F471949

General Info

Members Datasets Scaffolds Average Seq Length
643 293 1286 87

Family's Representative Sequence

Representative Sequence 3300019188|Ga0184599_128362|Ga0184599_1283621
Length 105
Sequence MAHKKGGGSSTNGRDSHGQRLGIKRFGGQLVTGGSILIRQRGTRYKAGKNVSRAKDDSLFATITGVVRFEDKGAHGKFISVFPAEESAVGGADRAASATETAAAN

Samples

Sample ID Description Type Environment
1 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
193 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
199 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
203 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
287 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
288 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
289 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 3.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 1.4
Rhizosphere 96.73
Stem 0
Stem Tuber 0
Unclassified 9.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0184599_128362 3300019188 Unclassified 696
2 Ga0058859_11623783 3300004798 Unclassified 601
3 Ga0058863_11291101 3300004799 Unclassified 606
4 Ga0058863_11972839 3300004799 Bacteria 541
5 Ga0058861_11184733 3300004800 Unclassified 599
6 Ga0058861_11927805 3300004800 Unclassified 603
7 Ga0058860_11418969 3300004801 Unclassified 609
8 Ga0058860_11478411 3300004801 Bacteria 568
9 Ga0058860_12123193 3300004801 Unclassified 627
10 Ga0058862_10054614 3300004803 Bacteria 720
11 Ga0058862_11812850 3300004803 Unclassified 599
12 Ga0065712_10027773 3300005290 Bacteria 1590
13 Ga0065712_10633417 3300005290 Bacteria 575
14 Ga0065712_10683689 3300005290 Unclassified 543
15 Ga0065715_10345745 3300005293 Unclassified 959
16 Ga0065715_10922704 3300005293 Bacteria 568
17 Ga0065715_11074355 3300005293 Bacteria 526
18 Ga0065707_10169923 3300005295 Bacteria 1492
19 Ga0065707_10996235 3300005295 Bacteria 540
20 Ga0070676_10460108 3300005328 Bacteria 896
21 Ga0070683_100222851 3300005329 Bacteria 1792
22 Ga0070690_100007160 3300005330 Bacteria 6379
23 Ga0070690_100078482 3300005330 Bacteria 2157
24 Ga0070670_100001467 3300005331 Bacteria 18976
25 Ga0070670_100261111 3300005331 Bacteria 1510
26 Ga0070670_100693804 3300005331 Bacteria 915
27 Ga0068869_100075082 3300005334 Bacteria 2511
28 Ga0068869_100108807 3300005334 Bacteria 2106
29 Ga0070666_10008793 3300005335 Bacteria 6276
30 Ga0070666_10174757 3300005335 Bacteria 1505
31 Ga0070666_10283034 3300005335 Bacteria 1179
32 Ga0070680_100230949 3300005336 Bacteria 1563
33 Ga0070680_100257459 3300005336 Bacteria 1476
34 Ga0068868_100004098 3300005338 Bacteria 10180
35 Ga0068868_101347936 3300005338 Bacteria 664
36 Ga0070689_100390535 3300005340 Unclassified 1174
37 Ga0070689_100458408 3300005340 Bacteria 1086
38 Ga0070689_100911540 3300005340 Bacteria 778
39 Ga0070689_101136897 3300005340 Bacteria 699
40 Ga0070687_100710084 3300005343 Bacteria 703
41 Ga0070692_10000981 3300005345 Bacteria 9758
42 Ga0070692_10802573 3300005345 Bacteria 643
43 Ga0070669_100082694 3300005353 Bacteria 2394
44 Ga0070669_100225597 3300005353 Bacteria 1483
45 Ga0070669_100371371 3300005353 Bacteria 1165
46 Ga0070675_100001582 3300005354 Bacteria 16807
47 Ga0070675_100002076 3300005354 Bacteria 14826
48 Ga0070675_100227904 3300005354 Bacteria 1624
49 Ga0070675_100882109 3300005354 Unclassified 819
50 Ga0070671_100004126 3300005355 Bacteria 11475
51 Ga0070671_100011288 3300005355 Bacteria 7176
52 Ga0070671_100494176 3300005355 Bacteria 1052
53 Ga0070671_100925210 3300005355 Bacteria 762
54 Ga0070674_100280202 3300005356 Bacteria 1321
55 Ga0070673_100000775 3300005364 Bacteria 17745
56 Ga0070673_100448819 3300005364 Bacteria 1160
57 Ga0070673_100759845 3300005364 Bacteria 893
58 Ga0070673_101537364 3300005364 Bacteria 628
59 Ga0070688_100132800 3300005365 Bacteria 1682
60 Ga0070688_100141587 3300005365 Unclassified 1634
61 Ga0070688_100292008 3300005365 Bacteria 1175
62 Ga0070688_100804930 3300005365 Bacteria 735
63 Ga0070667_100002609 3300005367 Bacteria 15635
64 Ga0070667_100004113 3300005367 Bacteria 12316
65 Ga0070703_10514099 3300005406 Bacteria 541
66 Ga0070709_10006473 3300005434 Bacteria 6386
67 Ga0070709_10763686 3300005434 Bacteria 756
68 Ga0070713_100024299 3300005436 Bacteria 4718
69 Ga0070713_101488924 3300005436 Unclassified 657
70 Ga0070710_10268945 3300005437 Bacteria 1102
71 Ga0070710_11068986 3300005437 Bacteria 591
72 Ga0070701_10906501 3300005438 Bacteria 609
73 Ga0070701_11345503 3300005438 Bacteria 512
74 Ga0070711_100325736 3300005439 Bacteria 1229
75 Ga0070700_101070737 3300005441 Bacteria 667
76 Ga0070694_100041931 3300005444 Bacteria 3055
77 Ga0070694_100304102 3300005444 Bacteria 1223
78 Ga0070694_100403295 3300005444 Bacteria 1071
79 Ga0070694_100691685 3300005444 Bacteria 828
80 Ga0070708_100094430 3300005445 Bacteria 2729
81 Ga0070663_101020346 3300005455 Bacteria 720
82 Ga0070678_101282050 3300005456 Bacteria 681
83 Ga0070678_101287657 3300005456 Unclassified 680
84 Ga0070681_10013013 3300005458 Bacteria 8263
85 Ga0068867_102200809 3300005459 Bacteria 523
86 Ga0070685_10056296 3300005466 Bacteria 2286
87 Ga0070685_10549429 3300005466 Bacteria 824
88 Ga0070706_101265096 3300005467 Unclassified 677
89 Ga0070707_100001300 3300005468 Bacteria 24529
90 Ga0070707_100003867 3300005468 Bacteria 14104
91 Ga0070707_100290349 3300005468 Bacteria 1589
92 Ga0070707_101822380 3300005468 Bacteria 576
93 Ga0070699_100031161 3300005518 Bacteria 4604
94 Ga0070699_101460333 3300005518 Bacteria 627
95 Ga0070699_101611174 3300005518 Bacteria 595
96 Ga0070679_100274927 3300005530 Bacteria 1638
97 Ga0070684_100101803 3300005535 Bacteria 2567
98 Ga0070684_101980482 3300005535 Bacteria 550
99 Ga0070697_100422181 3300005536 Bacteria 1159
100 Ga0070697_101495399 3300005536 Unclassified 603
101 Ga0070672_100003133 3300005543 Bacteria 10684
102 Ga0070672_100126220 3300005543 Bacteria 2099
103 Ga0070672_100155312 3300005543 Bacteria 1895
104 Ga0070672_100344473 3300005543 Bacteria 1270
105 Ga0070672_101747346 3300005543 Bacteria 559
106 Ga0070686_100077788 3300005544 Bacteria 2188
107 Ga0070686_100186617 3300005544 Bacteria 1477
108 Ga0070686_101221891 3300005544 Bacteria 625
109 Ga0070686_101324261 3300005544 Bacteria 602
110 Ga0070695_100208750 3300005545 Bacteria 1400
111 Ga0070696_100011305 3300005546 Bacteria 5978
112 Ga0070696_100391059 3300005546 Bacteria 1086
113 Ga0070696_101381348 3300005546 Unclassified 600
114 Ga0070693_100910416 3300005547 Unclassified 660
115 Ga0070665_100311061 3300005548 Bacteria 1579
116 Ga0070665_101494684 3300005548 Bacteria 684
117 Ga0070704_100162962 3300005549 Bacteria 1765
118 Ga0070704_100370892 3300005549 Bacteria 1213
119 Ga0070704_100591491 3300005549 Bacteria 974
120 Ga0070704_100863412 3300005549 Bacteria 812
121 Ga0070664_100000643 3300005564 Bacteria 26805
122 Ga0070664_100017675 3300005564 Bacteria 5855
123 Ga0068857_100072993 3300005577 Bacteria 3057
124 Ga0068857_102091795 3300005577 Unclassified 555
125 Ga0068852_102098781 3300005616 Bacteria 587
126 Ga0068859_100004173 3300005617 Bacteria 14753
127 Ga0068859_100063320 3300005617 Bacteria 3729
128 Ga0068859_100072898 3300005617 Bacteria 3471
129 Ga0068859_100084888 3300005617 Bacteria 3211
130 Ga0068859_100510315 3300005617 Bacteria 1297
131 Ga0068859_100638485 3300005617 Bacteria 1157
132 Ga0068859_100653321 3300005617 Bacteria 1144
133 Ga0068859_101480888 3300005617 Bacteria 749
134 Ga0068859_101888471 3300005617 Bacteria 659
135 Ga0068864_100000554 3300005618 Bacteria 31949
136 Ga0068864_100339217 3300005618 Bacteria 1416
137 Ga0068864_100645796 3300005618 Unclassified 1030
138 Ga0068864_101418957 3300005618 Bacteria 696
139 Ga0068866_10440454 3300005718 Bacteria 850
140 Ga0068861_100037747 3300005719 Bacteria 3592
141 Ga0068861_100378478 3300005719 Bacteria 1250
142 Ga0068861_100881423 3300005719 Bacteria 846
143 Ga0068861_101125252 3300005719 Bacteria 756
144 Ga0068861_101797004 3300005719 Bacteria 608
145 Ga0068870_10585424 3300005840 Unclassified 756
146 Ga0068870_10800054 3300005840 Unclassified 659
147 Ga0068870_11070965 3300005840 Bacteria 578
148 Ga0068863_100004506 3300005841 Bacteria 13744
149 Ga0068863_101074235 3300005841 Bacteria 809
150 Ga0068858_100003898 3300005842 Bacteria 14741
151 Ga0068858_100052304 3300005842 Bacteria 3779
152 Ga0068858_100110799 3300005842 Bacteria 2563
153 Ga0068858_100356781 3300005842 Bacteria 1401
154 Ga0068858_100445129 3300005842 Bacteria 1248
155 Ga0068860_100014398 3300005843 Bacteria 7749
156 Ga0068860_100097141 3300005843 Bacteria 2808
157 Ga0068862_100259420 3300005844 Unclassified 1586
158 Ga0068862_101099098 3300005844 Bacteria 790
159 Ga0081455_10061947 3300005937 Bacteria 3146
160 Ga0081455_10242849 3300005937 Bacteria 1322
161 Ga0070717_10035523 3300006028 Bacteria 4035
162 Ga0070716_100148247 3300006173 Bacteria 1506
163 Ga0097621_100001047 3300006237 Bacteria 19421
164 Ga0097621_100038760 3300006237 Bacteria 3824
165 Ga0097621_100415932 3300006237 Bacteria 1206
166 Ga0097621_100622205 3300006237 Unclassified 988
167 Ga0097621_100707291 3300006237 Bacteria 928
168 Ga0068871_100064500 3300006358 Bacteria 2999
169 Ga0068871_100080933 3300006358 Bacteria 2690
170 Ga0075428_100134313 3300006844 Bacteria 2690
171 Ga0075428_100138475 3300006844 Unclassified 2646
172 Ga0075428_100144390 3300006844 Bacteria 2587
173 Ga0075428_100801091 3300006844 Bacteria 1001
174 Ga0075428_100978659 3300006844 Bacteria 896
175 Ga0075428_101844576 3300006844 Bacteria 629
176 Ga0075428_102001029 3300006844 Bacteria 600
177 Ga0075428_102400689 3300006844 Bacteria 541
178 Ga0075430_100031512 3300006846 Bacteria 4501
179 Ga0075430_100742108 3300006846 Unclassified 809
180 Ga0075430_101082555 3300006846 Bacteria 660
181 Ga0075430_101201126 3300006846 Bacteria 624
182 Ga0075431_100006172 3300006847 Bacteria 11893
183 Ga0075431_100025602 3300006847 Bacteria 6048
184 Ga0075431_100046968 3300006847 Bacteria 4452
185 Ga0075431_100058227 3300006847 Unclassified 3986
186 Ga0075431_100608249 3300006847 Bacteria 1076
187 Ga0075433_10029154 3300006852 Bacteria 4699
188 Ga0075433_10165681 3300006852 Bacteria 1967
189 Ga0075433_10373552 3300006852 Bacteria 1259
190 Ga0075433_10386124 3300006852 Bacteria 1236
191 Ga0075434_100013777 3300006871 Bacteria 7710
192 Ga0075434_100090437 3300006871 Unclassified 3062
193 Ga0075434_100125574 3300006871 Bacteria 2583
194 Ga0075434_100138655 3300006871 Bacteria 2452
195 Ga0075434_100664415 3300006871 Bacteria 1060
196 Ga0075434_100802353 3300006871 Bacteria 957
197 Ga0075434_101119712 3300006871 Unclassified 800
198 Ga0075434_101861054 3300006871 Bacteria 608
199 Ga0075429_100077951 3300006880 Bacteria 2887
200 Ga0075429_100900885 3300006880 Bacteria 774
201 Ga0068865_100133662 3300006881 Bacteria 1861
202 Ga0068865_101686887 3300006881 Bacteria 571
203 Ga0075436_100120521 3300006914 Bacteria 1835
204 Ga0097620_100004173 3300006931 Bacteria 14753
205 Ga0097620_100063323 3300006931 Bacteria 3729
206 Ga0097620_100072898 3300006931 Bacteria 3471
207 Ga0097620_100084884 3300006931 Bacteria 3211
208 Ga0097620_100510307 3300006931 Bacteria 1297
209 Ga0097620_100638500 3300006931 Bacteria 1157
210 Ga0097620_100653344 3300006931 Bacteria 1144
211 Ga0097620_101480553 3300006931 Bacteria 749
212 Ga0097620_101888515 3300006931 Bacteria 659
213 Ga0075435_100010025 3300007076 Bacteria 6908
214 Ga0075435_100045897 3300007076 Bacteria 3504
215 Ga0075435_100259925 3300007076 Bacteria 1479
216 Ga0075435_101184454 3300007076 Bacteria 668
217 Ga0075435_101521879 3300007076 Bacteria 587
218 Ga0075435_101686239 3300007076 Bacteria 556
219 Ga0105240_10003958 3300009093 Bacteria 22879
220 Ga0111539_10294670 3300009094 Bacteria 1888
221 Ga0111539_11928979 3300009094 Bacteria 685
222 Ga0105245_11765959 3300009098 Bacteria 671
223 Ga0105247_10025695 3300009101 Bacteria 3554
224 Ga0114129_10001286 3300009147 Bacteria 33446
225 Ga0114129_10022464 3300009147 Bacteria 8955
226 Ga0114129_10025553 3300009147 Bacteria 8367
227 Ga0114129_10027959 3300009147 Bacteria 7986
228 Ga0114129_10061127 3300009147 Bacteria 5265
229 Ga0114129_10336053 3300009147 Bacteria 2005
230 Ga0114129_10556468 3300009147 Bacteria 1491
231 Ga0114129_10611753 3300009147 Bacteria 1410
232 Ga0114129_10646999 3300009147 Bacteria 1365
233 Ga0114129_10805313 3300009147 Bacteria 1198
234 Ga0114129_12725247 3300009147 Bacteria 589
235 Ga0105243_10553723 3300009148 Bacteria 1099
236 Ga0105243_12963676 3300009148 Bacteria 515
237 Ga0105242_10101279 3300009176 Bacteria 2441
238 Ga0105242_10250985 3300009176 Unclassified 1594
239 Ga0105242_12340140 3300009176 Bacteria 581
240 Ga0105248_10000806 3300009177 Bacteria 35108
241 Ga0105248_10016276 3300009177 Bacteria 8187
242 Ga0105248_10076236 3300009177 Bacteria 3769
243 Ga0105248_10266462 3300009177 Bacteria 1928
244 Ga0105248_10775380 3300009177 Bacteria 1082
245 Ga0105248_12855199 3300009177 Bacteria 551
246 Ga0105237_10111247 3300009545 Bacteria 2731
247 Ga0105238_10293207 3300009551 Bacteria 1609
248 Ga0105249_10299102 3300009553 Bacteria 1613
249 Ga0105249_11844844 3300009553 Bacteria 677
250 Ga0105239_10202295 3300010375 Bacteria 2225
251 Ga0105246_10467107 3300011119 Bacteria 1064
252 Ga0157374_11162128 3300013296 Bacteria 793
253 Ga0157378_10058772 3300013297 Bacteria 3429
254 Ga0157378_12275045 3300013297 Bacteria 593
255 Ga0163162_10056259 3300013306 Bacteria 3962
256 Ga0163162_10537906 3300013306 Bacteria 1297
257 Ga0163162_11888998 3300013306 Bacteria 683
258 Ga0157375_10000837 3300013308 Bacteria 26889
259 Ga0157375_10084173 3300013308 Bacteria 3228
260 Ga0157375_10106048 3300013308 Bacteria 2901
261 Ga0157375_10435868 3300013308 Bacteria 1476
262 Ga0157375_11828533 3300013308 Bacteria 720
263 Ga0157375_13807539 3300013308 Bacteria 501
264 Ga0163163_10016728 3300014325 Bacteria 6822
265 Ga0163163_10097814 3300014325 Bacteria 2955
266 Ga0163163_10400903 3300014325 Bacteria 1430
267 Ga0163163_10635044 3300014325 Bacteria 1131
268 Ga0163163_10727353 3300014325 Unclassified 1056
269 Ga0163163_10841006 3300014325 Bacteria 981
270 Ga0157380_10039465 3300014326 Bacteria 3672
271 Ga0157380_10048947 3300014326 Bacteria 3332
272 Ga0157380_10154005 3300014326 Bacteria 1990
273 Ga0157380_10308808 3300014326 Bacteria 1460
274 Ga0157380_10422437 3300014326 Bacteria 1272
275 Ga0157380_10667941 3300014326 Bacteria 1039
276 Ga0157380_11370859 3300014326 Bacteria 757
277 Ga0157379_10000708 3300014968 Bacteria 27005
278 Ga0157376_10200250 3300014969 Bacteria 1837
279 Ga0157376_11883589 3300014969 Bacteria 635
280 Ga0163161_10402103 3300017792 Bacteria 1098
281 Ga0213871_10302349 3300021441 Unclassified 517
282 Ga0224572_1011936 3300024225 Bacteria 1646
283 Ga0228598_1000582 3300024227 Bacteria 7658
284 Ga0207692_10225834 3300025898 Bacteria 1112
285 Ga0207688_10589367 3300025901 Bacteria 700
286 Ga0207680_10026420 3300025903 Bacteria 3219
287 Ga0207680_10237128 3300025903 Bacteria 1256
288 Ga0207680_10256750 3300025903 Bacteria 1209
289 Ga0207645_10254384 3300025907 Bacteria 1163
290 Ga0207643_10362405 3300025908 Unclassified 911
291 Ga0207684_11250615 3300025910 Unclassified 613
292 Ga0207707_10090252 3300025912 Bacteria 2678
293 Ga0207695_10477644 3300025913 Bacteria 1129
294 Ga0207671_10378845 3300025914 Bacteria 1124
295 Ga0207693_10388169 3300025915 Bacteria 1092
296 Ga0207660_10106147 3300025917 Bacteria 2106
297 Ga0207660_10423863 3300025917 Bacteria 1074
298 Ga0207660_10972610 3300025917 Bacteria 692
299 Ga0207662_10280063 3300025918 Bacteria 1103
300 Ga0207662_11000655 3300025918 Bacteria 593
301 Ga0207649_10002490 3300025920 Bacteria 10291
302 Ga0207646_10005008 3300025922 Bacteria 14119
303 Ga0207646_10007241 3300025922 Bacteria 11315
304 Ga0207646_10125069 3300025922 Bacteria 2312
305 Ga0207646_10294040 3300025922 Bacteria 1467
306 Ga0207681_10068148 3300025923 Bacteria 2470
307 Ga0207681_10160467 3300025923 Bacteria 1694
308 Ga0207681_10225812 3300025923 Bacteria 1451
309 Ga0207650_10001987 3300025925 Bacteria 14341
310 Ga0207650_10221167 3300025925 Bacteria 1524
311 Ga0207659_10000323 3300025926 Bacteria 28799
312 Ga0207659_10067125 3300025926 Bacteria 2605
313 Ga0207659_10145697 3300025926 Bacteria 1844
314 Ga0207700_10364635 3300025928 Bacteria 1260
315 Ga0207700_10801065 3300025928 Bacteria 843
316 Ga0207700_11083519 3300025928 Bacteria 716
317 Ga0207664_10740392 3300025929 Unclassified 884
318 Ga0207644_10004568 3300025931 Bacteria 9000
319 Ga0207644_10054986 3300025931 Bacteria 2868
320 Ga0207644_10720618 3300025931 Bacteria 832
321 Ga0207644_11866919 3300025931 Bacteria 502
322 Ga0207686_10103503 3300025934 Bacteria 1905
323 Ga0207686_10916555 3300025934 Bacteria 708
324 Ga0207709_10794606 3300025935 Bacteria 763
325 Ga0207709_11865561 3300025935 Bacteria 500
326 Ga0207670_10406431 3300025936 Bacteria 1090
327 Ga0207670_10513949 3300025936 Bacteria 974
328 Ga0207670_10880395 3300025936 Bacteria 749
329 Ga0207669_10204177 3300025937 Bacteria 1437
330 Ga0207704_10297970 3300025938 Bacteria 1234
331 Ga0207704_10468007 3300025938 Bacteria 1009
332 Ga0207665_10044883 3300025939 Bacteria 2958
333 Ga0207691_10004765 3300025940 Bacteria 13120
334 Ga0207691_10007718 3300025940 Bacteria 10354
335 Ga0207691_10472507 3300025940 Bacteria 1066
336 Ga0207691_10951663 3300025940 Bacteria 718
337 Ga0207691_11710272 3300025940 Unclassified 509
338 Ga0207711_10241531 3300025941 Bacteria 1656
339 Ga0207711_10497570 3300025941 Bacteria 1136
340 Ga0207711_10528521 3300025941 Bacteria 1100
341 Ga0207711_10622425 3300025941 Bacteria 1007
342 Ga0207689_10118819 3300025942 Bacteria 2174
343 Ga0207689_10122087 3300025942 Bacteria 2142
344 Ga0207689_10832015 3300025942 Bacteria 779
345 Ga0207679_10008137 3300025945 Bacteria 6671
346 Ga0207679_10098441 3300025945 Bacteria 2281
347 Ga0207651_10000704 3300025960 Bacteria 14338
348 Ga0207651_10004611 3300025960 Bacteria 6978
349 Ga0207651_10572132 3300025960 Bacteria 985
350 Ga0207651_10660376 3300025960 Bacteria 918
351 Ga0207712_10458500 3300025961 Bacteria 1082
352 Ga0207712_12057297 3300025961 Bacteria 511
353 Ga0207668_10450439 3300025972 Bacteria 1098
354 Ga0207658_10015390 3300025986 Bacteria 5247
355 Ga0207658_10019811 3300025986 Bacteria 4655
356 Ga0207658_11311134 3300025986 Bacteria 662
357 Ga0207677_10004849 3300026023 Bacteria 7260
358 Ga0207677_10277019 3300026023 Bacteria 1375
359 Ga0207703_10013681 3300026035 Bacteria 6323
360 Ga0207703_10184534 3300026035 Bacteria 1843
361 Ga0207703_11858751 3300026035 Bacteria 578
362 Ga0207708_10586634 3300026075 Bacteria 943
363 Ga0207708_10657661 3300026075 Bacteria 892
364 Ga0207708_11861919 3300026075 Unclassified 527
365 Ga0207641_10002281 3300026088 Bacteria 17876
366 Ga0207641_10320543 3300026088 Bacteria 1469
367 Ga0207641_11050192 3300026088 Bacteria 812
368 Ga0207641_11213117 3300026088 Bacteria 754
369 Ga0207648_10137148 3300026089 Bacteria 2155
370 Ga0207676_10009465 3300026095 Bacteria 6936
371 Ga0207676_10646220 3300026095 Bacteria 1020
372 Ga0207676_11230707 3300026095 Bacteria 742
373 Ga0207676_11408056 3300026095 Bacteria 693
374 Ga0207674_10128186 3300026116 Bacteria 2502
375 Ga0207675_100022185 3300026118 Bacteria 5912
376 Ga0207675_100174946 3300026118 Bacteria 2053
377 Ga0207675_100681787 3300026118 Bacteria 1035
378 Ga0207675_100810504 3300026118 Bacteria 950
379 Ga0207675_101231515 3300026118 Bacteria 769
380 Ga0207683_10110496 3300026121 Bacteria 2461
381 Ga0207698_12559844 3300026142 Bacteria 520
382 Ga0209983_1154066 3300027665 Bacteria 527
383 Ga0268266_10177748 3300028379 Bacteria 1936
384 Ga0268266_10424867 3300028379 Bacteria 1260
385 Ga0268266_10480647 3300028379 Bacteria 1184
386 Ga0268265_10197522 3300028380 Bacteria 1742
387 Ga0268265_12423327 3300028380 Bacteria 531
388 Ga0268264_10077876 3300028381 Bacteria 2825
389 Ga0268264_10820348 3300028381 Bacteria 930
390 Ga0268264_11475727 3300028381 Bacteria 691
391 Ga0268264_11962750 3300028381 Bacteria 595
392 Ga0268264_12262243 3300028381 Bacteria 551
393 Ga0265338_10003821 3300028800 Bacteria 20923
394 Ga0265762_1008804 3300030760 Bacteria 1795
395 Ga0265770_1021667 3300030878 Bacteria 1023
396 Ga0265773_1044621 3300031018 Unclassified 517
397 Ga0265760_10000015 3300031090 Bacteria 91316
398 Ga0265760_10001764 3300031090 Bacteria 6365
399 Ga0265325_10003819 3300031241 Bacteria 9702
400 Ga0265325_10051522 3300031241 Bacteria 2116
401 Ga0265316_10097117 3300031344 Bacteria 2243
402 Ga0307408_101421821 3300031548 Bacteria 654
403 Ga0265313_10117415 3300031595 Bacteria 1164
404 Ga0265314_10695807 3300031711 Bacteria 514
405 Ga0307410_10827267 3300031852 Bacteria 789
406 Ga0307410_11367679 3300031852 Bacteria 621
407 Ga0307410_11788604 3300031852 Bacteria 546
408 Ga0307407_10316473 3300031903 Bacteria 1094
409 Ga0307409_100884465 3300031995 Bacteria 906
410 Ga0307409_101340792 3300031995 Bacteria 741
411 Ga0307409_102243214 3300031995 Bacteria 575
412 Ga0307411_10618364 3300032005 Bacteria 934
413 Ga0307411_10857244 3300032005 Bacteria 804
414 Ga0316053_105271 3300032120 Bacteria 816
415 Ga0307415_100052208 3300032126 Unclassified 2779
416 Ga0373944_0394478 3300035089 Bacteria 533
417 Ga0373949_0309821 3300035090 Unclassified 503
418 Ga0373923_0020431 3300035111 Bacteria 2573
419 Ga0373923_0042895 3300035111 Bacteria 1870
420 Ga0373936_0174007 3300035113 Bacteria 942
421 Ga0373936_0307483 3300035113 Bacteria 716
422 Ga0373953_0244522 3300035117 Bacteria 779
423 Ga0373953_0376145 3300035117 Unclassified 624
424 Ga0373954_0054245 3300035118 Bacteria 1885
425 Ga0373954_0089955 3300035118 Bacteria 1474
426 Ga0373954_0353556 3300035118 Bacteria 726
427 Ga0373956_0592889 3300035119 Unclassified 529
428 Ga0373956_0598202 3300035119 Unclassified 526
429 Ga0373957_0032949 3300035120 Bacteria 1911
430 Ga0373943_0021210 3300035170 Bacteria 2998
431 Ga0373946_0128876 3300035171 Bacteria 1162
432 Ga0373955_0018943 3300035172 Bacteria 3433
433 Ga0373955_0263839 3300035172 Bacteria 1034
434 Ga0373961_0378932 3300035241 Bacteria 539
435 Ga0373924_0042878 3300035410 Bacteria 1857
436 Ga0373924_0252800 3300035410 Bacteria 780
437 Ga0373931_0094661 3300035691 Bacteria 1670
438 Ga0373931_0406116 3300035691 Bacteria 863
439 Ga0373935_0007842 3300035692 Bacteria 6403
440 Ga0373935_0073158 3300035692 Bacteria 2214
441 Ga0373933_0823212 3300035724 Bacteria 611
442 Ga0373947_0556603 3300035725 Bacteria 781
443 Ga0373937_0028898 3300036401 Bacteria 5021
444 Ga0373937_0037224 3300036401 Bacteria 4434
445 Ga0373937_0332777 3300036401 Bacteria 1437
446 Ga0373937_0374031 3300036401 Unclassified 1351
447 Ga0373937_0569532 3300036401 Bacteria 1076
448 Ga0373925_0055565 3300037068 Bacteria 2964
449 Ga0373925_0220114 3300037068 Bacteria 1515
450 Ga0436360_0513297 3300039438 Unclassified 919
451 Ga0436360_1023055 3300039438 Bacteria 870
452 Ga0436362_0103411 3300039453 Bacteria 788
453 Ga0451791_0710523 3300041451 Bacteria 1068
454 Ga0451793_1878183 3300041452 Bacteria 666
455 Ga0451800_1564513 3300041459 Bacteria 1264
456 Ga0451802_1065277 3300041460 Bacteria 992
457 Ga0451804_1061323 3300041463 Bacteria 755
458 Ga0451807_2478126 3300041486 Bacteria 712
459 Ga0451845_0605748 3300041501 Bacteria 849
460 Ga0451849_0835551 3300041505 Bacteria 561
461 Ga0451853_2280574 3300041512 Bacteria 963
462 Ga0439448_0036098 3300042005 Bacteria 1585
463 Ga0450911_037225 3300042115 Bacteria 631
464 Ga0450914_036633 3300042118 Bacteria 610
465 Ga0439446_0353976 3300042156 Bacteria 524
466 Ga0451577_1125003 3300042876 Bacteria 702
467 Ga0451576_0856260 3300045051 Bacteria 954
468 Ga0451576_2253198 3300045051 Bacteria 559
469 Ga0495592_0021158 3300046454 Bacteria 4947
470 Ga0495592_0541139 3300046454 Bacteria 717
471 Ga0495638_0008690 3300046460 Bacteria 7182
472 Ga0495650_0000037 3300046471 Bacteria 390090
473 Ga0495580_0287310 3300046472 Bacteria 1121
474 Ga0495582_0414344 3300046473 Unclassified 777
475 Ga0495662_0175796 3300046476 Bacteria 1055
476 Ga0495664_0181567 3300046477 Unclassified 1276
477 Ga0495583_0146573 3300046506 Bacteria 980
478 Ga0495608_0025698 3300046511 Bacteria 4020
479 Ga0495618_0155650 3300046514 Bacteria 1459
480 Ga0495618_0241939 3300046514 Unclassified 1134
481 Ga0495628_0584115 3300046516 Bacteria 799
482 Ga0495630_0372992 3300046517 Bacteria 1093
483 Ga0495630_0567632 3300046517 Bacteria 870
484 Ga0495630_1115948 3300046517 Unclassified 598
485 Ga0495630_1495747 3300046517 Bacteria 507
486 Ga0495665_0566936 3300046531 Bacteria 569
487 Ga0495640_0073729 3300046533 Bacteria 2285
488 Ga0495586_0022108 3300046535 Bacteria 3394
489 Ga0495587_0632449 3300046536 Bacteria 588
490 Ga0495667_0002884 3300046559 Bacteria 11524
491 Ga0495634_0124840 3300046642 Bacteria 1646
492 Ga0495625_0053613 3300046660 Bacteria 2883
493 Ga0495635_0272997 3300046663 Bacteria 1137
494 Ga0495659_0081905 3300046664 Bacteria 1226
495 Ga0495657_0001995 3300046675 Bacteria 17394
496 Ga0495599_0180381 3300046678 Bacteria 1302
497 Ga0495599_0370456 3300046678 Bacteria 856
498 Ga0495647_0003999 3300046681 Bacteria 4759
499 Ga0495647_0481252 3300046681 Unclassified 577
500 Ga0495658_0045719 3300046683 Bacteria 2458
501 Ga0495658_0047792 3300046683 Bacteria 2411
502 Ga0495613_0076349 3300046689 Bacteria 2438
503 Ga0495613_0444459 3300046689 Unclassified 879
504 Ga0495581_0323535 3300047315 Unclassified 901
505 Ga0495581_0560099 3300047315 Unclassified 663
506 Ga0495636_0006034 3300047318 Bacteria 4754
507 Ga0495636_0533090 3300047318 Bacteria 570
508 Ga0495680_0663511 3300047322 Bacteria 692
509 Ga0495684_0043196 3300047471 Unclassified 3451
510 Ga0495614_0671209 3300048089 Unclassified 501
511 Ga0496100_0789554 3300048903 Bacteria 744
512 Ga0496109_1082043 3300048912 Bacteria 739
513 Ga0496110_0385176 3300048913 Bacteria 1278
514 Ga0501304_025137 3300049160 Bacteria 609
515 Ga0495682_0039567 3300049460 Bacteria 1731
516 Ga0501314_023627 3300049530 Bacteria 653
517 Ga0501317_040690 3300049533 Bacteria 708
518 Ga0501031_0229070 3300049568 Bacteria 1209
519 Ga0501031_1010355 3300049568 Bacteria 531
520 Ga0501032_0034922 3300049569 Bacteria 3438
521 Ga0501032_0071594 3300049569 Bacteria 2310
522 Ga0501032_0300556 3300049569 Bacteria 1037
523 Ga0501033_0039202 3300049570 Bacteria 3539
524 Ga0501033_0663180 3300049570 Bacteria 712
525 Ga0501034_0014212 3300049571 Bacteria 8205
526 Ga0501034_0044439 3300049571 Bacteria 4493
527 Ga0501034_0233722 3300049571 Bacteria 1786
528 Ga0501036_0028328 3300049572 Bacteria 4733
529 Ga0501036_0761317 3300049572 Bacteria 798
530 Ga0501037_0073473 3300049573 Bacteria 2486
531 Ga0501037_0959569 3300049573 Bacteria 558
532 Ga0501038_0018656 3300049574 Bacteria 6265
533 Ga0501038_0121765 3300049574 Bacteria 2150
534 Ga0501038_0299939 3300049574 Bacteria 1261
535 Ga0501039_0079850 3300049575 Bacteria 2545
536 Ga0501040_0976250 3300049576 Bacteria 614
537 Ga0501042_0672859 3300049578 Bacteria 752
538 Ga0501043_0037262 3300049579 Bacteria 3824
539 Ga0501043_0151539 3300049579 Bacteria 1814
540 Ga0501046_0076230 3300049580 Bacteria 2598
541 Ga0501047_0001442 3300049581 Bacteria 23283
542 Ga0501047_0013507 3300049581 Bacteria 7741
543 Ga0501047_0032822 3300049581 Bacteria 5012
544 Ga0501047_0419577 3300049581 Bacteria 1169
545 Ga0501048_0074592 3300049582 Bacteria 2393
546 Ga0501048_0170822 3300049582 Bacteria 1540
547 Ga0501048_0319227 3300049582 Bacteria 1106
548 Ga0501067_0006276 3300049583 Bacteria 6595
549 Ga0501067_0079639 3300049583 Bacteria 1815
550 Ga0501067_0192676 3300049583 Bacteria 1135
551 Ga0501068_0005719 3300049584 Bacteria 6813
552 Ga0501068_0034129 3300049584 Bacteria 3033
553 Ga0501068_0354592 3300049584 Bacteria 943
554 Ga0501068_1120881 3300049584 Bacteria 520
555 Ga0501069_0042887 3300049585 Bacteria 2503
556 Ga0501070_0121533 3300049586 Bacteria 2158
557 Ga0501070_0441021 3300049586 Bacteria 1050
558 Ga0501071_0119816 3300049587 Bacteria 1950
559 Ga0501072_0225478 3300049588 Bacteria 1493
560 Ga0501072_0536477 3300049588 Bacteria 924
561 Ga0501072_0847780 3300049588 Bacteria 715
562 Ga0501073_0050130 3300049589 Bacteria 2926
563 Ga0501073_0183928 3300049589 Bacteria 1446
564 Ga0501073_0956214 3300049589 Bacteria 589
565 Ga0501074_0146844 3300049590 Bacteria 1686
566 Ga0501076_0033321 3300049592 Bacteria 4022
567 Ga0501076_0241377 3300049592 Bacteria 1478
568 Ga0501077_0353519 3300049593 Bacteria 938
569 Ga0501077_0471745 3300049593 Bacteria 804
570 Ga0501079_0214080 3300049741 Bacteria 1505
571 Ga0501079_0381656 3300049741 Bacteria 1105
572 Ga0501079_1008742 3300049741 Bacteria 656
573 Ga0501080_0008092 3300049742 Bacteria 9527
574 Ga0501080_0193134 3300049742 Bacteria 1870
575 Ga0501080_0230771 3300049742 Bacteria 1692
576 Ga0501080_0360477 3300049742 Bacteria 1312
577 Ga0501080_0420745 3300049742 Bacteria 1200
578 Ga0501080_0608478 3300049742 Bacteria 969
579 Ga0501081_0113849 3300049743 Bacteria 1921
580 Ga0501081_0248489 3300049743 Unclassified 1298
581 Ga0501081_0434432 3300049743 Bacteria 974
582 Ga0501083_0019469 3300049744 Bacteria 4728
583 Ga0501083_0038089 3300049744 Bacteria 3269
584 Ga0501083_0159104 3300049744 Bacteria 1478
585 Ga0501035_0222873 3300049822 Bacteria 1609
586 Ga0501035_0597196 3300049822 Bacteria 900
587 Ga0501044_0087754 3300049823 Bacteria 3141
588 Ga0501045_0283442 3300049824 Bacteria 1233
589 Ga0501045_0904991 3300049824 Bacteria 648
590 Ga0501045_1066858 3300049824 Bacteria 591
591 Ga0501045_1324544 3300049824 Bacteria 524
592 nmdc:mga05p37_155100_c1 3300050507 Bacteria 2799
593 nmdc:mga05p37_1916888_c1 3300050507 Bacteria 565
594 nmdc:mga05p37_2409_c1 3300050507 Bacteria 21760
595 nmdc:mga05p37_25497_c1 3300050507 Bacteria 7191
596 nmdc:mga05p37_268194_c1 3300050507 Bacteria 2041
597 nmdc:mga05p37_36822_c1 3300050507 Bacteria 6001
598 nmdc:mga05p37_520113_c1 3300050507 Bacteria 1361
599 nmdc:mga05p37_79122_c1 3300050507 Bacteria 4048
600 nmdc:mga05p37_84505_c2 3300050507 Bacteria 1432
601 nmdc:mga09592_106560_c1 3300050508 Bacteria 2404
602 nmdc:mga09592_1709378_c1 3300050508 Bacteria 507
603 nmdc:mga09592_186534_c1 3300050508 Bacteria 1795
604 nmdc:mga0qj67_310504_c1 3300050509 Bacteria 1277
605 nmdc:mga06r32_158705_c1 3300050510 Unclassified 2244
606 nmdc:mga06r32_33231_c1 3300050510 Bacteria 4858
607 nmdc:mga06r32_914842_c1 3300050510 Bacteria 833
608 nmdc:mga06r32_92806_c1 3300050510 Bacteria 2952
609 nmdc:mga06r32_96759_c1 3300050510 Bacteria 2598
610 nmdc:mga06r32_99333_c1 3300050510 Bacteria 2854
611 nmdc:mga08y16_1186746_c1 3300050511 Bacteria 734
612 nmdc:mga08y16_4500_c1 3300050511 Bacteria 14559
613 nmdc:mga08y16_643503_c1 3300050511 Bacteria 1065
614 nmdc:mga0n895_158332_c1 3300050512 Unclassified 2296
615 nmdc:mga0n895_350582_c1 3300050512 Bacteria 1495
616 nmdc:mga0n895_36272_c1 3300050512 Bacteria 4761
617 nmdc:mga0n895_74077_c1 3300050512 Bacteria 3381
618 nmdc:mga0n895_823088_c1 3300050512 Bacteria 918
619 nmdc:mga0rr50_11448_c1 3300050513 Bacteria 5680
620 nmdc:mga0rr50_1388636_c1 3300050513 Bacteria 595
621 nmdc:mga0rr50_1784327_c1 3300050513 Bacteria 518
622 nmdc:mga0rr50_52226_c1 3300050513 Bacteria 3036
623 nmdc:mga08x19_382463_c1 3300050514 Bacteria 986
624 nmdc:mga0a205_1644_c1 3300050515 Bacteria 19206
625 nmdc:mga0a205_38880_c1 3300050515 Bacteria 4578
626 nmdc:mga0a205_579317_c1 3300050515 Bacteria 976
627 nmdc:mga0a205_615447_c1 3300050515 Bacteria 939
628 Ga0495619_0028240 3300053085 Bacteria 3619
629 Ga0500651_0114883 3300053093 Bacteria 1640
630 Ga0500641_0000556 3300053096 Bacteria 13482
631 Ga0500592_023353 3300053116 Bacteria 997
632 Ga0500592_027658 3300053116 Bacteria 915
633 Ga0500599_001889 3300053736 Bacteria 2474
634 Ga0501084_0012237 3300054114 Bacteria 7103
635 Ga0501084_0078680 3300054114 Bacteria 2764
636 Ga0501084_0612856 3300054114 Bacteria 919
637 Ga0587084_152335 3300059477 Unclassified 509
638 Ga0501082_0047101 3300060353 Bacteria 3715
639 Ga0501082_0057205 3300060353 Bacteria 3360
640 Ga0501082_0063973 3300060353 Bacteria 3167
641 Ga0501082_0240733 3300060353 Bacteria 1574
642 Ga0530510_0279715 3300061734 Bacteria 1246
643 Ga0530510_0470712 3300061734 Bacteria 951
644 Ga0184599_128362
645 Ga0058859_11623783
646 Ga0058863_11291101
647 Ga0058863_11972839
648 Ga0058861_11184733
649 Ga0058861_11927805
650 Ga0058860_11418969
651 Ga0058860_11478411
652 Ga0058860_12123193
653 Ga0058862_10054614
654 Ga0058862_11812850
655 Ga0065712_10027773
656 Ga0065712_10633417
657 Ga0065712_10683689
658 Ga0065715_10345745
659 Ga0065715_10922704
660 Ga0065715_11074355
661 Ga0065707_10169923
662 Ga0065707_10996235
663 Ga0070676_10460108
664 Ga0070683_100222851
665 Ga0070690_100007160
666 Ga0070690_100078482
667 Ga0070670_100001467
668 Ga0070670_100261111
669 Ga0070670_100693804
670 Ga0068869_100075082
671 Ga0068869_100108807
672 Ga0070666_10008793
673 Ga0070666_10174757
674 Ga0070666_10283034
675 Ga0070680_100230949
676 Ga0070680_100257459
677 Ga0068868_100004098
678 Ga0068868_101347936
679 Ga0070689_100390535
680 Ga0070689_100458408
681 Ga0070689_100911540
682 Ga0070689_101136897
683 Ga0070687_100710084
684 Ga0070692_10000981
685 Ga0070692_10802573
686 Ga0070669_100082694
687 Ga0070669_100225597
688 Ga0070669_100371371
689 Ga0070675_100001582
690 Ga0070675_100002076
691 Ga0070675_100227904
692 Ga0070675_100882109
693 Ga0070671_100004126
694 Ga0070671_100011288
695 Ga0070671_100494176
696 Ga0070671_100925210
697 Ga0070674_100280202
698 Ga0070673_100000775
699 Ga0070673_100448819
700 Ga0070673_100759845
701 Ga0070673_101537364
702 Ga0070688_100132800
703 Ga0070688_100141587
704 Ga0070688_100292008
705 Ga0070688_100804930
706 Ga0070667_100002609
707 Ga0070667_100004113
708 Ga0070703_10514099
709 Ga0070709_10006473
710 Ga0070709_10763686
711 Ga0070713_100024299
712 Ga0070713_101488924
713 Ga0070710_10268945
714 Ga0070710_11068986
715 Ga0070701_10906501
716 Ga0070701_11345503
717 Ga0070711_100325736
718 Ga0070700_101070737
719 Ga0070694_100041931
720 Ga0070694_100304102
721 Ga0070694_100403295
722 Ga0070694_100691685
723 Ga0070708_100094430
724 Ga0070663_101020346
725 Ga0070678_101282050
726 Ga0070678_101287657
727 Ga0070681_10013013
728 Ga0068867_102200809
729 Ga0070685_10056296
730 Ga0070685_10549429
731 Ga0070706_101265096
732 Ga0070707_100001300
733 Ga0070707_100003867
734 Ga0070707_100290349
735 Ga0070707_101822380
736 Ga0070699_100031161
737 Ga0070699_101460333
738 Ga0070699_101611174
739 Ga0070679_100274927
740 Ga0070684_100101803
741 Ga0070684_101980482
742 Ga0070697_100422181
743 Ga0070697_101495399
744 Ga0070672_100003133
745 Ga0070672_100126220
746 Ga0070672_100155312
747 Ga0070672_100344473
748 Ga0070672_101747346
749 Ga0070686_100077788
750 Ga0070686_100186617
751 Ga0070686_101221891
752 Ga0070686_101324261
753 Ga0070695_100208750
754 Ga0070696_100011305
755 Ga0070696_100391059
756 Ga0070696_101381348
757 Ga0070693_100910416
758 Ga0070665_100311061
759 Ga0070665_101494684
760 Ga0070704_100162962
761 Ga0070704_100370892
762 Ga0070704_100591491
763 Ga0070704_100863412
764 Ga0070664_100000643
765 Ga0070664_100017675
766 Ga0068857_100072993
767 Ga0068857_102091795
768 Ga0068852_102098781
769 Ga0068859_100004173
770 Ga0068859_100063320
771 Ga0068859_100072898
772 Ga0068859_100084888
773 Ga0068859_100510315
774 Ga0068859_100638485
775 Ga0068859_100653321
776 Ga0068859_101480888
777 Ga0068859_101888471
778 Ga0068864_100000554
779 Ga0068864_100339217
780 Ga0068864_100645796
781 Ga0068864_101418957
782 Ga0068866_10440454
783 Ga0068861_100037747
784 Ga0068861_100378478
785 Ga0068861_100881423
786 Ga0068861_101125252
787 Ga0068861_101797004
788 Ga0068870_10585424
789 Ga0068870_10800054
790 Ga0068870_11070965
791 Ga0068863_100004506
792 Ga0068863_101074235
793 Ga0068858_100003898
794 Ga0068858_100052304
795 Ga0068858_100110799
796 Ga0068858_100356781
797 Ga0068858_100445129
798 Ga0068860_100014398
799 Ga0068860_100097141
800 Ga0068862_100259420
801 Ga0068862_101099098
802 Ga0081455_10061947
803 Ga0081455_10242849
804 Ga0070717_10035523
805 Ga0070716_100148247
806 Ga0097621_100001047
807 Ga0097621_100038760
808 Ga0097621_100415932
809 Ga0097621_100622205
810 Ga0097621_100707291
811 Ga0068871_100064500
812 Ga0068871_100080933
813 Ga0075428_100134313
814 Ga0075428_100138475
815 Ga0075428_100144390
816 Ga0075428_100801091
817 Ga0075428_100978659
818 Ga0075428_101844576
819 Ga0075428_102001029
820 Ga0075428_102400689
821 Ga0075430_100031512
822 Ga0075430_100742108
823 Ga0075430_101082555
824 Ga0075430_101201126
825 Ga0075431_100006172
826 Ga0075431_100025602
827 Ga0075431_100046968
828 Ga0075431_100058227
829 Ga0075431_100608249
830 Ga0075433_10029154
831 Ga0075433_10165681
832 Ga0075433_10373552
833 Ga0075433_10386124
834 Ga0075434_100013777
835 Ga0075434_100090437
836 Ga0075434_100125574
837 Ga0075434_100138655
838 Ga0075434_100664415
839 Ga0075434_100802353
840 Ga0075434_101119712
841 Ga0075434_101861054
842 Ga0075429_100077951
843 Ga0075429_100900885
844 Ga0068865_100133662
845 Ga0068865_101686887
846 Ga0075436_100120521
847 Ga0097620_100004173
848 Ga0097620_100063323
849 Ga0097620_100072898
850 Ga0097620_100084884
851 Ga0097620_100510307
852 Ga0097620_100638500
853 Ga0097620_100653344
854 Ga0097620_101480553
855 Ga0097620_101888515
856 Ga0075435_100010025
857 Ga0075435_100045897
858 Ga0075435_100259925
859 Ga0075435_101184454
860 Ga0075435_101521879
861 Ga0075435_101686239
862 Ga0105240_10003958
863 Ga0111539_10294670
864 Ga0111539_11928979
865 Ga0105245_11765959
866 Ga0105247_10025695
867 Ga0114129_10001286
868 Ga0114129_10022464
869 Ga0114129_10025553
870 Ga0114129_10027959
871 Ga0114129_10061127
872 Ga0114129_10336053
873 Ga0114129_10556468
874 Ga0114129_10611753
875 Ga0114129_10646999
876 Ga0114129_10805313
877 Ga0114129_12725247
878 Ga0105243_10553723
879 Ga0105243_12963676
880 Ga0105242_10101279
881 Ga0105242_10250985
882 Ga0105242_12340140
883 Ga0105248_10000806
884 Ga0105248_10016276
885 Ga0105248_10076236
886 Ga0105248_10266462
887 Ga0105248_10775380
888 Ga0105248_12855199
889 Ga0105237_10111247
890 Ga0105238_10293207
891 Ga0105249_10299102
892 Ga0105249_11844844
893 Ga0105239_10202295
894 Ga0105246_10467107
895 Ga0157374_11162128
896 Ga0157378_10058772
897 Ga0157378_12275045
898 Ga0163162_10056259
899 Ga0163162_10537906
900 Ga0163162_11888998
901 Ga0157375_10000837
902 Ga0157375_10084173
903 Ga0157375_10106048
904 Ga0157375_10435868
905 Ga0157375_11828533
906 Ga0157375_13807539
907 Ga0163163_10016728
908 Ga0163163_10097814
909 Ga0163163_10400903
910 Ga0163163_10635044
911 Ga0163163_10727353
912 Ga0163163_10841006
913 Ga0157380_10039465
914 Ga0157380_10048947
915 Ga0157380_10154005
916 Ga0157380_10308808
917 Ga0157380_10422437
918 Ga0157380_10667941
919 Ga0157380_11370859
920 Ga0157379_10000708
921 Ga0157376_10200250
922 Ga0157376_11883589
923 Ga0163161_10402103
924 Ga0213871_10302349
925 Ga0224572_1011936
926 Ga0228598_1000582
927 Ga0207692_10225834
928 Ga0207688_10589367
929 Ga0207680_10026420
930 Ga0207680_10237128
931 Ga0207680_10256750
932 Ga0207645_10254384
933 Ga0207643_10362405
934 Ga0207684_11250615
935 Ga0207707_10090252
936 Ga0207695_10477644
937 Ga0207671_10378845
938 Ga0207693_10388169
939 Ga0207660_10106147
940 Ga0207660_10423863
941 Ga0207660_10972610
942 Ga0207662_10280063
943 Ga0207662_11000655
944 Ga0207649_10002490
945 Ga0207646_10005008
946 Ga0207646_10007241
947 Ga0207646_10125069
948 Ga0207646_10294040
949 Ga0207681_10068148
950 Ga0207681_10160467
951 Ga0207681_10225812
952 Ga0207650_10001987
953 Ga0207650_10221167
954 Ga0207659_10000323
955 Ga0207659_10067125
956 Ga0207659_10145697
957 Ga0207700_10364635
958 Ga0207700_10801065
959 Ga0207700_11083519
960 Ga0207664_10740392
961 Ga0207644_10004568
962 Ga0207644_10054986
963 Ga0207644_10720618
964 Ga0207644_11866919
965 Ga0207686_10103503
966 Ga0207686_10916555
967 Ga0207709_10794606
968 Ga0207709_11865561
969 Ga0207670_10406431
970 Ga0207670_10513949
971 Ga0207670_10880395
972 Ga0207669_10204177
973 Ga0207704_10297970
974 Ga0207704_10468007
975 Ga0207665_10044883
976 Ga0207691_10004765
977 Ga0207691_10007718
978 Ga0207691_10472507
979 Ga0207691_10951663
980 Ga0207691_11710272
981 Ga0207711_10241531
982 Ga0207711_10497570
983 Ga0207711_10528521
984 Ga0207711_10622425
985 Ga0207689_10118819
986 Ga0207689_10122087
987 Ga0207689_10832015
988 Ga0207679_10008137
989 Ga0207679_10098441
990 Ga0207651_10000704
991 Ga0207651_10004611
992 Ga0207651_10572132
993 Ga0207651_10660376
994 Ga0207712_10458500
995 Ga0207712_12057297
996 Ga0207668_10450439
997 Ga0207658_10015390
998 Ga0207658_10019811
999 Ga0207658_11311134
1000 Ga0207677_10004849
1001 Ga0207677_10277019
1002 Ga0207703_10013681
1003 Ga0207703_10184534
1004 Ga0207703_11858751
1005 Ga0207708_10586634
1006 Ga0207708_10657661
1007 Ga0207708_11861919
1008 Ga0207641_10002281
1009 Ga0207641_10320543
1010 Ga0207641_11050192
1011 Ga0207641_11213117
1012 Ga0207648_10137148
1013 Ga0207676_10009465
1014 Ga0207676_10646220
1015 Ga0207676_11230707
1016 Ga0207676_11408056
1017 Ga0207674_10128186
1018 Ga0207675_100022185
1019 Ga0207675_100174946
1020 Ga0207675_100681787
1021 Ga0207675_100810504
1022 Ga0207675_101231515
1023 Ga0207683_10110496
1024 Ga0207698_12559844
1025 Ga0209983_1154066
1026 Ga0268266_10177748
1027 Ga0268266_10424867
1028 Ga0268266_10480647
1029 Ga0268265_10197522
1030 Ga0268265_12423327
1031 Ga0268264_10077876
1032 Ga0268264_10820348
1033 Ga0268264_11475727
1034 Ga0268264_11962750
1035 Ga0268264_12262243
1036 Ga0265338_10003821
1037 Ga0265762_1008804
1038 Ga0265770_1021667
1039 Ga0265773_1044621
1040 Ga0265760_10000015
1041 Ga0265760_10001764
1042 Ga0265325_10003819
1043 Ga0265325_10051522
1044 Ga0265316_10097117
1045 Ga0307408_101421821
1046 Ga0265313_10117415
1047 Ga0265314_10695807
1048 Ga0307410_10827267
1049 Ga0307410_11367679
1050 Ga0307410_11788604
1051 Ga0307407_10316473
1052 Ga0307409_100884465
1053 Ga0307409_101340792
1054 Ga0307409_102243214
1055 Ga0307411_10618364
1056 Ga0307411_10857244
1057 Ga0316053_105271
1058 Ga0307415_100052208
1059 Ga0373944_0394478
1060 Ga0373949_0309821
1061 Ga0373923_0020431
1062 Ga0373923_0042895
1063 Ga0373936_0174007
1064 Ga0373936_0307483
1065 Ga0373953_0244522
1066 Ga0373953_0376145
1067 Ga0373954_0054245
1068 Ga0373954_0089955
1069 Ga0373954_0353556
1070 Ga0373956_0592889
1071 Ga0373956_0598202
1072 Ga0373957_0032949
1073 Ga0373943_0021210
1074 Ga0373946_0128876
1075 Ga0373955_0018943
1076 Ga0373955_0263839
1077 Ga0373961_0378932
1078 Ga0373924_0042878
1079 Ga0373924_0252800
1080 Ga0373931_0094661
1081 Ga0373931_0406116
1082 Ga0373935_0007842
1083 Ga0373935_0073158
1084 Ga0373933_0823212
1085 Ga0373947_0556603
1086 Ga0373937_0028898
1087 Ga0373937_0037224
1088 Ga0373937_0332777
1089 Ga0373937_0374031
1090 Ga0373937_0569532
1091 Ga0373925_0055565
1092 Ga0373925_0220114
1093 Ga0436360_0513297
1094 Ga0436360_1023055
1095 Ga0436362_0103411
1096 Ga0451791_0710523
1097 Ga0451793_1878183
1098 Ga0451800_1564513
1099 Ga0451802_1065277
1100 Ga0451804_1061323
1101 Ga0451807_2478126
1102 Ga0451845_0605748
1103 Ga0451849_0835551
1104 Ga0451853_2280574
1105 Ga0439448_0036098
1106 Ga0450911_037225
1107 Ga0450914_036633
1108 Ga0439446_0353976
1109 Ga0451577_1125003
1110 Ga0451576_0856260
1111 Ga0451576_2253198
1112 Ga0495592_0021158
1113 Ga0495592_0541139
1114 Ga0495638_0008690
1115 Ga0495650_0000037
1116 Ga0495580_0287310
1117 Ga0495582_0414344
1118 Ga0495662_0175796
1119 Ga0495664_0181567
1120 Ga0495583_0146573
1121 Ga0495608_0025698
1122 Ga0495618_0155650
1123 Ga0495618_0241939
1124 Ga0495628_0584115
1125 Ga0495630_0372992
1126 Ga0495630_0567632
1127 Ga0495630_1115948
1128 Ga0495630_1495747
1129 Ga0495665_0566936
1130 Ga0495640_0073729
1131 Ga0495586_0022108
1132 Ga0495587_0632449
1133 Ga0495667_0002884
1134 Ga0495634_0124840
1135 Ga0495625_0053613
1136 Ga0495635_0272997
1137 Ga0495659_0081905
1138 Ga0495657_0001995
1139 Ga0495599_0180381
1140 Ga0495599_0370456
1141 Ga0495647_0003999
1142 Ga0495647_0481252
1143 Ga0495658_0045719
1144 Ga0495658_0047792
1145 Ga0495613_0076349
1146 Ga0495613_0444459
1147 Ga0495581_0323535
1148 Ga0495581_0560099
1149 Ga0495636_0006034
1150 Ga0495636_0533090
1151 Ga0495680_0663511
1152 Ga0495684_0043196
1153 Ga0495614_0671209
1154 Ga0496100_0789554
1155 Ga0496109_1082043
1156 Ga0496110_0385176
1157 Ga0501304_025137
1158 Ga0495682_0039567
1159 Ga0501314_023627
1160 Ga0501317_040690
1161 Ga0501031_0229070
1162 Ga0501031_1010355
1163 Ga0501032_0034922
1164 Ga0501032_0071594
1165 Ga0501032_0300556
1166 Ga0501033_0039202
1167 Ga0501033_0663180
1168 Ga0501034_0014212
1169 Ga0501034_0044439
1170 Ga0501034_0233722
1171 Ga0501036_0028328
1172 Ga0501036_0761317
1173 Ga0501037_0073473
1174 Ga0501037_0959569
1175 Ga0501038_0018656
1176 Ga0501038_0121765
1177 Ga0501038_0299939
1178 Ga0501039_0079850
1179 Ga0501040_0976250
1180 Ga0501042_0672859
1181 Ga0501043_0037262
1182 Ga0501043_0151539
1183 Ga0501046_0076230
1184 Ga0501047_0001442
1185 Ga0501047_0013507
1186 Ga0501047_0032822
1187 Ga0501047_0419577
1188 Ga0501048_0074592
1189 Ga0501048_0170822
1190 Ga0501048_0319227
1191 Ga0501067_0006276
1192 Ga0501067_0079639
1193 Ga0501067_0192676
1194 Ga0501068_0005719
1195 Ga0501068_0034129
1196 Ga0501068_0354592
1197 Ga0501068_1120881
1198 Ga0501069_0042887
1199 Ga0501070_0121533
1200 Ga0501070_0441021
1201 Ga0501071_0119816
1202 Ga0501072_0225478
1203 Ga0501072_0536477
1204 Ga0501072_0847780
1205 Ga0501073_0050130
1206 Ga0501073_0183928
1207 Ga0501073_0956214
1208 Ga0501074_0146844
1209 Ga0501076_0033321
1210 Ga0501076_0241377
1211 Ga0501077_0353519
1212 Ga0501077_0471745
1213 Ga0501079_0214080
1214 Ga0501079_0381656
1215 Ga0501079_1008742
1216 Ga0501080_0008092
1217 Ga0501080_0193134
1218 Ga0501080_0230771
1219 Ga0501080_0360477
1220 Ga0501080_0420745
1221 Ga0501080_0608478
1222 Ga0501081_0113849
1223 Ga0501081_0248489
1224 Ga0501081_0434432
1225 Ga0501083_0019469
1226 Ga0501083_0038089
1227 Ga0501083_0159104
1228 Ga0501035_0222873
1229 Ga0501035_0597196
1230 Ga0501044_0087754
1231 Ga0501045_0283442
1232 Ga0501045_0904991
1233 Ga0501045_1066858
1234 Ga0501045_1324544
1235 nmdc:mga05p37_155100_c1
1236 nmdc:mga05p37_1916888_c1
1237 nmdc:mga05p37_2409_c1
1238 nmdc:mga05p37_25497_c1
1239 nmdc:mga05p37_268194_c1
1240 nmdc:mga05p37_36822_c1
1241 nmdc:mga05p37_520113_c1
1242 nmdc:mga05p37_79122_c1
1243 nmdc:mga05p37_84505_c2
1244 nmdc:mga09592_106560_c1
1245 nmdc:mga09592_1709378_c1
1246 nmdc:mga09592_186534_c1
1247 nmdc:mga0qj67_310504_c1
1248 nmdc:mga06r32_158705_c1
1249 nmdc:mga06r32_33231_c1
1250 nmdc:mga06r32_914842_c1
1251 nmdc:mga06r32_92806_c1
1252 nmdc:mga06r32_96759_c1
1253 nmdc:mga06r32_99333_c1
1254 nmdc:mga08y16_1186746_c1
1255 nmdc:mga08y16_4500_c1
1256 nmdc:mga08y16_643503_c1
1257 nmdc:mga0n895_158332_c1
1258 nmdc:mga0n895_350582_c1
1259 nmdc:mga0n895_36272_c1
1260 nmdc:mga0n895_74077_c1
1261 nmdc:mga0n895_823088_c1
1262 nmdc:mga0rr50_11448_c1
1263 nmdc:mga0rr50_1388636_c1
1264 nmdc:mga0rr50_1784327_c1
1265 nmdc:mga0rr50_52226_c1
1266 nmdc:mga08x19_382463_c1
1267 nmdc:mga0a205_1644_c1
1268 nmdc:mga0a205_38880_c1
1269 nmdc:mga0a205_579317_c1
1270 nmdc:mga0a205_615447_c1
1271 Ga0495619_0028240
1272 Ga0500651_0114883
1273 Ga0500641_0000556
1274 Ga0500592_023353
1275 Ga0500592_027658
1276 Ga0500599_001889
1277 Ga0501084_0012237
1278 Ga0501084_0078680
1279 Ga0501084_0612856
1280 Ga0587084_152335
1281 Ga0501082_0047101
1282 Ga0501082_0057205
1283 Ga0501082_0063973
1284 Ga0501082_0240733
1285 Ga0530510_0279715
1286 Ga0530510_0470712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9497 20 85
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.936 20 85
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.9247 27 84
5okz-assembly3.cif.gz_R crystal strucrure of the mpp6 exosome complex 0.9 28 85
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8999 20 84
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9497 20 85 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.936 20 85 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9129 29 83 2.40.50.100
4ifdH01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8979 29 85 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8968 29 83 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A356IGA3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9968 31 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A2E0JHA6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9766 28 85 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A350BV23-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9666 29 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A356IGA3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9619 31 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A3D1WKP5-F1-model_v4 deleted 0.9603 28 83

Map