F471952

General Info

Members Datasets Scaffolds Average Seq Length
643 269 584 438

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10004410|Ga0207690_100044106
Length 497
Sequence MSVANSDCTVNNIKLLPRAPRMPLMQPGMIGYKMRFLYFLCAYKACGSRNEETMSLPLILNLAIALAGCGLLYTMQQRHLSFTKRVFTGLGLGIVLGAAFQAFYGTGAPVIAQTNAYLDIVGTGYVKLLQMIIMPLIMVSIIQAILKLRDASSLGKISLLTIGTLMVTTAIAATIGILMAKLYGLSAVGLTSSAAEVARGHYLEGKLATAQDVSLPTLILSFIPENPFLDMTGARKTSTIAVVLFSIFIGVSATGIAAKKPDVFEKFSEFVHVAHVIVMRMVTLVLRLTPFGVFALITQVLASSSLQDIVNLIGFVMASYNALILMFGVHLVIIAAVGLNPGRYVKKIFPVLAFAFTSRTSAGSIPMSVQTQTARLGTPEGIANFAASFGSMMGQNGCAGIYPAMLAVMIAPTVGIDPFTSGFLLPLVIVLSALNLPVALAGLLISIEPLIDMGRTALNVSGSITAGTFASRVLGQTDMRVFDSDADANLDSEEQVA

Samples

Sample ID Description Type Environment
1 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
2 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
3 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221638 Duganella sp. Root336D2 Isolate Unclassified
6 2643221664 Massilia sp. Root418 Isolate Unclassified
7 2643221684 Massilia sp. Root133 Isolate Unclassified
8 2643221729 Bacillus sp. Root11 Isolate Unclassified
9 2643221730 Bacillus sp. Root131 Isolate Unclassified
10 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
11 2684622632 Bacillus cereus 905 Isolate Unclassified
12 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
13 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
14 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
15 2738541280 Massilia sp. GV090 Isolate Unclassified
16 2738541297 Duganella sp. GV083 Isolate Unclassified
17 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
18 2738541300 Massilia sp. GV016 Isolate Unclassified
19 2738541357 Duganella sp. GV053 Isolate Unclassified
20 2738541358 Bacillus sp. OV752 Isolate Unclassified
21 2738543003 Duganella sp. GV066 Isolate Unclassified
22 2738543006 Bacillus sp. OK077 Isolate Unclassified
23 2738543018 Massilia sp. GV045 Isolate Unclassified
24 2738543026 Duganella sp. GV089 Isolate Unclassified
25 2738543029 Duganella sp. GV039 Isolate Unclassified
26 2738543030 Massilia sp. GV097 Isolate Unclassified
27 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
28 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
29 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
30 2821131069 Duganella sp. 1224 Isolate Unclassified
31 2842682962 Bacillus sp. R-72492 Isolate Unclassified
32 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
33 2849139964 Bacillus sp. R-71875 Isolate Unclassified
34 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
35 2857553236 Duganella sp. R-74557 Isolate Unclassified
36 2857564685 Duganella sp. R-74599 Isolate Unclassified
37 2857581216 Bacillus sp. R-71922 Isolate Unclassified
38 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
39 2904424332 Duganella sp. 1411 Isolate Rhizosphere
40 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
41 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
42 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
43 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
44 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
45 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
46 2938917290 Bacillus sp. CR71 Isolate Unclassified
47 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
48 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
49 2965761152 Bacillus sp. COPE52 Isolate Unclassified
50 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
51 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
52 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
53 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
54 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
55 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
58 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
59 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
106 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
107 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
108 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
120 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
121 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
259 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
264 8022792930 Bacillus sp. Xin Isolate Rhizosphere
265 8023438354 Bacillus sp. BH2 Isolate Unclassified
266 8023444577 Bacillus sp. BH32 Isolate Unclassified
267 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
268 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
269 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.14
Metatranscriptomes 6.69
Isolates 9.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7
Nodule 0.62
Rhizoplane 2.18
Rhizosphere 79.94
Stem 0
Stem Tuber 0
Unclassified 10.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000078 3300002773 Bacteria 65830
2 JGI25150J39212_1000136 3300002774 Bacteria 41521
3 JGI25159J45721_1007043 3300002987 Bacteria 3279
4 JGI25159J45721_1016942 3300002987 Bacteria 1530
5 JGI25151J46595_10007016 3300003187 Bacteria 5574
6 JGI25151J46595_10017170 3300003187 Bacteria 3148
7 JGI25153J46596_10002503 3300003215 Bacteria 10548
8 rootL2_10093230 3300003322 Bacteria 4840
9 rootL2_10093232 3300003322 Bacteria 4912
10 Ga0055525_1000029 3300003759 Bacteria 320663
11 Ga0055526_1001986 3300003771 Bacteria 14103
12 Ga0055537_1000804 3300003773 Bacteria 15551
13 Ga0055524_1000134 3300003775 Bacteria 87367
14 Ga0055524_1000201 3300003775 Bacteria 65147
15 Ga0055534_1003076 3300003784 Bacteria 5442
16 Ga0055528_1001228 3300003790 Bacteria 16352
17 Ga0055543_1004844 3300004625 Bacteria 3566
18 Ga0065165_1001270 3300005262 Bacteria 28540
19 Ga0065165_1004256 3300005262 Bacteria 9049
20 Ga0070659_100036801 3300005366 Bacteria 3815
21 Ga0070662_100124231 3300005457 Bacteria 1981
22 Ga0079104_1004592 3300006946 Bacteria 5829
23 Ga0099826_10000001 3300006948 Bacteria 1155201
24 Ga0105251_10024997 3300009011 Bacteria 3060
25 Ga0105244_10014224 3300009036 Bacteria 4612
26 Ga0105244_10038629 3300009036 Bacteria 2489
27 Ga0105250_10001097 3300009092 Bacteria 15279
28 Ga0105243_10040580 3300009148 Bacteria 3635
29 Ga0105241_10019750 3300009174 Bacteria 4972
30 Ga0105242_10024415 3300009176 Bacteria 4774
31 Ga0105239_10099735 3300010375 Bacteria 3211
32 Ga0157372_10096969 3300013307 Bacteria 3361
33 Ga0182006_1000092 3300015261 Bacteria 106896
34 Ga0182006_1000155 3300015261 Bacteria 73019
35 Ga0182007_10000275 3300015262 Bacteria 34048
36 Ga0182005_1000041 3300015265 Bacteria 150123
37 Ga0182005_1000084 3300015265 Bacteria 71765
38 Ga0163161_10015243 3300017792 Bacteria 5356
39 Ga0209147_100897 3300025229 Bacteria 13596
40 Ga0209563_100003 3300025230 Bacteria 1932942
41 Ga0207425_1000014 3300025245 Bacteria 481113
42 Ga0209677_103078 3300025253 Bacteria 5695
43 Ga0209148_1000806 3300025254 Bacteria 22835
44 Ga0209129_1000017 3300025258 Bacteria 480935
45 Ga0209565_1000015 3300025263 Bacteria 494091
46 Ga0209565_1004518 3300025263 Bacteria 4208
47 Ga0209565_1008622 3300025263 Bacteria 2645
48 Ga0209673_1000394 3300025273 Bacteria 78048
49 Ga0209130_1000296 3300025284 Bacteria 60641
50 Ga0209130_1000808 3300025284 Bacteria 26511
51 Ga0209130_1001673 3300025284 Bacteria 13517
52 Ga0209675_1000012 3300025291 Bacteria 494061
53 Ga0209675_1018399 3300025291 Bacteria 1956
54 Ga0209025_1000539 3300025294 Bacteria 71638
55 Ga0209025_1000547 3300025294 Bacteria 70326
56 Ga0209025_1000587 3300025294 Bacteria 65826
57 Ga0209025_1003160 3300025294 Bacteria 16055
58 Ga0209025_1014056 3300025294 Bacteria 4968
59 Ga0209025_1016354 3300025294 Bacteria 4387
60 Ga0209025_1030743 3300025294 Bacteria 2561
61 Ga0209564_1000016 3300025295 Bacteria 613131
62 Ga0209758_1000038 3300025297 Bacteria 433771
63 Ga0209758_1000483 3300025297 Bacteria 65467
64 Ga0209256_1000005 3300025299 Bacteria 1315082
65 Ga0209256_1000076 3300025299 Bacteria 234735
66 Ga0209256_1000298 3300025299 Bacteria 86943
67 Ga0207696_1000701 3300025711 Bacteria 22922
68 Ga0207713_1009932 3300025735 Bacteria 5320
69 Ga0207705_10004156 3300025909 Bacteria 10981
70 Ga0207657_10006827 3300025919 Bacteria 11777
71 Ga0207690_10004410 3300025932 Bacteria 8307
72 Ga0207686_10062816 3300025934 Bacteria 2360
73 Ga0207709_10046463 3300025935 Bacteria 2635
74 Ga0207679_10101260 3300025945 Bacteria 2253
75 Ga0209281_1005530 3300027111 Bacteria 3493
76 Ga0209282_1000001 3300027666 Bacteria 2450367
77 Ga0237817_10022 3300030083 Bacteria 62837
78 Ga0316177_1058998 3300030731 Bacteria 3028
79 Ga0307408_100001107 3300031548 Bacteria 20569
80 Ga0307408_100213891 3300031548 Bacteria 1568
81 Ga0307518_10151747 3300031838 Bacteria 1602
82 Ga0307414_10005411 3300032004 Bacteria 7030
83 Ga0395899_0000128 3300037312 Bacteria 119014
84 Ga0395899_0034080 3300037312 Bacteria 3822
85 Ga0395900_0000123 3300037418 Bacteria 133326
86 Ga0395900_0003633 3300037418 Bacteria 16582
87 Ga0395900_0020278 3300037418 Bacteria 6784
88 Ga0395900_0120629 3300037418 Bacteria 2690
89 Ga0395900_0133655 3300037418 Bacteria 2541
90 Ga0395898_0046735 3300037466 Bacteria 4251
91 Ga0395905_0197814 3300037471 Bacteria 1884
92 Ga0395901_0000411 3300038443 Bacteria 50643
93 Ga0395901_0000940 3300038443 Bacteria 31690
94 Ga0395901_0137842 3300038443 Bacteria 2564
95 Ga0395901_0238849 3300038443 Bacteria 1895
96 Ga0237819_00050 3300038705 Bacteria 40889
97 Ga0237819_00225 3300038705 Bacteria 20549
98 Ga0439448_0003195 3300042005 Bacteria 4523
99 Ga0439450_006482 3300042008 Bacteria 2110
100 Ga0450904_000108 3300042139 Bacteria 18343
101 Ga0439458_0013400 3300042157 Bacteria 1844
102 Ga0466972_0007848 3300044658 Bacteria 5353
103 Ga0466965_0001913 3300044683 Bacteria 8691
104 Ga0466965_0004323 3300044683 Bacteria 6311
105 Ga0466965_0005700 3300044683 Bacteria 5616
106 Ga0466966_0010763 3300044684 Bacteria 6080
107 Ga0466966_0025590 3300044684 Bacteria 3854
108 Ga0466963_0049246 3300044694 Bacteria 2786
109 Ga0466964_0000019 3300044706 Bacteria 35345
110 Ga0466964_0000400 3300044706 Bacteria 13189
111 Ga0466968_0000184 3300044735 Bacteria 19138
112 Ga0466970_0066918 3300044765 Bacteria 1929
113 Ga0466957_0000079 3300044842 Bacteria 38733
114 Ga0466959_0024372 3300045049 Bacteria 4482
115 Ga0466959_0060474 3300045049 Bacteria 2756
116 Ga0466958_0034946 3300045836 Bacteria 3001
117 Ga0466967_0000025 3300045976 Bacteria 65709
118 Ga0466967_0005518 3300045976 Bacteria 8780
119 Ga0495617_000004 3300046452 Bacteria 511274
120 Ga0495617_000034 3300046452 Bacteria 147232
121 Ga0495617_000457 3300046452 Bacteria 22007
122 Ga0495617_006196 3300046452 Bacteria 4208
123 Ga0495627_000088 3300046453 Bacteria 110479
124 Ga0495627_000740 3300046453 Bacteria 24578
125 Ga0495627_003418 3300046453 Bacteria 7025
126 Ga0495603_0015985 3300046455 Bacteria 4537
127 Ga0495590_0000027 3300046457 Bacteria 158323
128 Ga0495590_0000163 3300046457 Bacteria 39787
129 Ga0495590_0000301 3300046457 Bacteria 26015
130 Ga0495590_0001262 3300046457 Bacteria 11033
131 Ga0495591_003556 3300046458 Bacteria 7963
132 Ga0495629_0001777 3300046459 Bacteria 16914
133 Ga0495638_0000098 3300046460 Bacteria 140656
134 Ga0495638_0001739 3300046460 Bacteria 19125
135 Ga0495638_0011682 3300046460 Bacteria 6048
136 Ga0495638_0018023 3300046460 Bacteria 4698
137 Ga0495638_0027365 3300046460 Bacteria 3691
138 Ga0495653_0000004 3300046463 Bacteria 376003
139 Ga0495653_0007472 3300046463 Bacteria 8938
140 Ga0495650_0000011 3300046471 Bacteria 615329
141 Ga0495650_0000042 3300046471 Bacteria 357244
142 Ga0495650_0000445 3300046471 Bacteria 66180
143 Ga0495650_0000715 3300046471 Bacteria 42328
144 Ga0495650_0000833 3300046471 Bacteria 37204
145 Ga0495650_0007022 3300046471 Bacteria 6867
146 Ga0495650_0008623 3300046471 Bacteria 5913
147 Ga0495582_0003967 3300046473 Bacteria 8316
148 Ga0495582_0014130 3300046473 Bacteria 4394
149 Ga0495605_0000029 3300046474 Bacteria 215329
150 Ga0495605_0000392 3300046474 Bacteria 40339
151 Ga0495605_0010077 3300046474 Bacteria 5294
152 Ga0495605_0011000 3300046474 Bacteria 5054
153 Ga0495605_0014530 3300046474 Bacteria 4307
154 Ga0495605_0031388 3300046474 Bacteria 2714
155 Ga0495605_0036090 3300046474 Bacteria 2494
156 Ga0495639_0012572 3300046475 Bacteria 3652
157 Ga0495584_0000007 3300046491 Bacteria 294820
158 Ga0495584_0000151 3300046491 Bacteria 48129
159 Ga0495584_0001542 3300046491 Bacteria 13685
160 Ga0495584_0002207 3300046491 Bacteria 11107
161 Ga0495584_0003051 3300046491 Bacteria 9299
162 Ga0495584_0010072 3300046491 Bacteria 4854
163 Ga0495584_0012147 3300046491 Bacteria 4400
164 Ga0495584_0020494 3300046491 Bacteria 3358
165 Ga0495584_0031022 3300046491 Bacteria 2705
166 Ga0495584_0035938 3300046491 Bacteria 2503
167 Ga0495584_0068226 3300046491 Bacteria 1786
168 Ga0495585_0000115 3300046492 Bacteria 86460
169 Ga0495585_0000421 3300046492 Bacteria 40862
170 Ga0495585_0000495 3300046492 Bacteria 37233
171 Ga0495585_0000580 3300046492 Bacteria 34411
172 Ga0495585_0000685 3300046492 Bacteria 30770
173 Ga0495585_0000915 3300046492 Bacteria 24970
174 Ga0495585_0008135 3300046492 Bacteria 6371
175 Ga0495585_0026151 3300046492 Bacteria 3334
176 Ga0495585_0033739 3300046492 Bacteria 2895
177 Ga0495585_0040277 3300046492 Bacteria 2623
178 Ga0495594_0004373 3300046499 Bacteria 7268
179 Ga0495594_0008124 3300046499 Bacteria 5398
180 Ga0495594_0009283 3300046499 Bacteria 5079
181 Ga0495596_0000499 3300046500 Bacteria 24894
182 Ga0495596_0001155 3300046500 Bacteria 15515
183 Ga0495596_0001373 3300046500 Bacteria 13972
184 Ga0495596_0001657 3300046500 Bacteria 12648
185 Ga0495596_0005842 3300046500 Bacteria 5756
186 Ga0495596_0011528 3300046500 Bacteria 3808
187 Ga0495596_0013842 3300046500 Bacteria 3410
188 Ga0495607_0000522 3300046501 Bacteria 37808
189 Ga0495607_0001320 3300046501 Bacteria 22109
190 Ga0495607_0001327 3300046501 Bacteria 22078
191 Ga0495607_0002040 3300046501 Bacteria 16916
192 Ga0495607_0002280 3300046501 Bacteria 15782
193 Ga0495607_0003499 3300046501 Bacteria 12009
194 Ga0495607_0003791 3300046501 Bacteria 11421
195 Ga0495607_0004237 3300046501 Bacteria 10635
196 Ga0495607_0008115 3300046501 Bacteria 7208
197 Ga0495607_0008656 3300046501 Bacteria 6938
198 Ga0495607_0035150 3300046501 Bacteria 3034
199 Ga0495607_0047291 3300046501 Bacteria 2521
200 Ga0495583_0000337 3300046506 Bacteria 73928
201 Ga0495583_0000348 3300046506 Bacteria 73050
202 Ga0495583_0000440 3300046506 Bacteria 62422
203 Ga0495583_0000472 3300046506 Bacteria 58906
204 Ga0495583_0001215 3300046506 Bacteria 27435
205 Ga0495583_0002737 3300046506 Bacteria 14594
206 Ga0495583_0004101 3300046506 Bacteria 10683
207 Ga0495583_0005530 3300046506 Bacteria 8555
208 Ga0495583_0007684 3300046506 Bacteria 6720
209 Ga0495583_0023043 3300046506 Bacteria 3159
210 Ga0495606_0000084 3300046507 Bacteria 158428
211 Ga0495606_0000175 3300046507 Bacteria 113577
212 Ga0495606_0000680 3300046507 Bacteria 53232
213 Ga0495606_0000787 3300046507 Bacteria 48504
214 Ga0495606_0001426 3300046507 Bacteria 32102
215 Ga0495606_0002963 3300046507 Bacteria 18689
216 Ga0495606_0012596 3300046507 Bacteria 6763
217 Ga0495606_0017984 3300046507 Bacteria 5318
218 Ga0495606_0031190 3300046507 Bacteria 3710
219 Ga0495610_0000010 3300046512 Bacteria 538821
220 Ga0495610_0000473 3300046512 Bacteria 41477
221 Ga0495610_0002891 3300046512 Bacteria 13895
222 Ga0495610_0006668 3300046512 Bacteria 7870
223 Ga0495610_0018327 3300046512 Bacteria 3959
224 Ga0495616_0000073 3300046513 Bacteria 85397
225 Ga0495616_0000666 3300046513 Bacteria 25531
226 Ga0495616_0001438 3300046513 Bacteria 16569
227 Ga0495616_0001674 3300046513 Bacteria 15132
228 Ga0495616_0001793 3300046513 Bacteria 14604
229 Ga0495616_0002753 3300046513 Bacteria 11502
230 Ga0495616_0013390 3300046513 Bacteria 4626
231 Ga0495616_0019954 3300046513 Bacteria 3652
232 Ga0495616_0028852 3300046513 Bacteria 2934
233 Ga0495630_0096324 3300046517 Bacteria 2237
234 Ga0495631_0000008 3300046518 Bacteria 121368
235 Ga0495631_0001559 3300046518 Bacteria 13800
236 Ga0495631_0004321 3300046518 Bacteria 7578
237 Ga0495631_0008692 3300046518 Bacteria 5109
238 Ga0495631_0009611 3300046518 Bacteria 4824
239 Ga0495631_0009614 3300046518 Bacteria 4822
240 Ga0495631_0011505 3300046518 Bacteria 4350
241 Ga0495631_0014932 3300046518 Bacteria 3736
242 Ga0495631_0026353 3300046518 Bacteria 2671
243 Ga0495632_0000027 3300046519 Bacteria 173785
244 Ga0495632_0000193 3300046519 Bacteria 61596
245 Ga0495632_0000472 3300046519 Bacteria 38169
246 Ga0495632_0007966 3300046519 Bacteria 6580
247 Ga0495632_0028408 3300046519 Bacteria 2919
248 Ga0495637_0000013 3300046520 Bacteria 244837
249 Ga0495637_0000114 3300046520 Bacteria 58485
250 Ga0495637_0015023 3300046520 Bacteria 3641
251 Ga0495643_0000200 3300046522 Bacteria 93353
252 Ga0495643_0000551 3300046522 Bacteria 46367
253 Ga0495643_0000633 3300046522 Bacteria 41677
254 Ga0495643_0000981 3300046522 Bacteria 29267
255 Ga0495643_0005890 3300046522 Bacteria 8195
256 Ga0495643_0008292 3300046522 Bacteria 6592
257 Ga0495643_0009562 3300046522 Bacteria 6017
258 Ga0495643_0074781 3300046522 Bacteria 1773
259 Ga0495644_0000222 3300046523 Bacteria 26820
260 Ga0495644_0002665 3300046523 Bacteria 7095
261 Ga0495644_0003003 3300046523 Bacteria 6686
262 Ga0495644_0003501 3300046523 Bacteria 6208
263 Ga0495644_0003858 3300046523 Bacteria 5904
264 Ga0495644_0004533 3300046523 Bacteria 5458
265 Ga0495648_0000112 3300046524 Bacteria 99859
266 Ga0495648_0000169 3300046524 Bacteria 75523
267 Ga0495648_0000995 3300046524 Bacteria 29146
268 Ga0495648_0001706 3300046524 Bacteria 21250
269 Ga0495648_0005245 3300046524 Bacteria 10829
270 Ga0495648_0005293 3300046524 Bacteria 10769
271 Ga0495648_0005820 3300046524 Bacteria 10153
272 Ga0495648_0014594 3300046524 Bacteria 5742
273 Ga0495648_0017756 3300046524 Bacteria 5073
274 Ga0495663_0001314 3300046525 Bacteria 7866
275 Ga0495642_0000050 3300046528 Bacteria 71246
276 Ga0495642_0000772 3300046528 Bacteria 15622
277 Ga0495642_0001786 3300046528 Bacteria 9266
278 Ga0495642_0002213 3300046528 Bacteria 7962
279 Ga0495642_0004394 3300046528 Bacteria 5473
280 Ga0495642_0028073 3300046528 Bacteria 2240
281 Ga0495642_0036311 3300046528 Bacteria 1991
282 Ga0495652_0009303 3300046529 Bacteria 8932
283 Ga0495652_0078656 3300046529 Bacteria 2729
284 Ga0495654_0000002 3300046530 Bacteria 1021205
285 Ga0495654_0012631 3300046530 Bacteria 4534
286 Ga0495654_0013411 3300046530 Bacteria 4387
287 Ga0495654_0025388 3300046530 Bacteria 3052
288 Ga0495654_0063486 3300046530 Bacteria 1768
289 Ga0495665_0002786 3300046531 Bacteria 9432
290 Ga0495586_0000429 3300046535 Bacteria 25339
291 Ga0495609_0000022 3300046538 Bacteria 279488
292 Ga0495609_0000163 3300046538 Bacteria 69578
293 Ga0495609_0000386 3300046538 Bacteria 37359
294 Ga0495609_0001842 3300046538 Bacteria 13577
295 Ga0495609_0002102 3300046538 Bacteria 12516
296 Ga0495609_0002409 3300046538 Bacteria 11502
297 Ga0495609_0009839 3300046538 Bacteria 4610
298 Ga0495609_0013538 3300046538 Bacteria 3849
299 Ga0495609_0020661 3300046538 Bacteria 3040
300 Ga0495597_0000064 3300046542 Bacteria 91446
301 Ga0495597_0000169 3300046542 Bacteria 57724
302 Ga0495597_0000266 3300046542 Bacteria 47830
303 Ga0495597_0006699 3300046542 Bacteria 5929
304 Ga0495597_0010097 3300046542 Bacteria 4630
305 Ga0495597_0016445 3300046542 Bacteria 3491
306 Ga0495597_0053802 3300046542 Bacteria 1769
307 Ga0495645_0048358 3300046543 Bacteria 3098
308 Ga0495622_0000263 3300046557 Bacteria 40099
309 Ga0495622_0052092 3300046557 Bacteria 1898
310 Ga0495633_0000311 3300046558 Bacteria 55445
311 Ga0495633_0000614 3300046558 Bacteria 33797
312 Ga0495633_0001021 3300046558 Bacteria 22931
313 Ga0495633_0005384 3300046558 Bacteria 7842
314 Ga0495633_0009353 3300046558 Bacteria 5420
315 Ga0495633_0013688 3300046558 Bacteria 4265
316 Ga0495633_0014934 3300046558 Bacteria 4038
317 Ga0495656_0007771 3300046615 Bacteria 3805
318 Ga0495656_0008737 3300046615 Bacteria 3627
319 Ga0495656_0039474 3300046615 Bacteria 1961
320 Ga0495656_0047013 3300046615 Bacteria 1828
321 Ga0495668_0000120 3300046616 Bacteria 117076
322 Ga0495668_0000288 3300046616 Bacteria 69253
323 Ga0495668_0000597 3300046616 Bacteria 43942
324 Ga0495668_0000744 3300046616 Bacteria 38882
325 Ga0495668_0000853 3300046616 Bacteria 34412
326 Ga0495668_0001420 3300046616 Bacteria 23275
327 Ga0495668_0001549 3300046616 Bacteria 21796
328 Ga0495668_0004121 3300046616 Bacteria 10524
329 Ga0495668_0009917 3300046616 Bacteria 5807
330 Ga0495668_0011207 3300046616 Bacteria 5381
331 Ga0495668_0019232 3300046616 Bacteria 3940
332 Ga0495668_0044839 3300046616 Bacteria 2457
333 Ga0495668_0047820 3300046616 Bacteria 2374
334 Ga0495634_0009438 3300046642 Bacteria 7196
335 Ga0495611_0000820 3300046648 Bacteria 17190
336 Ga0495611_0004060 3300046648 Bacteria 6368
337 Ga0495611_0011448 3300046648 Bacteria 3760
338 Ga0495611_0014839 3300046648 Bacteria 3330
339 Ga0495611_0018103 3300046648 Bacteria 3019
340 Ga0495625_0000810 3300046660 Bacteria 43340
341 Ga0495625_0003030 3300046660 Bacteria 17236
342 Ga0495625_0003516 3300046660 Bacteria 15523
343 Ga0495625_0004451 3300046660 Bacteria 13245
344 Ga0495625_0024662 3300046660 Bacteria 4572
345 Ga0495625_0025233 3300046660 Bacteria 4510
346 Ga0495625_0032331 3300046660 Bacteria 3881
347 Ga0495625_0109984 3300046660 Bacteria 1884
348 Ga0495635_0002356 3300046663 Bacteria 12857
349 Ga0495659_0000019 3300046664 Bacteria 74610
350 Ga0495659_0001234 3300046664 Bacteria 8845
351 Ga0495659_0002554 3300046664 Bacteria 5871
352 Ga0495661_0000151 3300046665 Bacteria 81275
353 Ga0495661_0000590 3300046665 Bacteria 37515
354 Ga0495661_0000864 3300046665 Bacteria 28244
355 Ga0495661_0001969 3300046665 Bacteria 16274
356 Ga0495661_0002907 3300046665 Bacteria 12960
357 Ga0495661_0008506 3300046665 Bacteria 7095
358 Ga0495661_0009600 3300046665 Bacteria 6630
359 Ga0495661_0012638 3300046665 Bacteria 5697
360 Ga0495661_0013343 3300046665 Bacteria 5522
361 Ga0495588_0000086 3300046674 Bacteria 193241
362 Ga0495588_0009477 3300046674 Bacteria 4500
363 Ga0495588_0015153 3300046674 Bacteria 3703
364 Ga0495588_0022173 3300046674 Bacteria 3137
365 Ga0495623_0001807 3300046679 Bacteria 14366
366 Ga0495623_0005944 3300046679 Bacteria 7954
367 Ga0495669_0001176 3300046684 Bacteria 10872
368 Ga0495669_0001587 3300046684 Bacteria 9343
369 Ga0495669_0004491 3300046684 Bacteria 5764
370 Ga0495669_0010304 3300046684 Bacteria 3950
371 Ga0495670_0000110 3300046691 Bacteria 36444
372 Ga0495670_0001243 3300046691 Bacteria 12443
373 Ga0495670_0013061 3300046691 Bacteria 4083
374 Ga0495670_0016793 3300046691 Bacteria 3599
375 Ga0495670_0021338 3300046691 Bacteria 3194
376 Ga0495671_0000002 3300046692 Bacteria 1136189
377 Ga0495671_0000562 3300046692 Bacteria 27863
378 Ga0495671_0002087 3300046692 Bacteria 12799
379 Ga0495671_0041162 3300046692 Bacteria 2327
380 Ga0495671_0061767 3300046692 Bacteria 1847
381 Ga0495671_0072975 3300046692 Bacteria 1684
382 Ga0495649_0003353 3300046694 Bacteria 10868
383 Ga0495649_0005117 3300046694 Bacteria 8416
384 Ga0495649_0010907 3300046694 Bacteria 5352
385 Ga0495649_0014124 3300046694 Bacteria 4585
386 Ga0495649_0028861 3300046694 Bacteria 3075
387 Ga0495649_0040026 3300046694 Bacteria 2568
388 Ga0495589_0000017 3300046794 Bacteria 206113
389 Ga0495589_0000926 3300046794 Bacteria 18002
390 Ga0495589_0005282 3300046794 Bacteria 6827
391 Ga0495589_0006281 3300046794 Bacteria 6275
392 Ga0495589_0009939 3300046794 Bacteria 4943
393 Ga0495589_0011177 3300046794 Bacteria 4657
394 Ga0495589_0019499 3300046794 Bacteria 3475
395 Ga0495589_0056263 3300046794 Bacteria 1936
396 Ga0495600_0001386 3300046809 Bacteria 13380
397 Ga0495600_0008701 3300046809 Bacteria 6244
398 Ga0495660_0000067 3300046810 Bacteria 119390
399 Ga0495660_0000448 3300046810 Bacteria 34404
400 Ga0495660_0000493 3300046810 Bacteria 32595
401 Ga0495660_0000846 3300046810 Bacteria 22599
402 Ga0495660_0001926 3300046810 Bacteria 13537
403 Ga0495660_0003472 3300046810 Bacteria 9735
404 Ga0495660_0005381 3300046810 Bacteria 7667
405 Ga0495660_0011175 3300046810 Bacteria 5212
406 Ga0495660_0012134 3300046810 Bacteria 4999
407 Ga0495660_0029913 3300046810 Bacteria 3070
408 Ga0495581_0006141 3300047315 Bacteria 6965
409 Ga0495581_0056973 3300047315 Bacteria 2255
410 Ga0495604_0012497 3300047317 Bacteria 6753
411 Ga0495604_0042836 3300047317 Bacteria 3546
412 Ga0495604_0148984 3300047317 Bacteria 1664
413 Ga0495636_0048806 3300047318 Bacteria 1769
414 Ga0495672_0000138 3300047320 Bacteria 108026
415 Ga0495672_0000162 3300047320 Bacteria 96750
416 Ga0495672_0000171 3300047320 Bacteria 94653
417 Ga0495672_0000343 3300047320 Bacteria 59629
418 Ga0495672_0002293 3300047320 Bacteria 17745
419 Ga0495672_0003715 3300047320 Bacteria 12868
420 Ga0495672_0007596 3300047320 Bacteria 8134
421 Ga0495672_0013121 3300047320 Bacteria 5731
422 Ga0495676_0000067 3300047321 Bacteria 80084
423 Ga0495676_0019258 3300047321 Bacteria 6005
424 Ga0495676_0085206 3300047321 Bacteria 2381
425 Ga0495680_0002331 3300047322 Bacteria 19469
426 Ga0495683_0000335 3300047323 Bacteria 39334
427 Ga0495683_0003680 3300047323 Bacteria 8883
428 Ga0495683_0004473 3300047323 Bacteria 7928
429 Ga0495683_0004821 3300047323 Bacteria 7569
430 Ga0495683_0005284 3300047323 Bacteria 7176
431 Ga0495683_0020616 3300047323 Bacteria 3399
432 Ga0495683_0023285 3300047323 Bacteria 3183
433 Ga0495683_0033258 3300047323 Bacteria 2625
434 Ga0495687_000033 3300047443 Bacteria 263788
435 Ga0495687_000126 3300047443 Bacteria 117879
436 Ga0495687_000670 3300047443 Bacteria 38991
437 Ga0495687_000818 3300047443 Bacteria 33347
438 Ga0495687_000842 3300047443 Bacteria 32674
439 Ga0495687_000992 3300047443 Bacteria 28475
440 Ga0495687_002248 3300047443 Bacteria 15898
441 Ga0495687_021145 3300047443 Bacteria 3156
442 Ga0495675_0002496 3300047444 Bacteria 11005
443 Ga0495677_0000002 3300047445 Bacteria 346767
444 Ga0495677_0000199 3300047445 Bacteria 27733
445 Ga0495677_0001847 3300047445 Bacteria 8464
446 Ga0495677_0006666 3300047445 Bacteria 4350
447 Ga0495677_0007834 3300047445 Bacteria 3978
448 Ga0495677_0012854 3300047445 Bacteria 3049
449 Ga0495677_0021322 3300047445 Bacteria 2348
450 Ga0495677_0056867 3300047445 Bacteria 1445
451 Ga0495679_005465 3300047446 Bacteria 5629
452 Ga0495679_006599 3300047446 Bacteria 4966
453 Ga0495679_012733 3300047446 Bacteria 3186
454 Ga0495679_017901 3300047446 Bacteria 2526
455 Ga0495685_000079 3300047447 Bacteria 36504
456 Ga0495673_0000028 3300047469 Bacteria 473418
457 Ga0495673_0000207 3300047469 Bacteria 89423
458 Ga0495673_0000265 3300047469 Bacteria 72840
459 Ga0495673_0002722 3300047469 Bacteria 12140
460 Ga0495681_0000321 3300047470 Bacteria 38154
461 Ga0495681_0001352 3300047470 Bacteria 18532
462 Ga0495681_0001898 3300047470 Bacteria 15347
463 Ga0495681_0002480 3300047470 Bacteria 13166
464 Ga0495681_0006775 3300047470 Bacteria 7453
465 Ga0495681_0008373 3300047470 Bacteria 6492
466 Ga0495681_0018497 3300047470 Bacteria 3837
467 Ga0495681_0019842 3300047470 Bacteria 3658
468 Ga0495681_0021526 3300047470 Bacteria 3472
469 Ga0495686_0000228 3300047472 Bacteria 103664
470 Ga0495686_0000272 3300047472 Bacteria 92063
471 Ga0495686_0005802 3300047472 Bacteria 9628
472 Ga0495686_0013077 3300047472 Bacteria 5778
473 Ga0495686_0039804 3300047472 Bacteria 3000
474 Ga0495686_0051493 3300047472 Bacteria 2583
475 Ga0495593_0000337 3300047673 Bacteria 26031
476 Ga0495593_0005583 3300047673 Bacteria 7427
477 Ga0495593_0007412 3300047673 Bacteria 6425
478 Ga0495602_0003696 3300048088 Bacteria 15872
479 Ga0495614_0009645 3300048089 Bacteria 4266
480 Ga0495615_0000473 3300048090 Bacteria 5822
481 Ga0495626_0000097 3300048091 Bacteria 113925
482 Ga0495626_0000209 3300048091 Bacteria 70145
483 Ga0495626_0000258 3300048091 Bacteria 60668
484 Ga0495626_0001445 3300048091 Bacteria 18865
485 Ga0495626_0004099 3300048091 Bacteria 9055
486 Ga0495626_0006694 3300048091 Bacteria 6528
487 Ga0495626_0010575 3300048091 Bacteria 4912
488 Ga0495626_0010613 3300048091 Bacteria 4902
489 Ga0495626_0017884 3300048091 Bacteria 3573
490 Ga0495626_0021756 3300048091 Bacteria 3176
491 Ga0495626_0035779 3300048091 Bacteria 2369
492 Ga0496100_0015868 3300048903 Bacteria 4409
493 Ga0496101_0113774 3300048904 Bacteria 2039
494 Ga0496102_0000341 3300048905 Bacteria 57211
495 Ga0496102_0000487 3300048905 Bacteria 43875
496 Ga0496103_0001999 3300048906 Bacteria 13139
497 Ga0496103_0085525 3300048906 Bacteria 1987
498 Ga0496105_0218979 3300048908 Bacteria 1550
499 Ga0496106_0009708 3300048909 Bacteria 7107
500 Ga0496107_0169458 3300048910 Bacteria 1620
501 Ga0496110_0000024 3300048913 Bacteria 74685
502 Ga0496110_0000399 3300048913 Bacteria 29393
503 Ga0496110_0153453 3300048913 Bacteria 2086
504 Ga0496115_0109496 3300048918 Bacteria 2268
505 Ga0496116_0019713 3300048919 Bacteria 5155
506 Ga0496116_0021587 3300048919 Bacteria 4850
507 Ga0496117_0000032 3300048920 Bacteria 375533
508 Ga0496118_0000027 3300048921 Bacteria 375533
509 Ga0496122_0000439 3300048925 Bacteria 87380
510 Ga0496122_0001272 3300048925 Bacteria 42099
511 Ga0496122_0003278 3300048925 Bacteria 21457
512 Ga0496122_0006946 3300048925 Bacteria 12763
513 Ga0496123_0000487 3300048926 Bacteria 69019
514 Ga0496123_0002487 3300048926 Bacteria 22747
515 Ga0496123_0003399 3300048926 Bacteria 17913
516 Ga0496123_0015809 3300048926 Bacteria 6165
517 Ga0496123_0046287 3300048926 Bacteria 2952
518 Ga0496124_0007367 3300048927 Bacteria 11715
519 Ga0496124_0023507 3300048927 Bacteria 5625
520 Ga0496124_0050951 3300048927 Bacteria 3524
521 Ga0496125_0002348 3300048928 Bacteria 24833
522 Ga0496125_0047384 3300048928 Bacteria 3595
523 Ga0496125_0091408 3300048928 Bacteria 2280
524 Ga0496125_0150335 3300048928 Bacteria 1601
525 Ga0501306_005137 3300049127 Bacteria 1490
526 Ga0501309_005717 3300049129 Bacteria 1493
527 Ga0501309_005829 3300049129 Bacteria 1483
528 Ga0501341_00709 3300049131 Bacteria 1491
529 Ga0501344_00671 3300049133 Bacteria 1491
530 Ga0501345_00383 3300049134 Bacteria 1451
531 Ga0501345_00620 3300049134 Bacteria 1239
532 Ga0501304_001586 3300049160 Bacteria 1483
533 Ga0501342_00214 3300049163 Bacteria 1426
534 Ga0495678_000131 3300049459 Bacteria 88620
535 Ga0495678_000197 3300049459 Bacteria 70712
536 Ga0495678_000816 3300049459 Bacteria 27884
537 Ga0495678_002146 3300049459 Bacteria 13938
538 Ga0495678_003889 3300049459 Bacteria 8962
539 Ga0495678_004718 3300049459 Bacteria 7787
540 Ga0495678_006534 3300049459 Bacteria 6192
541 Ga0495678_007692 3300049459 Bacteria 5556
542 Ga0495682_0000820 3300049460 Bacteria 19519
543 Ga0495682_0003926 3300049460 Bacteria 6491
544 Ga0495682_0004690 3300049460 Bacteria 5786
545 Ga0495682_0021276 3300049460 Bacteria 2431
546 Ga0501311_004453 3300049527 Bacteria 1491
547 Ga0501311_004713 3300049527 Bacteria 1464
548 Ga0501312_002310 3300049528 Bacteria 2044
549 Ga0501313_003543 3300049529 Bacteria 1559
550 Ga0501313_003875 3300049529 Bacteria 1512
551 Ga0501314_002277 3300049530 Bacteria 1470
552 Ga0501315_004329 3300049531 Bacteria 1480
553 Ga0501317_003769 3300049533 Bacteria 1535
554 Ga0501317_004106 3300049533 Bacteria 1496
555 Ga0501317_004256 3300049533 Bacteria 1480
556 Ga0501318_002747 3300049534 Bacteria 1557
557 Ga0501319_001133 3300049535 Bacteria 1478
558 Ga0501320_002434 3300049536 Bacteria 1489
559 Ga0501321_001678 3300049537 Bacteria 1810
560 Ga0501322_000868 3300049538 Bacteria 1559
561 Ga0501322_001062 3300049538 Bacteria 1464
562 Ga0501323_004639 3300049539 Bacteria 1464
563 Ga0501323_004855 3300049539 Bacteria 1443
564 Ga0501324_001794 3300049540 Bacteria 1483
565 Ga0501326_00584 3300049542 Bacteria 1490
566 Ga0501327_00668 3300049543 Bacteria 1460
567 Ga0501328_00312 3300049544 Bacteria 1548
568 Ga0501330_000846 3300049546 Bacteria 1457
569 Ga0501332_00369 3300049548 Bacteria 1906
570 Ga0501332_00888 3300049548 Bacteria 1448
571 Ga0501333_000427 3300049549 Bacteria 1909
572 Ga0501333_000977 3300049549 Bacteria 1462
573 Ga0501335_001417 3300049551 Bacteria 1835
574 Ga0501335_001601 3300049551 Bacteria 1754
575 Ga0501336_000731 3300049552 Bacteria 1752
576 Ga0501336_001410 3300049552 Bacteria 1423
577 Ga0501337_000825 3300049553 Bacteria 1649
578 Ga0501339_00059 3300049555 Bacteria 1467
579 Ga0501340_000786 3300049556 Bacteria 1539
580 Ga0501234_008090 3300049707 Bacteria 1643
581 Ga0501269_000022 3300049766 Bacteria 53264
582 Ga0501035_0001714 3300049822 Bacteria 22155
583 Ga0501044_0093557 3300049823 Bacteria 3031
584 Ga0466962_0103324 3300061719 Bacteria 1369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046692 Ga0495671_0061767 Ga0495671_0061767_688_1836 340
2 3300046692 Ga0495671_0072975 Ga0495671_0072975_12_1160 340
3 3300049134 Ga0501345_00620 Ga0501345_00620_56_1204 350
4 3300047673 Ga0495593_0005583 Ga0495593_0005583_1589_2977 381
5 3300046492 Ga0495585_0000580 Ga0495585_0000580_5501_6955 383
6 3300046529 Ga0495652_0078656 Ga0495652_0078656_1239_2639 385
7 3300047315 Ga0495581_0056973 Ga0495581_0056973_559_1959 385
8 3300047317 Ga0495604_0148984 Ga0495604_0148984_191_1591 385
9 3300046473 Ga0495582_0014130 Ga0495582_0014130_2075_3523 387
10 3300046499 Ga0495594_0004373 Ga0495594_0004373_4103_5551 387
11 3300046809 Ga0495600_0001386 Ga0495600_0001386_5779_7179 388
12 3300046648 Ga0495611_0011448 Ga0495611_0011448_1188_2588 389
13 3300042139 Ga0450904_000108 Ga0450904_000108_2749_4149 391
14 3300048913 Ga0496110_0153453 Ga0496110_0153453_392_1735 391
15 3300046491 Ga0495584_0000007 Ga0495584_0000007_247624_249024 392
16 3300046691 Ga0495670_0001243 Ga0495670_0001243_565_2016 394
17 3300047673 Ga0495593_0007412 Ga0495593_0007412_1838_3226 394
18 3300046501 Ga0495607_0047291 Ga0495607_0047291_1097_2497 395
19 3300046506 Ga0495583_0004101 Ga0495583_0004101_5390_6790 395
20 3300047470 Ga0495681_0001898 Ga0495681_0001898_6358_7758 395
21 3300048091 Ga0495626_0010613 Ga0495626_0010613_329_1783 395
22 3300048908 Ga0496105_0218979 Ga0496105_0218979_192_1529 395
23 3300049460 Ga0495682_0021276 Ga0495682_0021276_781_2181 395
24 3300046522 Ga0495643_0000200 Ga0495643_0000200_51390_52790 396
25 3300046542 Ga0495597_0006699 Ga0495597_0006699_2693_4093 396
26 3300046558 Ga0495633_0013688 Ga0495633_0013688_2060_3460 396
27 3300046615 Ga0495656_0008737 Ga0495656_0008737_2099_3499 396
28 3300046794 Ga0495589_0006281 Ga0495589_0006281_3825_5225 396
29 3300047445 Ga0495677_0006666 Ga0495677_0006666_1571_2971 396
30 3300047323 Ga0495683_0023285 Ga0495683_0023285_33_1433 397
31 3300049539 Ga0501323_004855 Ga0501323_004855_60_1379 397
32 3300046459 Ga0495629_0001777 Ga0495629_0001777_14064_15458 399
33 3300046492 Ga0495585_0000421 Ga0495585_0000421_9360_10760 401
34 3300046691 Ga0495670_0021338 Ga0495670_0021338_270_1670 401
35 3300046474 Ga0495605_0036090 Ga0495605_0036090_460_1860 402
36 3300046491 Ga0495584_0012147 Ga0495584_0012147_879_2327 402
37 3300046492 Ga0495585_0040277 Ga0495585_0040277_65_1513 402
38 3300046500 Ga0495596_0005842 Ga0495596_0005842_1206_2606 402
39 3300046507 Ga0495606_0031190 Ga0495606_0031190_2286_3686 402
40 3300046518 Ga0495631_0009611 Ga0495631_0009611_388_1788 402
41 3300046518 Ga0495631_0014932 Ga0495631_0014932_518_1966 402
42 3300046519 Ga0495632_0028408 Ga0495632_0028408_1381_2781 402
43 3300046522 Ga0495643_0009562 Ga0495643_0009562_136_1536 402
44 3300046528 Ga0495642_0004394 Ga0495642_0004394_1139_2539 402
45 3300046616 Ga0495668_0047820 Ga0495668_0047820_881_2281 402
46 3300046660 Ga0495625_0109984 Ga0495625_0109984_270_1670 402
47 3300047321 Ga0495676_0085206 Ga0495676_0085206_609_2009 402
48 3300047445 Ga0495677_0021322 Ga0495677_0021322_773_2221 402
49 3300047445 Ga0495677_0056867 Ga0495677_0056867_20_1420 402
50 3300046491 Ga0495584_0003051 Ga0495584_0003051_2492_4027 403
51 3300046492 Ga0495585_0033739 Ga0495585_0033739_370_1905 403
52 3300046500 Ga0495596_0011528 Ga0495596_0011528_74_1609 403
53 3300046501 Ga0495607_0004237 Ga0495607_0004237_7113_8648 403
54 3300046506 Ga0495583_0001215 Ga0495583_0001215_3123_4658 403
55 3300046518 Ga0495631_0004321 Ga0495631_0004321_3664_5199 403
56 3300046523 Ga0495644_0002665 Ga0495644_0002665_2508_4043 403
57 3300046616 Ga0495668_0044839 Ga0495668_0044839_355_1890 403
58 3300046665 Ga0495661_0008506 Ga0495661_0008506_3053_4588 403
59 3300046794 Ga0495589_0011177 Ga0495589_0011177_816_2351 403
60 3300047470 Ga0495681_0008373 Ga0495681_0008373_759_2294 403
61 3300048091 Ga0495626_0006694 Ga0495626_0006694_3975_5375 403
62 3300048091 Ga0495626_0017884 Ga0495626_0017884_21_1454 403
63 3300049459 Ga0495678_003889 Ga0495678_003889_1503_3038 403
64 3300046460 Ga0495638_0001739 Ga0495638_0001739_1739_3139 404
65 3300046558 Ga0495633_0014934 Ga0495633_0014934_567_2009 404
66 3300046810 Ga0495660_0005381 Ga0495660_0005381_5048_6448 405
67 3300047320 Ga0495672_0000171 Ga0495672_0000171_73562_74962 405
68 3300025297 Ga0209758_1000483 Ga0209758_100048330 406
69 3300046491 Ga0495584_0020494 Ga0495584_0020494_1030_2457 406
70 3300046492 Ga0495585_0000685 Ga0495585_0000685_22280_23707 406
71 3300046518 Ga0495631_0026353 Ga0495631_0026353_639_2066 406
72 3300046665 Ga0495661_0001969 Ga0495661_0001969_12666_14093 406
73 3300046691 Ga0495670_0000110 Ga0495670_0000110_22291_23718 406
74 3300047323 Ga0495683_0033258 Ga0495683_0033258_532_1959 406
75 3300047470 Ga0495681_0001352 Ga0495681_0001352_2167_3594 406
76 3300046452 Ga0495617_000457 Ga0495617_000457_8765_10165 407
77 3300046492 Ga0495585_0000115 Ga0495585_0000115_25225_26625 407
78 3300046513 Ga0495616_0000666 Ga0495616_0000666_16347_17747 407
79 3300046524 Ga0495648_0000112 Ga0495648_0000112_44180_45580 407
80 3300047323 Ga0495683_0004473 Ga0495683_0004473_962_2362 407
81 3300049129 Ga0501309_005717 Ga0501309_005717_73_1455 407
82 3300049527 Ga0501311_004713 Ga0501311_004713_49_1431 407
83 3300049528 Ga0501312_002310 Ga0501312_002310_629_2011 407
84 3300049529 Ga0501313_003543 Ga0501313_003543_139_1521 407
85 3300049530 Ga0501314_002277 Ga0501314_002277_53_1435 407
86 3300049533 Ga0501317_004106 Ga0501317_004106_75_1457 407
87 3300049534 Ga0501318_002747 Ga0501318_002747_150_1532 407
88 3300049539 Ga0501323_004639 Ga0501323_004639_49_1431 407
89 3300049543 Ga0501327_00668 Ga0501327_00668_44_1426 407
90 3300046455 Ga0495603_0015985 Ga0495603_0015985_2040_3488 408
91 3300046492 Ga0495585_0008135 Ga0495585_0008135_4243_5643 408
92 3300046499 Ga0495594_0009283 Ga0495594_0009283_117_1517 408
93 3300049538 Ga0501322_001062 Ga0501322_001062_64_1422 408
94 3300009011 Ga0105251_10024997 Ga0105251_100249972 409
95 3300009036 Ga0105244_10038629 Ga0105244_100386292 409
96 3300009092 Ga0105250_10001097 Ga0105250_100010973 409
97 3300046512 Ga0495610_0006668 Ga0495610_0006668_3409_4791 409
98 3300046674 Ga0495588_0022173 Ga0495588_0022173_426_1826 409
99 3300049533 Ga0501317_004256 Ga0501317_004256_39_1421 409
100 3300046506 Ga0495583_0000337 Ga0495583_0000337_70963_72363 410
101 3300047470 Ga0495681_0000321 Ga0495681_0000321_30229_31629 411
102 3300048091 Ga0495626_0000209 Ga0495626_0000209_28977_30377 411
103 3300046474 Ga0495605_0010077 Ga0495605_0010077_745_2145 412
104 3300046519 Ga0495632_0007966 Ga0495632_0007966_3478_4878 412
105 3300046528 Ga0495642_0028073 Ga0495642_0028073_41_1441 412
106 3300046674 Ga0495588_0009477 Ga0495588_0009477_792_2180 412
107 3300046694 Ga0495649_0040026 Ga0495649_0040026_910_2310 412
108 3300047446 Ga0495679_006599 Ga0495679_006599_2108_3508 412
109 3300061719 Ga0466962_0103324 Ga0466962_0103324_19_1356 413
110 3300046538 Ga0495609_0002409 Ga0495609_0002409_7475_8875 414
111 3300046538 Ga0495609_0009839 Ga0495609_0009839_2255_3643 414
112 3300046542 Ga0495597_0053802 Ga0495597_0053802_132_1520 414
113 3300046694 Ga0495649_0003353 Ga0495649_0003353_2180_3580 414
114 3300048091 Ga0495626_0004099 Ga0495626_0004099_821_2209 414
115 3300013307 Ga0157372_10096969 Ga0157372_100969692 415
116 3300025945 Ga0207679_10101260 Ga0207679_101012601 415
117 3300031548 Ga0307408_100213891 Ga0307408_1002138911 415
118 3300042005 Ga0439448_0003195 Ga0439448_0003195_861_2261 415
119 3300044706 Ga0466964_0000400 Ga0466964_0000400_7679_9079 415
120 3300046453 Ga0495627_003418 Ga0495627_003418_3242_4642 415
121 3300046500 Ga0495596_0001657 Ga0495596_0001657_9213_10613 415
122 3300046506 Ga0495583_0000440 Ga0495583_0000440_7533_8933 415
123 3300046507 Ga0495606_0000680 Ga0495606_0000680_31159_32559 415
124 3300046512 Ga0495610_0002891 Ga0495610_0002891_8802_10202 415
125 3300046518 Ga0495631_0009614 Ga0495631_0009614_460_1860 415
126 3300046519 Ga0495632_0000472 Ga0495632_0000472_4309_5709 415
127 3300046558 Ga0495633_0005384 Ga0495633_0005384_842_2242 415
128 3300046615 Ga0495656_0047013 Ga0495656_0047013_388_1788 415
129 3300046616 Ga0495668_0000288 Ga0495668_0000288_65692_67092 415
130 3300046665 Ga0495661_0013343 Ga0495661_0013343_905_2305 415
131 3300046810 Ga0495660_0012134 Ga0495660_0012134_231_1631 415
132 3300047321 Ga0495676_0019258 Ga0495676_0019258_537_1937 415
133 3300047443 Ga0495687_002248 Ga0495687_002248_10875_12275 415
134 3300047470 Ga0495681_0006775 Ga0495681_0006775_4735_6135 415
135 3300047472 Ga0495686_0013077 Ga0495686_0013077_58_1458 415
136 3300048918 Ga0496115_0109496 Ga0496115_0109496_694_2082 415
137 3300048919 Ga0496116_0021587 Ga0496116_0021587_2693_4093 415
138 3300049127 Ga0501306_005137 Ga0501306_005137_40_1422 415
139 3300049129 Ga0501309_005829 Ga0501309_005829_40_1422 415
140 3300049131 Ga0501341_00709 Ga0501341_00709_40_1422 415
141 3300049133 Ga0501344_00671 Ga0501344_00671_40_1422 415
142 3300049134 Ga0501345_00383 Ga0501345_00383_34_1416 415
143 3300049160 Ga0501304_001586 Ga0501304_001586_40_1422 415
144 3300049163 Ga0501342_00214 Ga0501342_00214_19_1401 415
145 3300049459 Ga0495678_002146 Ga0495678_002146_10307_11707 415
146 3300049527 Ga0501311_004453 Ga0501311_004453_40_1422 415
147 3300049529 Ga0501313_003875 Ga0501313_003875_40_1422 415
148 3300049531 Ga0501315_004329 Ga0501315_004329_39_1421 415
149 3300049533 Ga0501317_003769 Ga0501317_003769_114_1496 415
150 3300049535 Ga0501319_001133 Ga0501319_001133_39_1421 415
151 3300049536 Ga0501320_002434 Ga0501320_002434_39_1421 415
152 3300049537 Ga0501321_001678 Ga0501321_001678_51_1433 415
153 3300049538 Ga0501322_000868 Ga0501322_000868_139_1521 415
154 3300049540 Ga0501324_001794 Ga0501324_001794_40_1422 415
155 3300049542 Ga0501326_00584 Ga0501326_00584_39_1421 415
156 3300049544 Ga0501328_00312 Ga0501328_00312_30_1412 415
157 3300049548 Ga0501332_00369 Ga0501332_00369_451_1833 415
158 3300049549 Ga0501333_000427 Ga0501333_000427_278_1660 415
159 3300049551 Ga0501335_001601 Ga0501335_001601_210_1592 415
160 3300049552 Ga0501336_000731 Ga0501336_000731_61_1443 415
161 3300049552 Ga0501336_001410 Ga0501336_001410_24_1406 415
162 3300049553 Ga0501337_000825 Ga0501337_000825_228_1610 415
163 3300049555 Ga0501339_00059 Ga0501339_00059_62_1444 415
164 3300049556 Ga0501340_000786 Ga0501340_000786_119_1501 415
165 3300049707 Ga0501234_008090 Ga0501234_008090_195_1577 415
166 3300046474 Ga0495605_0014530 Ga0495605_0014530_241_1641 416
167 3300046492 Ga0495585_0026151 Ga0495585_0026151_1056_2456 416
168 3300046499 Ga0495594_0008124 Ga0495594_0008124_945_2345 416
169 3300046506 Ga0495583_0007684 Ga0495583_0007684_2964_4364 416
170 3300046513 Ga0495616_0013390 Ga0495616_0013390_132_1532 416
171 3300046523 Ga0495644_0004533 Ga0495644_0004533_3090_4490 416
172 3300046648 Ga0495611_0000820 Ga0495611_0000820_13673_15073 416
173 3300046684 Ga0495669_0004491 Ga0495669_0004491_2129_3529 416
174 3300047443 Ga0495687_000126 Ga0495687_000126_56514_57914 416
175 3300048910 Ga0496107_0169458 Ga0496107_0169458_21_1346 416
176 3300049546 Ga0501330_000846 Ga0501330_000846_18_1400 416
177 3300049548 Ga0501332_00888 Ga0501332_00888_32_1414 416
178 3300049549 Ga0501333_000977 Ga0501333_000977_41_1423 416
179 3300049551 Ga0501335_001417 Ga0501335_001417_32_1414 416
180 3300046452 Ga0495617_000034 Ga0495617_000034_93335_94735 417
181 3300046453 Ga0495627_000740 Ga0495627_000740_14434_15834 417
182 3300046457 Ga0495590_0000163 Ga0495590_0000163_9855_11255 417
183 3300046460 Ga0495638_0000098 Ga0495638_0000098_108438_109838 417
184 3300046463 Ga0495653_0000004 Ga0495653_0000004_328058_329458 417
185 3300046471 Ga0495650_0007022 Ga0495650_0007022_483_1883 417
186 3300046471 Ga0495650_0008623 Ga0495650_0008623_2792_4192 417
187 3300046474 Ga0495605_0000392 Ga0495605_0000392_10032_11432 417
188 3300046491 Ga0495584_0068226 Ga0495584_0068226_99_1499 417
189 3300046492 Ga0495585_0000495 Ga0495585_0000495_9924_11324 417
190 3300046492 Ga0495585_0000915 Ga0495585_0000915_13785_15185 417
191 3300046500 Ga0495596_0001155 Ga0495596_0001155_6942_8342 417
192 3300046501 Ga0495607_0001320 Ga0495607_0001320_1802_3202 417
193 3300046506 Ga0495583_0000472 Ga0495583_0000472_30523_31923 417
194 3300046507 Ga0495606_0000084 Ga0495606_0000084_38758_40164 417
195 3300046507 Ga0495606_0000175 Ga0495606_0000175_84424_85824 417
196 3300046513 Ga0495616_0000073 Ga0495616_0000073_26513_27913 417
197 3300046513 Ga0495616_0001793 Ga0495616_0001793_2690_4150 417
198 3300046513 Ga0495616_0019954 Ga0495616_0019954_413_1813 417
199 3300046518 Ga0495631_0008692 Ga0495631_0008692_250_1650 417
200 3300046518 Ga0495631_0011505 Ga0495631_0011505_2270_3670 417
201 3300046519 Ga0495632_0000193 Ga0495632_0000193_30781_32181 417
202 3300046523 Ga0495644_0003858 Ga0495644_0003858_2894_4294 417
203 3300046524 Ga0495648_0000169 Ga0495648_0000169_43205_44605 417
204 3300046524 Ga0495648_0001706 Ga0495648_0001706_18038_19438 417
205 3300046528 Ga0495642_0000050 Ga0495642_0000050_40322_41722 417
206 3300046528 Ga0495642_0001786 Ga0495642_0001786_6042_7442 417
207 3300046528 Ga0495642_0002213 Ga0495642_0002213_3910_5310 417
208 3300046538 Ga0495609_0020661 Ga0495609_0020661_37_1437 417
209 3300046557 Ga0495622_0000263 Ga0495622_0000263_30540_31940 417
210 3300046616 Ga0495668_0001420 Ga0495668_0001420_19177_20577 417
211 3300046616 Ga0495668_0011207 Ga0495668_0011207_2639_4039 417
212 3300046616 Ga0495668_0019232 Ga0495668_0019232_410_1870 417
213 3300046660 Ga0495625_0000810 Ga0495625_0000810_14997_16397 417
214 3300046665 Ga0495661_0012638 Ga0495661_0012638_182_1582 417
215 3300046684 Ga0495669_0001587 Ga0495669_0001587_2731_4131 417
216 3300046684 Ga0495669_0010304 Ga0495669_0010304_1430_2830 417
217 3300046691 Ga0495670_0016793 Ga0495670_0016793_1268_2668 417
218 3300046692 Ga0495671_0000562 Ga0495671_0000562_17756_19156 417
219 3300046794 Ga0495589_0009939 Ga0495589_0009939_2676_4076 417
220 3300046810 Ga0495660_0001926 Ga0495660_0001926_6151_7551 417
221 3300046810 Ga0495660_0011175 Ga0495660_0011175_385_1785 417
222 3300047318 Ga0495636_0048806 Ga0495636_0048806_240_1640 417
223 3300047470 Ga0495681_0019842 Ga0495681_0019842_936_2336 417
224 3300048905 Ga0496102_0000341 Ga0496102_0000341_19039_20439 417
225 3300049459 Ga0495678_000816 Ga0495678_000816_3368_4828 417
226 3300049460 Ga0495682_0000820 Ga0495682_0000820_3368_4828 417
227 3300009036 Ga0105244_10014224 Ga0105244_100142242 418
228 3300031838 Ga0307518_10151747 Ga0307518_101517472 418
229 3300046457 Ga0495590_0000027 Ga0495590_0000027_29208_30608 418
230 3300046458 Ga0495591_003556 Ga0495591_003556_4033_5433 418
231 3300046474 Ga0495605_0031388 Ga0495605_0031388_1304_2704 418
232 3300046491 Ga0495584_0002207 Ga0495584_0002207_5967_7367 418
233 3300046501 Ga0495607_0002040 Ga0495607_0002040_14935_16335 418
234 3300046506 Ga0495583_0005530 Ga0495583_0005530_2499_3899 418
235 3300046512 Ga0495610_0000473 Ga0495610_0000473_13077_14477 418
236 3300046518 Ga0495631_0001559 Ga0495631_0001559_4424_5824 418
237 3300046520 Ga0495637_0000013 Ga0495637_0000013_239405_240805 418
238 3300046522 Ga0495643_0005890 Ga0495643_0005890_966_2366 418
239 3300046558 Ga0495633_0001021 Ga0495633_0001021_4481_5881 418
240 3300046616 Ga0495668_0000744 Ga0495668_0000744_27621_29021 418
241 3300046648 Ga0495611_0004060 Ga0495611_0004060_2386_3786 418
242 3300046694 Ga0495649_0005117 Ga0495649_0005117_3714_5114 418
243 3300046794 Ga0495589_0005282 Ga0495589_0005282_2836_4236 418
244 3300047320 Ga0495672_0000138 Ga0495672_0000138_5952_7352 418
245 3300047323 Ga0495683_0000335 Ga0495683_0000335_29973_31373 418
246 3300047445 Ga0495677_0001847 Ga0495677_0001847_3247_4647 418
247 3300047446 Ga0495679_012733 Ga0495679_012733_1168_2568 418
248 3300047470 Ga0495681_0018497 Ga0495681_0018497_1270_2670 418
249 3300047470 Ga0495681_0021526 Ga0495681_0021526_717_2117 418
250 3300048091 Ga0495626_0010575 Ga0495626_0010575_2726_4126 418
251 3300048905 Ga0496102_0000487 Ga0496102_0000487_30796_32196 418
252 3300048906 Ga0496103_0085525 Ga0496103_0085525_333_1733 418
253 3300048909 Ga0496106_0009708 Ga0496106_0009708_3024_4424 418
254 3300048913 Ga0496110_0000024 Ga0496110_0000024_34473_35873 418
255 3300049459 Ga0495678_004718 Ga0495678_004718_3889_5289 418
256 3300005262 Ga0065165_1004256 Ga0065165_10042563 419
257 3300046463 Ga0495653_0007472 Ga0495653_0007472_5924_7324 419
258 3300046491 Ga0495584_0031022 Ga0495584_0031022_864_2264 419
259 3300046500 Ga0495596_0001373 Ga0495596_0001373_3552_4952 419
260 3300046522 Ga0495643_0074781 Ga0495643_0074781_168_1568 419
261 3300046535 Ga0495586_0000429 Ga0495586_0000429_19591_20991 419
262 3300046538 Ga0495609_0001842 Ga0495609_0001842_3401_4852 419
263 3300046542 Ga0495597_0010097 Ga0495597_0010097_1098_2498 419
264 3300046616 Ga0495668_0009917 Ga0495668_0009917_1371_2771 419
265 3300046648 Ga0495611_0014839 Ga0495611_0014839_1009_2409 419
266 3300046663 Ga0495635_0002356 Ga0495635_0002356_5224_6624 419
267 3300046665 Ga0495661_0000590 Ga0495661_0000590_28606_30006 419
268 3300046794 Ga0495589_0056263 Ga0495589_0056263_123_1574 419
269 3300047317 Ga0495604_0012497 Ga0495604_0012497_48_1448 419
270 3300047322 Ga0495680_0002331 Ga0495680_0002331_11961_13361 419
271 3300047444 Ga0495675_0002496 Ga0495675_0002496_2179_3579 419
272 3300047472 Ga0495686_0039804 Ga0495686_0039804_685_2085 419
273 3300047673 Ga0495593_0000337 Ga0495593_0000337_5219_6619 419
274 3300048089 Ga0495614_0009645 Ga0495614_0009645_1706_3106 419
275 3300048091 Ga0495626_0001445 Ga0495626_0001445_3724_5172 419
276 3300048903 Ga0496100_0015868 Ga0496100_0015868_2919_4319 419
277 3300048904 Ga0496101_0113774 Ga0496101_0113774_35_1435 419
278 3300048925 Ga0496122_0000439 Ga0496122_0000439_55277_56677 419
279 3300048926 Ga0496123_0000487 Ga0496123_0000487_29531_30931 419
280 3300048928 Ga0496125_0002348 Ga0496125_0002348_12945_14345 419
281 3300030731 Ga0316177_1058998 Ga0316177_10589982 420
282 3300046513 Ga0495616_0028852 Ga0495616_0028852_69_1460 420
283 3300048926 Ga0496123_0015809 Ga0496123_0015809_2979_4379 420
284 3300025229 Ga0209147_100897 Ga0209147_10089718 421
285 3300030083 Ga0237817_10022 Ga0237817_1002249 421
286 3300047469 Ga0495673_0000265 Ga0495673_0000265_46966_48366 421
287 3300037312 Ga0395899_0034080 Ga0395899_0034080_979_2379 422
288 3300037418 Ga0395900_0003633 Ga0395900_0003633_13547_14947 422
289 3300037466 Ga0395898_0046735 Ga0395898_0046735_1883_3283 422
290 3300038443 Ga0395901_0000940 Ga0395901_0000940_25473_26873 422
291 3300002987 JGI25159J45721_1016942 JGI25159J45721_10169421 423
292 3300003771 Ga0055526_1001986 Ga0055526_10019862 423
293 3300003773 Ga0055537_1000804 Ga0055537_100080410 423
294 3300003784 Ga0055534_1003076 Ga0055534_10030761 423
295 3300003790 Ga0055528_1001228 Ga0055528_10012287 423
296 3300025263 Ga0209565_1000015 Ga0209565_100001563 423
297 3300025273 Ga0209673_1000394 Ga0209673_100039463 423
298 3300025284 Ga0209130_1000808 Ga0209130_100080820 423
299 3300025291 Ga0209675_1000012 Ga0209675_1000012419 423
300 3300025291 Ga0209675_1018399 Ga0209675_10183992 423
301 3300025294 Ga0209025_1000587 Ga0209025_100058736 423
302 3300025294 Ga0209025_1003160 Ga0209025_10031608 423
303 3300025294 Ga0209025_1016354 Ga0209025_10163544 423
304 3300025294 Ga0209025_1030743 Ga0209025_10307433 423
305 3300025295 Ga0209564_1000016 Ga0209564_1000016532 423
306 3300025299 Ga0209256_1000076 Ga0209256_100007624 423
307 3300025711 Ga0207696_1000701 Ga0207696_100070110 423
308 3300025735 Ga0207713_1009932 Ga0207713_10099327 423
309 3300038705 Ga0237819_00050 Ga0237819_00050_12576_13970 423
310 3300038705 Ga0237819_00225 Ga0237819_00225_18448_19842 423
311 3300045976 Ga0466967_0000025 Ga0466967_0000025_46000_47394 423
312 3300046491 Ga0495584_0035938 Ga0495584_0035938_932_2332 423
313 3300046501 Ga0495607_0000522 Ga0495607_0000522_30909_32309 423
314 3300046506 Ga0495583_0023043 Ga0495583_0023043_1684_3084 423
315 3300046538 Ga0495609_0000163 Ga0495609_0000163_18213_19613 423
316 3300046616 Ga0495668_0004121 Ga0495668_0004121_8734_10134 423
317 3300046660 Ga0495625_0032331 Ga0495625_0032331_29_1429 423
318 3300046664 Ga0495659_0002554 Ga0495659_0002554_2077_3477 423
319 3300046684 Ga0495669_0001176 Ga0495669_0001176_7236_8636 423
320 3300046694 Ga0495649_0010907 Ga0495649_0010907_1795_3195 423
321 3300046694 Ga0495649_0014124 Ga0495649_0014124_981_2381 423
322 3300044694 Ga0466963_0049246 Ga0466963_0049246_528_1928 424
323 3300045976 Ga0466967_0005518 Ga0466967_0005518_4057_5457 424
324 3300047443 Ga0495687_021145 Ga0495687_021145_1653_3053 424
325 3300009174 Ga0105241_10019750 Ga0105241_100197503 425
326 3300032004 Ga0307414_10005411 Ga0307414_100054116 425
327 3300046507 Ga0495606_0000787 Ga0495606_0000787_1687_3087 425
328 3300046528 Ga0495642_0036311 Ga0495642_0036311_277_1677 425
329 3300046557 Ga0495622_0052092 Ga0495622_0052092_462_1862 425
330 3300046616 Ga0495668_0000120 Ga0495668_0000120_37652_39052 425
331 3300046674 Ga0495588_0015153 Ga0495588_0015153_223_1623 425
332 3300047321 Ga0495676_0000067 Ga0495676_0000067_53197_54597 425
333 3300047472 Ga0495686_0051493 Ga0495686_0051493_215_1627 425
334 3300049459 Ga0495678_007692 Ga0495678_007692_1345_2745 425
335 3300046501 Ga0495607_0002280 Ga0495607_0002280_5571_6971 426
336 3300046522 Ga0495643_0000981 Ga0495643_0000981_3454_4854 426
337 3300046665 Ga0495661_0002907 Ga0495661_0002907_379_1779 426
338 3300006948 Ga0099826_10000001 Ga0099826_10000001947 427
339 3300027666 Ga0209282_1000001 Ga0209282_10000012080 427
340 3300046471 Ga0495650_0000042 Ga0495650_0000042_37976_39376 427
341 3300002987 JGI25159J45721_1007043 JGI25159J45721_10070433 428
342 3300003187 JGI25151J46595_10007016 JGI25151J46595_100070162 428
343 3300003187 JGI25151J46595_10017170 JGI25151J46595_100171704 428
344 3300025284 Ga0209130_1001673 Ga0209130_10016735 428
345 3300025294 Ga0209025_1000539 Ga0209025_100053965 428
346 3300025909 Ga0207705_10004156 Ga0207705_100041563 428
347 3300025919 Ga0207657_10006827 Ga0207657_100068272 428
348 3300046452 Ga0495617_000004 Ga0495617_000004_462560_463960 428
349 3300046471 Ga0495650_0000445 Ga0495650_0000445_50083_51483 428
350 3300046512 Ga0495610_0000010 Ga0495610_0000010_163_1563 428
351 3300046519 Ga0495632_0000027 Ga0495632_0000027_86754_88154 428
352 3300046524 Ga0495648_0000995 Ga0495648_0000995_18333_19733 428
353 3300046524 Ga0495648_0005293 Ga0495648_0005293_7315_8715 428
354 3300046530 Ga0495654_0063486 Ga0495654_0063486_192_1592 428
355 3300046616 Ga0495668_0000853 Ga0495668_0000853_14995_16395 428
356 3300046692 Ga0495671_0000002 Ga0495671_0000002_53351_54751 428
357 3300046692 Ga0495671_0041162 Ga0495671_0041162_301_1701 428
358 3300047323 Ga0495683_0005284 Ga0495683_0005284_2838_4238 428
359 3300047446 Ga0495679_017901 Ga0495679_017901_332_1732 428
360 3300047469 Ga0495673_0000207 Ga0495673_0000207_56506_57906 428
361 3300003322 rootL2_10093230 rootL2_100932302 429
362 3300038443 Ga0395901_0238849 Ga0395901_0238849_351_1739 429
363 3300048925 Ga0496122_0003278 Ga0496122_0003278_17266_18666 429
364 3300048926 Ga0496123_0046287 Ga0496123_0046287_1384_2784 429
365 3300025294 Ga0209025_1000547 Ga0209025_100054747 430
366 3300046491 Ga0495584_0010072 Ga0495584_0010072_3321_4709 430
367 3300046501 Ga0495607_0003499 Ga0495607_0003499_78_1466 430
368 3300046513 Ga0495616_0002753 Ga0495616_0002753_1112_2500 430
369 3300046538 Ga0495609_0000022 Ga0495609_0000022_181998_183386 430
370 3300046665 Ga0495661_0000151 Ga0495661_0000151_28914_30302 430
371 3300046794 Ga0495589_0000017 Ga0495589_0000017_146499_147887 430
372 3300047443 Ga0495687_000033 Ga0495687_000033_87188_88576 430
373 3300047445 Ga0495677_0000002 Ga0495677_0000002_170593_171981 430
374 3300048091 Ga0495626_0000258 Ga0495626_0000258_4228_5616 430
375 3300048091 Ga0495626_0035779 Ga0495626_0035779_950_2350 430
376 3300048906 Ga0496103_0001999 Ga0496103_0001999_5277_6659 430
377 iso_pu_bacteria 3006826541 3006829321 430
378 3300037312 Ga0395899_0000128 Ga0395899_0000128_55309_56706 432
379 3300046453 Ga0495627_000088 Ga0495627_000088_41230_42630 432
380 3300046523 Ga0495644_0003003 Ga0495644_0003003_190_1590 432
381 3300046538 Ga0495609_0000386 Ga0495609_0000386_763_2163 432
382 3300046810 Ga0495660_0000448 Ga0495660_0000448_15443_16843 432
383 3300046810 Ga0495660_0000493 Ga0495660_0000493_17398_18798 432
384 3300047470 Ga0495681_0002480 Ga0495681_0002480_3392_4792 432
385 3300048927 Ga0496124_0023507 Ga0496124_0023507_3153_4553 432
386 3300049459 Ga0495678_000197 Ga0495678_000197_27549_28949 432
387 iso_pu_bacteria 2593339131 2595089711 432
388 iso_pu_bacteria 2964375228 2964375483 432
389 iso_pu_bacteria 3006978542 3006978654 432
390 iso_pu_bacteria 8057632132 8057633686 432
391 3300003322 rootL2_10093232 rootL2_100932322 433
392 3300025294 Ga0209025_1014056 Ga0209025_10140564 433
393 3300037418 Ga0395900_0020278 Ga0395900_0020278_2020_3420 433
394 3300046500 Ga0495596_0013842 Ga0495596_0013842_1143_2543 433
395 3300046513 Ga0495616_0001438 Ga0495616_0001438_623_2023 433
396 3300046558 Ga0495633_0000311 Ga0495633_0000311_23302_24702 433
397 3300047472 Ga0495686_0000272 Ga0495686_0000272_8194_9594 433
398 3300049460 Ga0495682_0003926 Ga0495682_0003926_2756_4156 433
399 iso_pu_bacteria 2551306519 2553393393 433
400 iso_pu_bacteria 2643221729 2644708180 433
401 iso_pu_bacteria 2643221730 2644712483 433
402 iso_pu_bacteria 2671180330 2672337575 433
403 iso_pu_bacteria 2684622632 2685152220 433
404 iso_pu_bacteria 2695420987 2698320942 433
405 iso_pu_bacteria 2703719227 2705996159 433
406 iso_pu_bacteria 2718218445 2721507380 433
407 iso_pu_bacteria 2738541358 2739154577 433
408 iso_pu_bacteria 2738543006 2739208051 433
409 iso_pu_bacteria 2816332186 2816862014 433
410 iso_pu_bacteria 2818991443 2819584435 433
411 iso_pu_bacteria 2842682962 2842686705 433
412 iso_pu_bacteria 2849139964 2849141653 433
413 iso_pu_bacteria 2857581216 2857583906 433
414 iso_pu_bacteria 2929233124 2929237919 433
415 iso_pu_bacteria 2938917290 2938922110 433
416 iso_pu_bacteria 2947426588 2947431004 433
417 iso_pu_bacteria 2965761152 2965765624 433
418 iso_pu_bacteria 2979083700 2979087905 433
419 iso_pu_bacteria 8022621104 8022624148 433
420 iso_pu_bacteria 8022792930 8022796839 433
421 iso_pu_bacteria 8023438354 8023443067 433
422 iso_pu_bacteria 8023444577 8023445112 433
423 iso_pu_bacteria 8057582654 8057586681 433
424 3300003759 Ga0055525_1000029 Ga0055525_1000029102 434
425 3300003775 Ga0055524_1000134 Ga0055524_100013461 434
426 3300005366 Ga0070659_100036801 Ga0070659_1000368012 434
427 3300005457 Ga0070662_100124231 Ga0070662_1001242312 434
428 3300009148 Ga0105243_10040580 Ga0105243_100405802 434
429 3300009176 Ga0105242_10024415 Ga0105242_100244152 434
430 3300010375 Ga0105239_10099735 Ga0105239_100997352 434
431 3300015261 Ga0182006_1000155 Ga0182006_100015552 434
432 3300015262 Ga0182007_10000275 Ga0182007_1000027516 434
433 3300015265 Ga0182005_1000084 Ga0182005_100008452 434
434 3300017792 Ga0163161_10015243 Ga0163161_100152433 434
435 3300025230 Ga0209563_100003 Ga0209563_100003266 434
436 3300025253 Ga0209677_103078 Ga0209677_1030785 434
437 3300025263 Ga0209565_1004518 Ga0209565_10045184 434
438 3300025299 Ga0209256_1000005 Ga0209256_1000005645 434
439 3300025932 Ga0207690_10004410 Ga0207690_100044106 434
440 3300025934 Ga0207686_10062816 Ga0207686_100628161 434
441 3300025935 Ga0207709_10046463 Ga0207709_100464632 434
442 3300037418 Ga0395900_0120629 Ga0395900_0120629_171_1571 434
443 3300037418 Ga0395900_0133655 Ga0395900_0133655_208_1608 434
444 3300037471 Ga0395905_0197814 Ga0395905_0197814_413_1813 434
445 3300038443 Ga0395901_0137842 Ga0395901_0137842_384_1784 434
446 3300042008 Ga0439450_006482 Ga0439450_006482_178_1578 434
447 3300042157 Ga0439458_0013400 Ga0439458_0013400_192_1592 434
448 3300044658 Ga0466972_0007848 Ga0466972_0007848_2344_3744 434
449 3300044683 Ga0466965_0001913 Ga0466965_0001913_1592_2992 434
450 3300044683 Ga0466965_0004323 Ga0466965_0004323_3575_4975 434
451 3300044683 Ga0466965_0005700 Ga0466965_0005700_58_1458 434
452 3300044684 Ga0466966_0010763 Ga0466966_0010763_3486_4886 434
453 3300044684 Ga0466966_0025590 Ga0466966_0025590_238_1638 434
454 3300044706 Ga0466964_0000019 Ga0466964_0000019_10229_11629 434
455 3300044735 Ga0466968_0000184 Ga0466968_0000184_5188_6588 434
456 3300044842 Ga0466957_0000079 Ga0466957_0000079_13188_14588 434
457 3300045049 Ga0466959_0060474 Ga0466959_0060474_21_1421 434
458 3300045836 Ga0466958_0034946 Ga0466958_0034946_1521_2921 434
459 3300046457 Ga0495590_0001262 Ga0495590_0001262_3677_5077 434
460 3300046460 Ga0495638_0027365 Ga0495638_0027365_944_2344 434
461 3300046474 Ga0495605_0000029 Ga0495605_0000029_91746_93146 434
462 3300046491 Ga0495584_0001542 Ga0495584_0001542_3761_5161 434
463 3300046501 Ga0495607_0001327 Ga0495607_0001327_144_1544 434
464 3300046501 Ga0495607_0003791 Ga0495607_0003791_9877_11277 434
465 3300046506 Ga0495583_0002737 Ga0495583_0002737_10978_12378 434
466 3300046507 Ga0495606_0002963 Ga0495606_0002963_4066_5466 434
467 3300046507 Ga0495606_0012596 Ga0495606_0012596_2131_3540 434
468 3300046507 Ga0495606_0017984 Ga0495606_0017984_264_1664 434
469 3300046518 Ga0495631_0000008 Ga0495631_0000008_118108_119508 434
470 3300046522 Ga0495643_0000633 Ga0495643_0000633_21764_23164 434
471 3300046522 Ga0495643_0008292 Ga0495643_0008292_3558_4958 434
472 3300046523 Ga0495644_0000222 Ga0495644_0000222_2049_3449 434
473 3300046524 Ga0495648_0005820 Ga0495648_0005820_6321_7784 434
474 3300046528 Ga0495642_0000772 Ga0495642_0000772_3510_4910 434
475 3300046530 Ga0495654_0012631 Ga0495654_0012631_708_2108 434
476 3300046530 Ga0495654_0025388 Ga0495654_0025388_1139_2539 434
477 3300046542 Ga0495597_0000169 Ga0495597_0000169_47252_48652 434
478 3300046542 Ga0495597_0016445 Ga0495597_0016445_1393_2802 434
479 3300046558 Ga0495633_0000614 Ga0495633_0000614_15744_17144 434
480 3300046615 Ga0495656_0007771 Ga0495656_0007771_34_1434 434
481 3300046616 Ga0495668_0000597 Ga0495668_0000597_25763_27163 434
482 3300046660 Ga0495625_0003516 Ga0495625_0003516_8290_9690 434
483 3300046660 Ga0495625_0024662 Ga0495625_0024662_65_1474 434
484 3300046665 Ga0495661_0000864 Ga0495661_0000864_21178_22578 434
485 3300046665 Ga0495661_0009600 Ga0495661_0009600_1620_3020 434
486 3300046674 Ga0495588_0000086 Ga0495588_0000086_85471_86871 434
487 3300046794 Ga0495589_0000926 Ga0495589_0000926_108_1508 434
488 3300046810 Ga0495660_0000067 Ga0495660_0000067_83521_84921 434
489 3300046810 Ga0495660_0029913 Ga0495660_0029913_511_1920 434
490 3300047320 Ga0495672_0002293 Ga0495672_0002293_14445_15845 434
491 3300047323 Ga0495683_0004821 Ga0495683_0004821_449_1849 434
492 3300047443 Ga0495687_000670 Ga0495687_000670_10664_12064 434
493 3300047443 Ga0495687_000818 Ga0495687_000818_15883_17283 434
494 3300047443 Ga0495687_000842 Ga0495687_000842_14899_16299 434
495 3300047445 Ga0495677_0000199 Ga0495677_0000199_18887_20287 434
496 3300047446 Ga0495679_005465 Ga0495679_005465_2379_3779 434
497 3300048091 Ga0495626_0000097 Ga0495626_0000097_26731_28131 434
498 3300048913 Ga0496110_0000399 Ga0496110_0000399_17451_18839 434
499 3300048919 Ga0496116_0019713 Ga0496116_0019713_3702_5102 434
500 3300048920 Ga0496117_0000032 Ga0496117_0000032_59867_61267 434
501 3300048921 Ga0496118_0000027 Ga0496118_0000027_314267_315667 434
502 3300048925 Ga0496122_0001272 Ga0496122_0001272_36592_37992 434
503 3300048925 Ga0496122_0006946 Ga0496122_0006946_5381_6781 434
504 3300048926 Ga0496123_0002487 Ga0496123_0002487_21030_22430 434
505 3300048926 Ga0496123_0003399 Ga0496123_0003399_4071_5471 434
506 3300048927 Ga0496124_0007367 Ga0496124_0007367_7498_8898 434
507 3300048927 Ga0496124_0050951 Ga0496124_0050951_1209_2609 434
508 3300048928 Ga0496125_0047384 Ga0496125_0047384_164_1624 434
509 3300048928 Ga0496125_0091408 Ga0496125_0091408_142_1542 434
510 3300049459 Ga0495678_000131 Ga0495678_000131_33137_34537 434
511 3300049460 Ga0495682_0004690 Ga0495682_0004690_4340_5740 434
512 iso_pu_bacteria 2916971899 2916972403 434
513 3300046460 Ga0495638_0011682 Ga0495638_0011682_2803_4203 435
514 3300046474 Ga0495605_0011000 Ga0495605_0011000_2705_4105 435
515 3300046491 Ga0495584_0000151 Ga0495584_0000151_7993_9393 435
516 3300046501 Ga0495607_0008115 Ga0495607_0008115_3587_4987 435
517 3300046506 Ga0495583_0000348 Ga0495583_0000348_48340_49740 435
518 3300046512 Ga0495610_0018327 Ga0495610_0018327_732_2132 435
519 3300046513 Ga0495616_0001674 Ga0495616_0001674_10109_11509 435
520 3300046523 Ga0495644_0003501 Ga0495644_0003501_991_2391 435
521 3300046524 Ga0495648_0014594 Ga0495648_0014594_1840_3240 435
522 3300046558 Ga0495633_0009353 Ga0495633_0009353_2192_3592 435
523 3300046648 Ga0495611_0018103 Ga0495611_0018103_1453_2853 435
524 3300046660 Ga0495625_0003030 Ga0495625_0003030_14422_15822 435
525 3300046664 Ga0495659_0001234 Ga0495659_0001234_2753_4153 435
526 3300046691 Ga0495670_0013061 Ga0495670_0013061_751_2151 435
527 3300046810 Ga0495660_0000846 Ga0495660_0000846_18144_19556 435
528 3300047320 Ga0495672_0003715 Ga0495672_0003715_2238_3638 435
529 3300047320 Ga0495672_0013121 Ga0495672_0013121_835_2235 435
530 3300047323 Ga0495683_0020616 Ga0495683_0020616_1833_3233 435
531 3300047443 Ga0495687_000992 Ga0495687_000992_10304_11704 435
532 3300047445 Ga0495677_0007834 Ga0495677_0007834_1938_3338 435
533 3300047447 Ga0495685_000079 Ga0495685_000079_18932_20332 435
534 3300047469 Ga0495673_0002722 Ga0495673_0002722_1695_3095 435
535 3300047472 Ga0495686_0005802 Ga0495686_0005802_7325_8725 435
536 3300049459 Ga0495678_006534 Ga0495678_006534_2940_4340 435
537 iso_pu_bacteria 2738541280 2738742437 435
538 iso_pu_bacteria 2738541300 2738845392 435
539 iso_pu_bacteria 2738543018 2739276445 435
540 iso_pu_bacteria 2738543030 2739345489 435
541 iso_pu_bacteria 2843690924 2843694502 435
542 iso_pu_bacteria 2919493220 2919494732 435
543 iso_pu_bacteria 2919543075 2919546688 435
544 3300044765 Ga0466970_0066918 Ga0466970_0066918_203_1630 436
545 3300045049 Ga0466959_0024372 Ga0466959_0024372_2148_3548 436
546 3300046501 Ga0495607_0008656 Ga0495607_0008656_2858_4258 436
547 3300046501 Ga0495607_0035150 Ga0495607_0035150_1466_2866 436
548 3300046524 Ga0495648_0017756 Ga0495648_0017756_2211_3611 436
549 3300046530 Ga0495654_0013411 Ga0495654_0013411_2834_4243 436
550 3300046664 Ga0495659_0000019 Ga0495659_0000019_27755_29164 436
551 3300046692 Ga0495671_0002087 Ga0495671_0002087_9483_10892 436
552 3300047320 Ga0495672_0000343 Ga0495672_0000343_9825_11234 436
553 iso_pu_bacteria 2600255292 2601671647 436
554 iso_pu_bacteria 2643221638 2644215562 436
555 iso_pu_bacteria 2643221664 2644358226 436
556 iso_pu_bacteria 2738541297 2738830368 436
557 iso_pu_bacteria 2738541357 2739154164 436
558 iso_pu_bacteria 2738543003 2739196084 436
559 iso_pu_bacteria 2738543026 2739322560 436
560 iso_pu_bacteria 2738543029 2739340801 436
561 iso_pu_bacteria 2808606418 2809142483 436
562 iso_pu_bacteria 2821131069 2821133454 436
563 iso_pu_bacteria 2857547612 2857553015 436
564 iso_pu_bacteria 2857553236 2857558308 436
565 iso_pu_bacteria 2857564685 2857570232 436
566 iso_pu_bacteria 2885080285 2885085476 436
567 iso_pu_bacteria 2904424332 2904427738 436
568 iso_pu_bacteria 2932410948 2932414033 436
569 iso_pu_bacteria 2932416698 2932418093 436
570 3300025254 Ga0209148_1000806 Ga0209148_10008066 437
571 3300037418 Ga0395900_0000123 Ga0395900_0000123_60532_61932 437
572 3300038443 Ga0395901_0000411 Ga0395901_0000411_49022_50422 437
573 3300046471 Ga0495650_0000833 Ga0495650_0000833_11770_13170 437
574 3300046500 Ga0495596_0000499 Ga0495596_0000499_18783_20183 437
575 3300046524 Ga0495648_0005245 Ga0495648_0005245_4299_5699 437
576 3300046525 Ga0495663_0001314 Ga0495663_0001314_4676_6076 437
577 3300046538 Ga0495609_0002102 Ga0495609_0002102_9903_11303 437
578 3300046538 Ga0495609_0013538 Ga0495609_0013538_2300_3700 437
579 3300046542 Ga0495597_0000064 Ga0495597_0000064_50149_51549 437
580 3300046543 Ga0495645_0048358 Ga0495645_0048358_151_1551 437
581 3300046615 Ga0495656_0039474 Ga0495656_0039474_549_1949 437
582 3300047320 Ga0495672_0007596 Ga0495672_0007596_5268_6668 437
583 3300047323 Ga0495683_0003680 Ga0495683_0003680_5023_6423 437
584 3300047472 Ga0495686_0000228 Ga0495686_0000228_77775_79175 437
585 3300048090 Ga0495615_0000473 Ga0495615_0000473_3289_4689 437
586 3300048091 Ga0495626_0021756 Ga0495626_0021756_479_1879 437
587 3300048928 Ga0496125_0150335 Ga0496125_0150335_54_1454 437
588 3300049822 Ga0501035_0001714 Ga0501035_0001714_15733_17133 437
589 3300049823 Ga0501044_0093557 Ga0501044_0093557_746_2146 437
590 iso_pu_bacteria 2738541299 2738838465 437
591 3300025263 Ga0209565_1008622 Ga0209565_10086223 438
592 3300031548 Ga0307408_100001107 Ga0307408_1000011079 438
593 3300046452 Ga0495617_006196 Ga0495617_006196_1784_3184 438
594 3300046520 Ga0495637_0015023 Ga0495637_0015023_1680_3080 438
595 3300046616 Ga0495668_0001549 Ga0495668_0001549_14500_15900 438
596 3300046660 Ga0495625_0025233 Ga0495625_0025233_2275_3687 438
597 3300046694 Ga0495649_0028861 Ga0495649_0028861_294_1694 438
598 3300046794 Ga0495589_0019499 Ga0495589_0019499_1467_2867 438
599 3300047315 Ga0495581_0006141 Ga0495581_0006141_1914_3314 438
600 3300047445 Ga0495677_0012854 Ga0495677_0012854_1077_2477 438
601 3300047469 Ga0495673_0000028 Ga0495673_0000028_463503_464903 438
602 3300049766 Ga0501269_000022 Ga0501269_000022_5099_6505 438
603 3300046475 Ga0495639_0012572 Ga0495639_0012572_1040_2440 439
604 3300046522 Ga0495643_0000551 Ga0495643_0000551_25061_26461 439
605 3300046542 Ga0495597_0000266 Ga0495597_0000266_20334_21734 439
606 3300002773 JGI25152J39213_1000078 JGI25152J39213_100007844 440
607 3300002774 JGI25150J39212_1000136 JGI25150J39212_100013624 440
608 3300003215 JGI25153J46596_10002503 JGI25153J46596_100025038 440
609 3300003775 Ga0055524_1000201 Ga0055524_100020145 440
610 3300004625 Ga0055543_1004844 Ga0055543_10048442 440
611 3300005262 Ga0065165_1001270 Ga0065165_10012707 440
612 3300006946 Ga0079104_1004592 Ga0079104_10045924 440
613 3300015261 Ga0182006_1000092 Ga0182006_100009231 440
614 3300015265 Ga0182005_1000041 Ga0182005_100004131 440
615 3300025245 Ga0207425_1000014 Ga0207425_1000014388 440
616 3300025258 Ga0209129_1000017 Ga0209129_100001772 440
617 3300025284 Ga0209130_1000296 Ga0209130_100029617 440
618 3300025297 Ga0209758_1000038 Ga0209758_1000038388 440
619 3300025299 Ga0209256_1000298 Ga0209256_100029846 440
620 3300027111 Ga0209281_1005530 Ga0209281_10055302 440
621 3300046457 Ga0495590_0000301 Ga0495590_0000301_21220_22620 440
622 3300046460 Ga0495638_0018023 Ga0495638_0018023_2456_3856 440
623 3300046471 Ga0495650_0000011 Ga0495650_0000011_400604_402004 440
624 3300046471 Ga0495650_0000715 Ga0495650_0000715_696_2096 440
625 3300046473 Ga0495582_0003967 Ga0495582_0003967_2969_4369 440
626 3300046507 Ga0495606_0001426 Ga0495606_0001426_63_1463 440
627 3300046517 Ga0495630_0096324 Ga0495630_0096324_71_1471 440
628 3300046520 Ga0495637_0000114 Ga0495637_0000114_13173_14573 440
629 3300046529 Ga0495652_0009303 Ga0495652_0009303_1046_2446 440
630 3300046530 Ga0495654_0000002 Ga0495654_0000002_43933_45333 440
631 3300046531 Ga0495665_0002786 Ga0495665_0002786_5136_6536 440
632 3300046642 Ga0495634_0009438 Ga0495634_0009438_4276_5676 440
633 3300046660 Ga0495625_0004451 Ga0495625_0004451_9353_10753 440
634 3300046679 Ga0495623_0001807 Ga0495623_0001807_6985_8385 440
635 3300046679 Ga0495623_0005944 Ga0495623_0005944_3951_5435 440
636 3300046809 Ga0495600_0008701 Ga0495600_0008701_1454_2854 440
637 3300046810 Ga0495660_0003472 Ga0495660_0003472_5359_6759 440
638 3300047317 Ga0495604_0042836 Ga0495604_0042836_669_2069 440
639 3300047320 Ga0495672_0000162 Ga0495672_0000162_78788_80188 440
640 3300048088 Ga0495602_0003696 Ga0495602_0003696_11027_12427 440
641 iso_pu_bacteria 2643221556 2643800193 440
642 iso_pu_bacteria 2643221684 2644472025 440
643 iso_pu_bacteria 8047673197 8047674785 440

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00375

SDF

Sodium:dicarboxylate symporter family

82

430

0.95

PF00375

SDF

Sodium:dicarboxylate symporter family

420

473

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ngh-assembly1.cif.gz_C structure of glutamate transporter homologue in complex with sybody 0.8531 21 428
7ngh-assembly1.cif.gz_C structure of glutamate transporter homologue in complex with sybody 0.8377 21 428
6uwl-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in intermediate outward-facing state 0.8338 20 417
6uwl-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in intermediate outward-facing state 0.826 20 417
6wyj-assembly1.cif.gz_A cryo-em structure of the gltph l152c-g321c mutant in the intermediate state 0.8232 28 417
ID Description Score Start End Superfamily
af_Q2G0Z4_33_460_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.8424 33 430 1.10.3860.10
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.8283 28 422 1.10.3860.10
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.8162 26 422 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.8143 29 422 1.10.3860.10
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.7945 26 422 1.10.3860.10
ID Description Score Start End GO Terms
AF-A0A0L7TF14-F1-model_v4 L-cystine transporter tcyP 0.9456 1 277 GO:0005886
GO:0015184
GO:0015293
AF-A0A3S6Q1L2-F1-model_v4 OmpW 0.9372 261 419 GO:0005886
GO:0015184
GO:0015293
AF-D0S1K7-F1-model_v4 deleted 0.9356 1 246
AF-A0A0B8P145-F1-model_v4 L-cystine uptake protein tcyP 0.9282 1 274 GO:0005886
GO:0015184
GO:0015293
AF-A0A443TRA9-F1-model_v4 deleted 0.9264 252 403

Feature Viewer

pLDDT pTM Quality
80.81 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map