal structure of the 6-carboxyhexanoate-coa ligase (biow)from bacillus subtilis in complex with amppnp 0.4893 5 60
ID Description Score Start End Superfamily
af_A1Z8P1_39_175_2.70.220.10 Mainly Beta;Distorted Sandwich;Ganglioside M2 Activator Protein; Chain: A,;Ganglioside GM2 activator 0.6784 5 29 2.70.220.10
af_E9Q861_219_331_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.5706 5 32 2.60.40.150
af_A0A1D8PE86_130_351_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.5578 7 28 2.60.120.260
af_Q80XU5_189_332_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.5424 5 32 2.60.40.150
2mheB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Uncharacterised protein PF13773, DUF4170 0.5341 6 59 3.30.70.2400
ID Description Score Start End GO Terms
AF-A0A6G6Y1F9-F1-model_v4 Lipoprotein 0.9556 5 60
AF-A0A2E2ZWW0-F1-model_v4 deleted 0.9491 5 60
AF-A0A430BHF9-F1-model_v4 Uncharacterized protein 0.9383 5 60
AF-A0A537MIY2-F1-model_v4 Lipoprotein 0.9294 1 62
AF-A0A1X7G5G4-F1-model_v4 Uncharacterized protein 0.9238 1 63

Map