F471730

General Info

Members Datasets Scaffolds Average Seq Length
640 325 1280 136

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0044963|Ga0501031_0044963_2112_2576
Length 142
Sequence VSCEALRRARVGAKLHDRRRAMEITRNGIDTNSGPSDWFTGAVYLDPVAAPADGSRLSASSVHFTPGARTAWEGVGLCQRRGGAIEAIRPGDRVFFEPGEEHWHGAAPGRFMTHLALLEVDDDGNAATWGDHVTDEEYAAAP

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
209 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
319 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 7.97
Rhizosphere 90.16
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0044963 3300049568 Bacteria 2881
2 JGI25407J50210_10005679 3300003373 Unclassified 3077
3 JGI25407J50210_10018409 3300003373 Bacteria 1815
4 JGI25407J50210_10183891 3300003373 Bacteria 515
5 Ga0070658_11314780 3300005327 Bacteria 628
6 Ga0070676_10267372 3300005328 Bacteria 1147
7 Ga0070683_100025053 3300005329 Bacteria 5352
8 Ga0070683_100052855 3300005329 Bacteria 3765
9 Ga0070683_101304014 3300005329 Bacteria 698
10 Ga0070690_101458462 3300005330 Bacteria 552
11 Ga0070670_100006509 3300005331 Bacteria 9891
12 Ga0070670_100017030 3300005331 Bacteria 6237
13 Ga0070677_10217065 3300005333 Bacteria 932
14 Ga0068869_100088844 3300005334 Bacteria 2320
15 Ga0068868_100635346 3300005338 Bacteria 949
16 Ga0070689_100123046 3300005340 Bacteria 2073
17 Ga0070689_100513359 3300005340 Bacteria 1028
18 Ga0070689_100518094 3300005340 Bacteria 1024
19 Ga0070691_10077687 3300005341 Bacteria 1621
20 Ga0070691_10202338 3300005341 Bacteria 1044
21 Ga0070691_10652744 3300005341 Bacteria 627
22 Ga0070687_100450296 3300005343 Bacteria 856
23 Ga0070661_100020560 3300005344 Bacteria 4709
24 Ga0070661_100047146 3300005344 Bacteria 3154
25 Ga0070661_100402738 3300005344 Bacteria 1082
26 Ga0070692_10087938 3300005345 Bacteria 1684
27 Ga0070668_100014889 3300005347 Bacteria 5814
28 Ga0070668_100832303 3300005347 Bacteria 822
29 Ga0070675_100144652 3300005354 Bacteria 2035
30 Ga0070675_100221456 3300005354 Bacteria 1648
31 Ga0070674_100014165 3300005356 Bacteria 4951
32 Ga0070674_100043369 3300005356 Bacteria 3060
33 Ga0070674_101642722 3300005356 Bacteria 580
34 Ga0070673_100053213 3300005364 Bacteria 3178
35 Ga0070688_100079900 3300005365 Bacteria 2114
36 Ga0070688_100898255 3300005365 Bacteria 698
37 Ga0070659_100556094 3300005366 Bacteria 983
38 Ga0070703_10234220 3300005406 Bacteria 737
39 Ga0070709_10355095 3300005434 Bacteria 1084
40 Ga0070709_10367297 3300005434 Bacteria 1067
41 Ga0070714_100526544 3300005435 Bacteria 1129
42 Ga0070714_100540223 3300005435 Bacteria 1115
43 Ga0070714_101061539 3300005435 Bacteria 789
44 Ga0070713_100154246 3300005436 Bacteria 2046
45 Ga0070701_10086367 3300005438 Bacteria 1709
46 Ga0070711_100051392 3300005439 Bacteria 2830
47 Ga0070711_100282323 3300005439 Bacteria 1314
48 Ga0070711_100516081 3300005439 Bacteria 987
49 Ga0070711_101665753 3300005439 Bacteria 558
50 Ga0070705_100019773 3300005440 Bacteria 3550
51 Ga0070700_100030140 3300005441 Bacteria 3239
52 Ga0070700_100050883 3300005441 Bacteria 2577
53 Ga0070700_100051855 3300005441 Bacteria 2555
54 Ga0070694_100199630 3300005444 Bacteria 1490
55 Ga0070708_101822915 3300005445 Bacteria 564
56 Ga0070663_100234270 3300005455 Bacteria 1447
57 Ga0070663_100238283 3300005455 Bacteria 1435
58 Ga0070663_100562103 3300005455 Bacteria 955
59 Ga0070663_101391387 3300005455 Bacteria 621
60 Ga0070678_100069342 3300005456 Bacteria 2633
61 Ga0070678_100826518 3300005456 Bacteria 843
62 Ga0070662_100016981 3300005457 Bacteria 4895
63 Ga0070662_100373197 3300005457 Bacteria 1173
64 Ga0070662_100983005 3300005457 Bacteria 722
65 Ga0070681_10893872 3300005458 Bacteria 807
66 Ga0070681_11149234 3300005458 Bacteria 698
67 Ga0068867_100512173 3300005459 Unclassified 1033
68 Ga0068867_102176611 3300005459 Bacteria 526
69 Ga0070685_10081497 3300005466 Bacteria 1940
70 Ga0070685_10344884 3300005466 Bacteria 1016
71 Ga0070706_100049030 3300005467 Bacteria 3897
72 Ga0070706_100412739 3300005467 Bacteria 1257
73 Ga0070707_100053782 3300005468 Bacteria 3860
74 Ga0070707_100063183 3300005468 Bacteria 3553
75 Ga0070698_100003694 3300005471 Bacteria 16800
76 Ga0070698_100025369 3300005471 Bacteria 6179
77 Ga0070698_100038627 3300005471 Bacteria 4918
78 Ga0070698_100518786 3300005471 Bacteria 1130
79 Ga0070698_102119870 3300005471 Bacteria 516
80 Ga0070699_100352644 3300005518 Bacteria 1325
81 Ga0070699_100987407 3300005518 Unclassified 772
82 Ga0070679_100349964 3300005530 Bacteria 1425
83 Ga0070679_100412085 3300005530 Bacteria 1297
84 Ga0070679_100546795 3300005530 Bacteria 1102
85 Ga0070679_101106270 3300005530 Bacteria 737
86 Ga0070684_100002364 3300005535 Bacteria 13907
87 Ga0070684_100112868 3300005535 Bacteria 2438
88 Ga0070684_100337778 3300005535 Bacteria 1385
89 Ga0070684_100565419 3300005535 Bacteria 1056
90 Ga0070697_101123726 3300005536 Bacteria 700
91 Ga0070672_100174720 3300005543 Bacteria 1788
92 Ga0070686_100240846 3300005544 Bacteria 1317
93 Ga0070686_101424580 3300005544 Bacteria 582
94 Ga0070686_101817178 3300005544 Bacteria 519
95 Ga0070695_100493465 3300005545 Bacteria 946
96 Ga0070665_100014467 3300005548 Bacteria 7914
97 Ga0070665_100172340 3300005548 Bacteria 2165
98 Ga0070704_100044036 3300005549 Bacteria 3099
99 Ga0070704_100995751 3300005549 Bacteria 758
100 Ga0070704_101477898 3300005549 Bacteria 625
101 Ga0068855_100157295 3300005563 Bacteria 2581
102 Ga0070664_101317732 3300005564 Bacteria 682
103 Ga0070664_101521705 3300005564 Bacteria 633
104 Ga0068857_100036949 3300005577 Bacteria 4326
105 Ga0068857_100168035 3300005577 Bacteria 1993
106 Ga0068857_100273382 3300005577 Bacteria 1553
107 Ga0068857_101186667 3300005577 Bacteria 739
108 Ga0068854_100304152 3300005578 Bacteria 1291
109 Ga0068856_100029338 3300005614 Bacteria 5374
110 Ga0068856_102659811 3300005614 Bacteria 506
111 Ga0070702_100050014 3300005615 Bacteria 2386
112 Ga0070702_100359984 3300005615 Bacteria 1028
113 Ga0068852_100093252 3300005616 Bacteria 2698
114 Ga0068859_100505297 3300005617 Bacteria 1304
115 Ga0068864_100019893 3300005618 Bacteria 5613
116 Ga0068864_100247002 3300005618 Bacteria 1655
117 Ga0068864_100621151 3300005618 Bacteria 1050
118 Ga0068866_10145850 3300005718 Bacteria 1364
119 Ga0068866_10225927 3300005718 Bacteria 1132
120 Ga0068861_100042426 3300005719 Bacteria 3409
121 Ga0068861_100674062 3300005719 Bacteria 958
122 Ga0068870_10001740 3300005840 Bacteria 8916
123 Ga0068870_10024350 3300005840 Bacteria 2995
124 Ga0068863_100421449 3300005841 Bacteria 1308
125 Ga0081455_10040829 3300005937 Bacteria 4088
126 Ga0081538_10000136 3300005981 Bacteria 76141
127 Ga0081538_10006326 3300005981 Bacteria 10453
128 Ga0081538_10042105 3300005981 Bacteria 2887
129 Ga0081540_1025512 3300005983 Bacteria 3398
130 Ga0081539_10119016 3300005985 Bacteria 1315
131 Ga0070717_10131803 3300006028 Bacteria 2150
132 Ga0070717_10733347 3300006028 Bacteria 898
133 Ga0075432_10002243 3300006058 Bacteria 6430
134 Ga0070712_100033864 3300006175 Bacteria 3459
135 Ga0070712_100244609 3300006175 Bacteria 1430
136 Ga0070712_100257127 3300006175 Bacteria 1398
137 Ga0070712_100420197 3300006175 Bacteria 1108
138 Ga0097621_100921179 3300006237 Bacteria 815
139 Ga0068871_100129822 3300006358 Bacteria 2136
140 Ga0068871_100399285 3300006358 Bacteria 1224
141 Ga0075428_100045613 3300006844 Bacteria 4816
142 Ga0075428_100226511 3300006844 Bacteria 2018
143 Ga0075428_100775062 3300006844 Bacteria 1020
144 Ga0075430_100649477 3300006846 Bacteria 870
145 Ga0075431_100024089 3300006847 Bacteria 6233
146 Ga0075433_10017385 3300006852 Bacteria 5955
147 Ga0075434_100084334 3300006871 Bacteria 3176
148 Ga0075434_100564515 3300006871 Bacteria 1158
149 Ga0075434_100680157 3300006871 Bacteria 1047
150 Ga0075434_102057360 3300006871 Bacteria 576
151 Ga0068865_100626332 3300006881 Bacteria 912
152 Ga0068865_101865232 3300006881 Unclassified 544
153 Ga0075436_100006382 3300006914 Bacteria 8081
154 Ga0075436_101162320 3300006914 Bacteria 582
155 Ga0097620_100505289 3300006931 Bacteria 1304
156 Ga0075435_100158224 3300007076 Bacteria 1907
157 Ga0075435_100239890 3300007076 Bacteria 1542
158 Ga0075435_100249808 3300007076 Bacteria 1510
159 Ga0105240_10222067 3300009093 Bacteria 2201
160 Ga0105240_10529831 3300009093 Bacteria 1306
161 Ga0111539_10040824 3300009094 Bacteria 5583
162 Ga0111539_10078724 3300009094 Bacteria 3877
163 Ga0105245_10082160 3300009098 Bacteria 2947
164 Ga0105245_10177303 3300009098 Bacteria 2033
165 Ga0105245_10545868 3300009098 Bacteria 1181
166 Ga0114129_10024837 3300009147 Bacteria 8495
167 Ga0114129_10057475 3300009147 Bacteria 5443
168 Ga0114129_10104301 3300009147 Bacteria 3918
169 Ga0114129_10351642 3300009147 Bacteria 1952
170 Ga0105243_10040726 3300009148 Bacteria 3630
171 Ga0105243_10255697 3300009148 Bacteria 1566
172 Ga0105243_12549745 3300009148 Bacteria 551
173 Ga0105241_10052905 3300009174 Bacteria 3102
174 Ga0105241_11537176 3300009174 Bacteria 642
175 Ga0105241_11698025 3300009174 Bacteria 613
176 Ga0105242_10128606 3300009176 Bacteria 2183
177 Ga0105242_10225419 3300009176 Bacteria 1677
178 Ga0105242_10613640 3300009176 Bacteria 1052
179 Ga0105242_10939912 3300009176 Bacteria 868
180 Ga0105242_11183115 3300009176 Bacteria 783
181 Ga0105248_10194786 3300009177 Bacteria 2283
182 Ga0105248_10943087 3300009177 Bacteria 975
183 Ga0105248_11515195 3300009177 Bacteria 759
184 Ga0105248_13133299 3300009177 Bacteria 526
185 Ga0105237_11240998 3300009545 Bacteria 752
186 Ga0105238_10056808 3300009551 Bacteria 3926
187 Ga0105238_10159678 3300009551 Bacteria 2230
188 Ga0105238_10754719 3300009551 Bacteria 987
189 Ga0105249_10004343 3300009553 Bacteria 12263
190 Ga0105249_10094521 3300009553 Bacteria 2802
191 Ga0105249_11197667 3300009553 Bacteria 831
192 Ga0105239_11001866 3300010375 Bacteria 961
193 Ga0105239_13077266 3300010375 Bacteria 543
194 Ga0105246_10036978 3300011119 Bacteria 3274
195 Ga0105246_10039973 3300011119 Bacteria 3163
196 Ga0157373_10045914 3300013100 Bacteria 3118
197 Ga0157370_10064765 3300013104 Bacteria 3459
198 Ga0157369_10006391 3300013105 Bacteria 13662
199 Ga0157369_10093950 3300013105 Bacteria 3202
200 Ga0157369_10550415 3300013105 Bacteria 1193
201 Ga0157374_10076782 3300013296 Bacteria 3159
202 Ga0157378_10453357 3300013297 Bacteria 1273
203 Ga0157378_11033211 3300013297 Bacteria 857
204 Ga0157378_11117978 3300013297 Bacteria 825
205 Ga0163162_10123733 3300013306 Bacteria 2692
206 Ga0163162_10370935 3300013306 Bacteria 1564
207 Ga0157372_10089816 3300013307 Bacteria 3491
208 Ga0157375_10023869 3300013308 Bacteria 5649
209 Ga0157375_10778514 3300013308 Bacteria 1107
210 Ga0157375_10958914 3300013308 Bacteria 997
211 Ga0163163_10234452 3300014325 Bacteria 1885
212 Ga0163163_10390936 3300014325 Unclassified 1449
213 Ga0163163_10528637 3300014325 Bacteria 1242
214 Ga0157380_10061376 3300014326 Bacteria 3008
215 Ga0182008_10032607 3300014497 Bacteria 2616
216 Ga0182008_10306443 3300014497 Bacteria 832
217 Ga0157377_10007906 3300014745 Bacteria 5160
218 Ga0157377_10215761 3300014745 Bacteria 1226
219 Ga0157377_10534335 3300014745 Bacteria 825
220 Ga0157377_10990699 3300014745 Bacteria 636
221 Ga0157379_10168554 3300014968 Bacteria 1977
222 Ga0157379_10494407 3300014968 Bacteria 1133
223 Ga0157379_11106703 3300014968 Bacteria 759
224 Ga0157376_10295368 3300014969 Bacteria 1531
225 Ga0157376_10310580 3300014969 Bacteria 1496
226 Ga0157376_11444505 3300014969 Bacteria 720
227 Ga0163161_10146165 3300017792 Bacteria 1793
228 Ga0163161_10362277 3300017792 Bacteria 1155
229 Ga0163161_10688606 3300017792 Bacteria 850
230 Ga0163161_11553505 3300017792 Bacteria 582
231 Ga0197907_10082848 3300020069 Bacteria 1426
232 Ga0197907_10988801 3300020069 Bacteria 908
233 Ga0206356_10898175 3300020070 Bacteria 844
234 Ga0206350_10879203 3300020080 Bacteria 743
235 Ga0206354_10123109 3300020081 Bacteria 2397
236 Ga0206353_10440267 3300020082 Bacteria 1165
237 Ga0213873_10055886 3300021358 Bacteria 1057
238 Ga0213876_10044247 3300021384 Bacteria 2353
239 Ga0213876_10210194 3300021384 Bacteria 1034
240 Ga0213876_10467518 3300021384 Bacteria 671
241 Ga0224712_10006104 3300022467 Bacteria 3409
242 Ga0224712_10084619 3300022467 Bacteria 1316
243 Ga0207682_10069071 3300025893 Bacteria 1494
244 Ga0207692_11060847 3300025898 Bacteria 536
245 Ga0207642_10009885 3300025899 Bacteria 3338
246 Ga0207688_10004008 3300025901 Bacteria 8023
247 Ga0207688_10211537 3300025901 Bacteria 1165
248 Ga0207688_10298440 3300025901 Bacteria 985
249 Ga0207688_10567633 3300025901 Bacteria 714
250 Ga0207699_10219939 3300025906 Bacteria 1296
251 Ga0207645_10223891 3300025907 Bacteria 1240
252 Ga0207645_10225168 3300025907 Bacteria 1237
253 Ga0207643_10034181 3300025908 Bacteria 2848
254 Ga0207643_10039994 3300025908 Unclassified 2639
255 Ga0207705_10448704 3300025909 Bacteria 1000
256 Ga0207684_10221936 3300025910 Bacteria 1631
257 Ga0207684_10467213 3300025910 Bacteria 1083
258 Ga0207707_10203980 3300025912 Bacteria 1724
259 Ga0207695_10139522 3300025913 Bacteria 2374
260 Ga0207695_11508291 3300025913 Bacteria 553
261 Ga0207693_10024171 3300025915 Bacteria 4824
262 Ga0207693_10053613 3300025915 Bacteria 3164
263 Ga0207693_10270483 3300025915 Bacteria 1332
264 Ga0207693_10373016 3300025915 Bacteria 1116
265 Ga0207663_10005888 3300025916 Bacteria 6219
266 Ga0207663_10153286 3300025916 Bacteria 1619
267 Ga0207663_10227936 3300025916 Bacteria 1359
268 Ga0207663_10638236 3300025916 Bacteria 840
269 Ga0207662_11362309 3300025918 Bacteria 504
270 Ga0207657_10014232 3300025919 Bacteria 7776
271 Ga0207657_10100202 3300025919 Bacteria 2405
272 Ga0207649_10215766 3300025920 Bacteria 1364
273 Ga0207649_10217282 3300025920 Bacteria 1360
274 Ga0207652_10292198 3300025921 Bacteria 1470
275 Ga0207652_10654255 3300025921 Bacteria 940
276 Ga0207646_10106571 3300025922 Bacteria 2514
277 Ga0207646_10202557 3300025922 Bacteria 1793
278 Ga0207694_10412077 3300025924 Bacteria 1125
279 Ga0207650_10004674 3300025925 Bacteria 9360
280 Ga0207650_10119058 3300025925 Bacteria 2053
281 Ga0207659_10120039 3300025926 Bacteria 2013
282 Ga0207659_10264868 3300025926 Bacteria 1400
283 Ga0207687_10053135 3300025927 Bacteria 2829
284 Ga0207687_10081323 3300025927 Bacteria 2341
285 Ga0207687_10359257 3300025927 Bacteria 1188
286 Ga0207687_10372455 3300025927 Bacteria 1168
287 Ga0207687_10600758 3300025927 Bacteria 927
288 Ga0207664_10027992 3300025929 Bacteria 4280
289 Ga0207664_11710208 3300025929 Bacteria 551
290 Ga0207690_10816057 3300025932 Bacteria 771
291 Ga0207690_11665208 3300025932 Bacteria 533
292 Ga0207706_10016211 3300025933 Bacteria 6734
293 Ga0207706_10304398 3300025933 Bacteria 1388
294 Ga0207686_10363141 3300025934 Bacteria 1093
295 Ga0207686_10411529 3300025934 Bacteria 1032
296 Ga0207686_10540417 3300025934 Bacteria 910
297 Ga0207709_10085529 3300025935 Bacteria 2045
298 Ga0207709_10183628 3300025935 Bacteria 1479
299 Ga0207709_11644043 3300025935 Bacteria 534
300 Ga0207670_10072483 3300025936 Bacteria 2385
301 Ga0207670_10194648 3300025936 Bacteria 1536
302 Ga0207669_10074234 3300025937 Bacteria 2150
303 Ga0207669_10781340 3300025937 Bacteria 791
304 Ga0207704_10124310 3300025938 Bacteria 1773
305 Ga0207704_10434293 3300025938 Bacteria 1044
306 Ga0207691_10125140 3300025940 Bacteria 2275
307 Ga0207661_10026503 3300025944 Bacteria 4417
308 Ga0207661_10203974 3300025944 Bacteria 1740
309 Ga0207667_10112501 3300025949 Bacteria 2807
310 Ga0207651_11026852 3300025960 Bacteria 737
311 Ga0207712_10076244 3300025961 Bacteria 2426
312 Ga0207712_11321051 3300025961 Bacteria 645
313 Ga0207668_10553252 3300025972 Bacteria 997
314 Ga0207668_11863127 3300025972 Bacteria 542
315 Ga0207640_10188289 3300025981 Bacteria 1553
316 Ga0207640_10464972 3300025981 Bacteria 1046
317 Ga0207658_12142964 3300025986 Bacteria 508
318 Ga0207677_10693274 3300026023 Bacteria 903
319 Ga0207677_10697565 3300026023 Bacteria 900
320 Ga0207678_10267507 3300026067 Bacteria 1466
321 Ga0207678_11197476 3300026067 Bacteria 673
322 Ga0207678_11240803 3300026067 Bacteria 660
323 Ga0207708_10004461 3300026075 Bacteria 10319
324 Ga0207708_10015907 3300026075 Bacteria 5649
325 Ga0207708_10018783 3300026075 Bacteria 5208
326 Ga0207708_10571515 3300026075 Bacteria 955
327 Ga0207708_10604979 3300026075 Bacteria 929
328 Ga0207708_10653975 3300026075 Bacteria 895
329 Ga0207702_10052239 3300026078 Bacteria 3458
330 Ga0207641_10396653 3300026088 Bacteria 1324
331 Ga0207648_10097405 3300026089 Bacteria 2574
332 Ga0207676_10052508 3300026095 Bacteria 3187
333 Ga0207676_10102538 3300026095 Bacteria 2376
334 Ga0207674_10047094 3300026116 Bacteria 4423
335 Ga0207674_10048883 3300026116 Bacteria 4327
336 Ga0207674_10389308 3300026116 Bacteria 1348
337 Ga0207674_11004231 3300026116 Bacteria 804
338 Ga0207683_10155093 3300026121 Bacteria 2068
339 Ga0207698_10271604 3300026142 Bacteria 1563
340 Ga0207698_10380547 3300026142 Bacteria 1343
341 Ga0207428_10074149 3300027907 Bacteria 2669
342 Ga0207428_10089990 3300027907 Bacteria 2384
343 Ga0207428_10149895 3300027907 Bacteria 1775
344 Ga0268266_10168678 3300028379 Bacteria 1986
345 Ga0268265_11042014 3300028380 Bacteria 810
346 Ga0265318_10001338 3300028577 Bacteria 14731
347 Ga0265323_10068874 3300028653 Bacteria 1214
348 Ga0265336_10127220 3300028666 Bacteria 759
349 Ga0265338_10024643 3300028800 Bacteria 6139
350 Ga0265325_10020692 3300031241 Bacteria 3624
351 Ga0265340_10016190 3300031247 Bacteria 3865
352 Ga0265339_10262175 3300031249 Bacteria 833
353 Ga0265327_10130344 3300031251 Bacteria 1184
354 Ga0265314_10003041 3300031711 Bacteria 16561
355 Ga0307413_10191937 3300031824 Bacteria 1467
356 Ga0307410_10369748 3300031852 Bacteria 1151
357 Ga0307410_10436297 3300031852 Bacteria 1065
358 Ga0307406_10011878 3300031901 Bacteria 4949
359 Ga0307407_10156362 3300031903 Bacteria 1487
360 Ga0307409_100097298 3300031995 Bacteria 2430
361 Ga0307409_101620127 3300031995 Bacteria 676
362 Ga0307416_103359655 3300032002 Bacteria 535
363 Ga0307411_10159474 3300032005 Bacteria 1687
364 Ga0307415_100069096 3300032126 Bacteria 2475
365 Ga0373948_0134812 3300034817 Bacteria 607
366 Ga0373944_0253202 3300035089 Bacteria 650
367 Ga0373932_0278357 3300035112 Bacteria 618
368 Ga0373945_0009721 3300035116 Bacteria 3156
369 Ga0373945_0264717 3300035116 Bacteria 729
370 Ga0373953_0174541 3300035117 Bacteria 926
371 Ga0373957_0101743 3300035120 Bacteria 1151
372 Ga0373943_0025689 3300035170 Bacteria 2754
373 Ga0373955_0023341 3300035172 Bacteria 3149
374 Ga0373942_0374525 3300035207 Bacteria 507
375 Ga0373931_0667317 3300035691 Bacteria 684
376 Ga0373927_0465558 3300035695 Bacteria 835
377 Ga0373933_0665097 3300035724 Bacteria 685
378 Ga0373947_0008872 3300035725 Bacteria 5786
379 Ga0373947_0018602 3300035725 Bacteria 4000
380 Ga0373937_0019256 3300036401 Bacteria 6109
381 Ga0373937_0046355 3300036401 Bacteria 3975
382 Ga0373925_0636141 3300037068 Bacteria 879
383 Ga0395899_0065842 3300037312 Bacteria 2662
384 Ga0395900_0085793 3300037418 Bacteria 3235
385 Ga0395900_0544157 3300037418 Bacteria 1106
386 Ga0395898_0006285 3300037466 Bacteria 12700
387 Ga0395898_0053164 3300037466 Bacteria 3955
388 Ga0395898_0209637 3300037466 Bacteria 1859
389 Ga0395905_0009137 3300037471 Bacteria 9712
390 Ga0395905_0031831 3300037471 Bacteria 4963
391 Ga0395905_0051835 3300037471 Bacteria 3843
392 Ga0395901_0137729 3300038443 Bacteria 2565
393 Ga0395901_0160073 3300038443 Bacteria 2364
394 Ga0395901_0688834 3300038443 Bacteria 1021
395 Ga0436365_0058952 3300039437 Bacteria 861
396 Ga0436365_0143973 3300039437 Bacteria 18536
397 Ga0436365_0248508 3300039437 Bacteria 47975
398 Ga0436365_0861017 3300039437 Bacteria 1048
399 Ga0436365_1508828 3300039437 Bacteria 1616
400 Ga0436363_1610031 3300039450 Bacteria 1840
401 Ga0436362_1056279 3300039453 Bacteria 1695
402 Ga0451849_1368384 3300041505 Bacteria 523
403 Ga0451855_1108427 3300041511 Bacteria 535
404 Ga0466966_0235695 3300044684 Bacteria 1104
405 Ga0466963_0287993 3300044694 Bacteria 1155
406 Ga0451576_0375522 3300045051 Bacteria 1490
407 Ga0466967_0051294 3300045976 Bacteria 3615
408 Ga0466967_0074652 3300045976 Bacteria 3046
409 Ga0466967_0309373 3300045976 Bacteria 1522
410 Ga0466967_1870012 3300045976 Bacteria 597
411 Ga0495592_0090155 3300046454 Bacteria 2200
412 Ga0495603_0026104 3300046455 Bacteria 3530
413 Ga0495603_0042380 3300046455 Bacteria 2721
414 Ga0495603_0603527 3300046455 Bacteria 628
415 Ga0495629_0077601 3300046459 Bacteria 2318
416 Ga0495629_0293548 3300046459 Bacteria 1114
417 Ga0495641_0014098 3300046461 Bacteria 4342
418 Ga0495641_0021531 3300046461 Bacteria 3242
419 Ga0495641_0248421 3300046461 Bacteria 800
420 Ga0495651_0104608 3300046462 Bacteria 2101
421 Ga0495651_0217448 3300046462 Bacteria 1325
422 Ga0495653_0019338 3300046463 Bacteria 5524
423 Ga0495653_0024967 3300046463 Bacteria 4809
424 Ga0495580_0043545 3300046472 Bacteria 3195
425 Ga0495582_0019645 3300046473 Bacteria 3694
426 Ga0495582_0051481 3300046473 Bacteria 2270
427 Ga0495605_0270539 3300046474 Bacteria 724
428 Ga0495639_0000860 3300046475 Bacteria 13774
429 Ga0495639_0746700 3300046475 Bacteria 506
430 Ga0495662_0001129 3300046476 Bacteria 13155
431 Ga0495664_0292888 3300046477 Bacteria 983
432 Ga0495594_0009237 3300046499 Bacteria 5090
433 Ga0495594_0027804 3300046499 Bacteria 3049
434 Ga0495596_0110418 3300046500 Bacteria 1068
435 Ga0495608_0016564 3300046511 Bacteria 5101
436 Ga0495608_0077641 3300046511 Bacteria 2161
437 Ga0495618_0141848 3300046514 Bacteria 1536
438 Ga0495618_0176146 3300046514 Bacteria 1360
439 Ga0495628_0019390 3300046516 Bacteria 5624
440 Ga0495628_0188894 3300046516 Bacteria 1556
441 Ga0495630_0032628 3300046517 Bacteria 3881
442 Ga0495630_0114390 3300046517 Bacteria 2044
443 Ga0495666_0008748 3300046526 Bacteria 5072
444 Ga0495652_0103537 3300046529 Bacteria 2304
445 Ga0495652_0667464 3300046529 Bacteria 702
446 Ga0495665_0040059 3300046531 Bacteria 2495
447 Ga0495640_0012827 3300046533 Bacteria 6393
448 Ga0495640_0209750 3300046533 Bacteria 1232
449 Ga0495587_0008513 3300046536 Bacteria 6592
450 Ga0495587_0228781 3300046536 Bacteria 1048
451 Ga0495645_0630769 3300046543 Bacteria 656
452 Ga0495667_0067555 3300046559 Bacteria 2335
453 Ga0495667_0101214 3300046559 Bacteria 1864
454 Ga0495656_0720601 3300046615 Bacteria 537
455 Ga0495634_0003038 3300046642 Bacteria 13663
456 Ga0495634_0226411 3300046642 Bacteria 1152
457 Ga0495635_0040325 3300046663 Bacteria 3226
458 Ga0495635_0082353 3300046663 Bacteria 2202
459 Ga0495588_0010588 3300046674 Bacteria 4294
460 Ga0495657_0012342 3300046675 Bacteria 6348
461 Ga0495657_0035779 3300046675 Bacteria 3438
462 Ga0495599_0174254 3300046678 Bacteria 1327
463 Ga0495599_0181139 3300046678 Bacteria 1298
464 Ga0495599_0189180 3300046678 Bacteria 1267
465 Ga0495623_0011387 3300046679 Bacteria 5755
466 Ga0495646_0076814 3300046680 Bacteria 1955
467 Ga0495647_0009782 3300046681 Bacteria 3256
468 Ga0495658_0023800 3300046683 Bacteria 3254
469 Ga0495658_0410192 3300046683 Bacteria 864
470 Ga0495613_0963998 3300046689 Bacteria 549
471 Ga0495624_0018736 3300046690 Bacteria 4626
472 Ga0495600_0031967 3300046809 Bacteria 3412
473 Ga0495600_0082532 3300046809 Bacteria 2097
474 Ga0495600_0096701 3300046809 Bacteria 1925
475 Ga0495581_0002982 3300047315 Bacteria 9697
476 Ga0495581_0086530 3300047315 Bacteria 1817
477 Ga0495604_0019379 3300047317 Bacteria 5445
478 Ga0495604_0156041 3300047317 Bacteria 1617
479 Ga0495674_0028591 3300047319 Bacteria 5080
480 Ga0495674_0788418 3300047319 Bacteria 740
481 Ga0495676_0050544 3300047321 Bacteria 3333
482 Ga0495676_0053418 3300047321 Bacteria 3220
483 Ga0495676_0072532 3300047321 Bacteria 2643
484 Ga0495676_0310484 3300047321 Bacteria 1061
485 Ga0495680_0029851 3300047322 Bacteria 4460
486 Ga0495675_0035914 3300047444 Bacteria 3163
487 Ga0495684_0575457 3300047471 Bacteria 763
488 Ga0495593_0003057 3300047673 Bacteria 10083
489 Ga0495602_0028115 3300048088 Bacteria 5387
490 Ga0495602_0480492 3300048088 Bacteria 872
491 Ga0495614_0005196 3300048089 Bacteria 5874
492 Ga0496100_0279470 3300048903 Bacteria 1244
493 Ga0496100_0830263 3300048903 Bacteria 724
494 Ga0496101_0007909 3300048904 Bacteria 6922
495 Ga0496101_0097360 3300048904 Bacteria 2197
496 Ga0496101_0164936 3300048904 Bacteria 1701
497 Ga0496101_0317688 3300048904 Bacteria 1222
498 Ga0496102_0729562 3300048905 Bacteria 914
499 Ga0496102_0793155 3300048905 Bacteria 870
500 Ga0496102_1399463 3300048905 Bacteria 618
501 Ga0496102_1658472 3300048905 Bacteria 557
502 Ga0496103_0130749 3300048906 Bacteria 1603
503 Ga0496103_0365129 3300048906 Bacteria 928
504 Ga0496104_0000329 3300048907 Bacteria 42355
505 Ga0496104_0020636 3300048907 Bacteria 6042
506 Ga0496104_1036143 3300048907 Bacteria 724
507 Ga0496105_0000128 3300048908 Bacteria 51033
508 Ga0496105_0025579 3300048908 Bacteria 4807
509 Ga0496105_0065873 3300048908 Bacteria 2990
510 Ga0496105_0096786 3300048908 Bacteria 2438
511 Ga0496105_0190744 3300048908 Bacteria 1676
512 Ga0496106_0352419 3300048909 Bacteria 1182
513 Ga0496107_0568206 3300048910 Bacteria 839
514 Ga0496108_0003277 3300048911 Bacteria 13009
515 Ga0496108_0011668 3300048911 Bacteria 7150
516 Ga0496108_0045870 3300048911 Bacteria 3650
517 Ga0496108_0047503 3300048911 Bacteria 3588
518 Ga0496109_0001074 3300048912 Bacteria 22668
519 Ga0496109_0021992 3300048912 Bacteria 5646
520 Ga0496109_0037349 3300048912 Bacteria 4388
521 Ga0496109_1801441 3300048912 Bacteria 545
522 Ga0496110_0000072 3300048913 Bacteria 51313
523 Ga0496110_0005532 3300048913 Bacteria 9919
524 Ga0496110_1002629 3300048913 Bacteria 742
525 Ga0496111_0006668 3300048914 Bacteria 7511
526 Ga0496111_0121336 3300048914 Bacteria 1930
527 Ga0496111_0581334 3300048914 Bacteria 821
528 Ga0496112_0000825 3300048915 Bacteria 21994
529 Ga0496112_0291168 3300048915 Bacteria 1579
530 Ga0496112_0501212 3300048915 Bacteria 1150
531 Ga0496112_1560680 3300048915 Bacteria 574
532 Ga0496113_0072492 3300048916 Bacteria 2621
533 Ga0496113_0117590 3300048916 Bacteria 2076
534 Ga0496114_0010251 3300048917 Bacteria 7457
535 Ga0496114_0017409 3300048917 Bacteria 5800
536 Ga0496114_0034912 3300048917 Bacteria 4152
537 Ga0496114_0232809 3300048917 Bacteria 1619
538 Ga0496114_0261477 3300048917 Bacteria 1524
539 Ga0496114_0478358 3300048917 Bacteria 1102
540 Ga0496115_0000319 3300048918 Bacteria 40949
541 Ga0496115_0118725 3300048918 Bacteria 2175
542 Ga0496115_1242220 3300048918 Bacteria 558
543 Ga0501031_0113866 3300049568 Bacteria 1766
544 Ga0501033_0287930 3300049570 Bacteria 1159
545 Ga0501036_0032237 3300049572 Bacteria 4427
546 Ga0501036_0036181 3300049572 Bacteria 4177
547 Ga0501037_0104278 3300049573 Bacteria 2045
548 Ga0501037_0414687 3300049573 Bacteria 922
549 Ga0501038_0045947 3300049574 Bacteria 3788
550 Ga0501038_0193765 3300049574 Bacteria 1634
551 Ga0501039_0071915 3300049575 Bacteria 2687
552 Ga0501040_0060606 3300049576 Bacteria 2600
553 Ga0501041_0001853 3300049577 Bacteria 11851
554 Ga0501042_0013127 3300049578 Bacteria 5636
555 Ga0501042_0143445 3300049578 Bacteria 1722
556 Ga0501043_0083464 3300049579 Bacteria 2512
557 Ga0501043_0139451 3300049579 Bacteria 1899
558 Ga0501046_0029995 3300049580 Bacteria 4418
559 Ga0501048_0018140 3300049582 Bacteria 5177
560 Ga0501048_0021855 3300049582 Bacteria 4682
561 Ga0501067_0000362 3300049583 Bacteria 24880
562 Ga0501068_0000450 3300049584 Bacteria 20933
563 Ga0501068_0028455 3300049584 Bacteria 3305
564 Ga0501068_0091092 3300049584 Bacteria 1881
565 Ga0501068_0461363 3300049584 Bacteria 822
566 Ga0501069_0001047 3300049585 Bacteria 13224
567 Ga0501069_0341270 3300049585 Bacteria 882
568 Ga0501069_0962889 3300049585 Bacteria 520
569 Ga0501070_0018157 3300049586 Bacteria 5900
570 Ga0501071_0024582 3300049587 Bacteria 4214
571 Ga0501071_0045623 3300049587 Bacteria 3146
572 Ga0501071_1512978 3300049587 Bacteria 518
573 Ga0501072_0459943 3300049588 Bacteria 1007
574 Ga0501074_0300370 3300049590 Bacteria 1140
575 Ga0501074_0654141 3300049590 Bacteria 742
576 Ga0501075_0000756 3300049591 Bacteria 20175
577 Ga0501075_0011969 3300049591 Bacteria 6156
578 Ga0501076_0026916 3300049592 Bacteria 4458
579 Ga0501077_0017511 3300049593 Bacteria 4523
580 Ga0501077_0351638 3300049593 Bacteria 940
581 Ga0501079_0009716 3300049741 Bacteria 7295
582 Ga0501079_0038520 3300049741 Bacteria 3686
583 Ga0501079_0734743 3300049741 Bacteria 777
584 Ga0501080_0153122 3300049742 Bacteria 2130
585 Ga0501080_0736445 3300049742 Bacteria 868
586 Ga0501081_0011978 3300049743 Bacteria 5683
587 Ga0501081_0012134 3300049743 Bacteria 5650
588 Ga0501081_0490416 3300049743 Bacteria 915
589 Ga0501081_0640766 3300049743 Bacteria 796
590 Ga0501083_0095191 3300049744 Bacteria 1965
591 Ga0501083_0122416 3300049744 Bacteria 1706
592 Ga0501283_128570 3300049779 Bacteria 513
593 Ga0501035_0396747 3300049822 Bacteria 1148
594 Ga0501035_0457872 3300049822 Bacteria 1055
595 Ga0501044_0479806 3300049823 Bacteria 1147
596 Ga0501044_0736036 3300049823 Bacteria 869
597 Ga0501045_0007759 3300049824 Bacteria 7465
598 Ga0501045_0028695 3300049824 Bacteria 4015
599 nmdc:mga0yw44_489289_c1 3300050492 Unclassified 834
600 nmdc:mga05p37_21763_c1 3300050507 Bacteria 7768
601 nmdc:mga05p37_30316_c1 3300050507 Bacteria 6599
602 nmdc:mga05p37_662087_c1 3300050507 Bacteria 1167
603 nmdc:mga0qj67_844618_c1 3300050509 Bacteria 723
604 nmdc:mga06r32_139506_c1 3300050510 Bacteria 2400
605 nmdc:mga06r32_1704409_c1 3300050510 Bacteria 567
606 nmdc:mga06r32_757116_c1 3300050510 Bacteria 934
607 nmdc:mga08y16_14222_c1 3300050511 Bacteria 8375
608 nmdc:mga08y16_143958_c1 3300050511 Bacteria 2478
609 nmdc:mga0n895_36107_c1 3300050512 Bacteria 4771
610 nmdc:mga0n895_614058_c1 3300050512 Bacteria 1089
611 nmdc:mga0n895_645837_c1 3300050512 Bacteria 1057
612 nmdc:mga0rr50_158249_c1 3300050513 Bacteria 1837
613 nmdc:mga0rr50_251108_c1 3300050513 Bacteria 1469
614 nmdc:mga0rr50_276292_c1 3300050513 Unclassified 1401
615 nmdc:mga0rr50_770108_c1 3300050513 Bacteria 821
616 nmdc:mga08x19_12784_c1 3300050514 Bacteria 5064
617 nmdc:mga0a205_201140_c1 3300050515 Bacteria 1883
618 Ga0495601_0052964 3300053077 Bacteria 2564
619 Ga0495601_0057067 3300053077 Bacteria 2473
620 Ga0495601_0278465 3300053077 Bacteria 1091
621 Ga0495612_0062041 3300053078 Bacteria 1549
622 Ga0495612_0091046 3300053078 Bacteria 1291
623 Ga0495612_0435311 3300053078 Bacteria 598
624 Ga0495655_0021464 3300053083 Bacteria 1462
625 Ga0495655_0326068 3300053083 Bacteria 533
626 Ga0495595_0016406 3300053084 Bacteria 3168
627 Ga0495595_0027254 3300053084 Bacteria 2544
628 Ga0495619_0091677 3300053085 Bacteria 2057
629 Ga0495619_0217524 3300053085 Bacteria 1323
630 Ga0495619_0552476 3300053085 Bacteria 790
631 Ga0501084_0008738 3300054114 Bacteria 8377
632 Ga0501084_0012113 3300054114 Bacteria 7138
633 Ga0590075_210049 3300059424 Bacteria 515
634 Ga0501082_0452754 3300060353 Bacteria 1121
635 Ga0466962_0041242 3300061719 Bacteria 2209
636 Ga0530510_0002358 3300061734 Bacteria 12967
637 Ga0530510_0017741 3300061734 Bacteria 5044
638 Ga0530510_0019458 3300061734 Bacteria 4819
639 Ga0530510_0147488 3300061734 Bacteria 1736
640 Ga0530510_0851391 3300061734 Bacteria 696
641 Ga0501031_0044963
642 JGI25407J50210_10005679
643 JGI25407J50210_10018409
644 JGI25407J50210_10183891
645 Ga0070658_11314780
646 Ga0070676_10267372
647 Ga0070683_100025053
648 Ga0070683_100052855
649 Ga0070683_101304014
650 Ga0070690_101458462
651 Ga0070670_100006509
652 Ga0070670_100017030
653 Ga0070677_10217065
654 Ga0068869_100088844
655 Ga0068868_100635346
656 Ga0070689_100123046
657 Ga0070689_100513359
658 Ga0070689_100518094
659 Ga0070691_10077687
660 Ga0070691_10202338
661 Ga0070691_10652744
662 Ga0070687_100450296
663 Ga0070661_100020560
664 Ga0070661_100047146
665 Ga0070661_100402738
666 Ga0070692_10087938
667 Ga0070668_100014889
668 Ga0070668_100832303
669 Ga0070675_100144652
670 Ga0070675_100221456
671 Ga0070674_100014165
672 Ga0070674_100043369
673 Ga0070674_101642722
674 Ga0070673_100053213
675 Ga0070688_100079900
676 Ga0070688_100898255
677 Ga0070659_100556094
678 Ga0070703_10234220
679 Ga0070709_10355095
680 Ga0070709_10367297
681 Ga0070714_100526544
682 Ga0070714_100540223
683 Ga0070714_101061539
684 Ga0070713_100154246
685 Ga0070701_10086367
686 Ga0070711_100051392
687 Ga0070711_100282323
688 Ga0070711_100516081
689 Ga0070711_101665753
690 Ga0070705_100019773
691 Ga0070700_100030140
692 Ga0070700_100050883
693 Ga0070700_100051855
694 Ga0070694_100199630
695 Ga0070708_101822915
696 Ga0070663_100234270
697 Ga0070663_100238283
698 Ga0070663_100562103
699 Ga0070663_101391387
700 Ga0070678_100069342
701 Ga0070678_100826518
702 Ga0070662_100016981
703 Ga0070662_100373197
704 Ga0070662_100983005
705 Ga0070681_10893872
706 Ga0070681_11149234
707 Ga0068867_100512173
708 Ga0068867_102176611
709 Ga0070685_10081497
710 Ga0070685_10344884
711 Ga0070706_100049030
712 Ga0070706_100412739
713 Ga0070707_100053782
714 Ga0070707_100063183
715 Ga0070698_100003694
716 Ga0070698_100025369
717 Ga0070698_100038627
718 Ga0070698_100518786
719 Ga0070698_102119870
720 Ga0070699_100352644
721 Ga0070699_100987407
722 Ga0070679_100349964
723 Ga0070679_100412085
724 Ga0070679_100546795
725 Ga0070679_101106270
726 Ga0070684_100002364
727 Ga0070684_100112868
728 Ga0070684_100337778
729 Ga0070684_100565419
730 Ga0070697_101123726
731 Ga0070672_100174720
732 Ga0070686_100240846
733 Ga0070686_101424580
734 Ga0070686_101817178
735 Ga0070695_100493465
736 Ga0070665_100014467
737 Ga0070665_100172340
738 Ga0070704_100044036
739 Ga0070704_100995751
740 Ga0070704_101477898
741 Ga0068855_100157295
742 Ga0070664_101317732
743 Ga0070664_101521705
744 Ga0068857_100036949
745 Ga0068857_100168035
746 Ga0068857_100273382
747 Ga0068857_101186667
748 Ga0068854_100304152
749 Ga0068856_100029338
750 Ga0068856_102659811
751 Ga0070702_100050014
752 Ga0070702_100359984
753 Ga0068852_100093252
754 Ga0068859_100505297
755 Ga0068864_100019893
756 Ga0068864_100247002
757 Ga0068864_100621151
758 Ga0068866_10145850
759 Ga0068866_10225927
760 Ga0068861_100042426
761 Ga0068861_100674062
762 Ga0068870_10001740
763 Ga0068870_10024350
764 Ga0068863_100421449
765 Ga0081455_10040829
766 Ga0081538_10000136
767 Ga0081538_10006326
768 Ga0081538_10042105
769 Ga0081540_1025512
770 Ga0081539_10119016
771 Ga0070717_10131803
772 Ga0070717_10733347
773 Ga0075432_10002243
774 Ga0070712_100033864
775 Ga0070712_100244609
776 Ga0070712_100257127
777 Ga0070712_100420197
778 Ga0097621_100921179
779 Ga0068871_100129822
780 Ga0068871_100399285
781 Ga0075428_100045613
782 Ga0075428_100226511
783 Ga0075428_100775062
784 Ga0075430_100649477
785 Ga0075431_100024089
786 Ga0075433_10017385
787 Ga0075434_100084334
788 Ga0075434_100564515
789 Ga0075434_100680157
790 Ga0075434_102057360
791 Ga0068865_100626332
792 Ga0068865_101865232
793 Ga0075436_100006382
794 Ga0075436_101162320
795 Ga0097620_100505289
796 Ga0075435_100158224
797 Ga0075435_100239890
798 Ga0075435_100249808
799 Ga0105240_10222067
800 Ga0105240_10529831
801 Ga0111539_10040824
802 Ga0111539_10078724
803 Ga0105245_10082160
804 Ga0105245_10177303
805 Ga0105245_10545868
806 Ga0114129_10024837
807 Ga0114129_10057475
808 Ga0114129_10104301
809 Ga0114129_10351642
810 Ga0105243_10040726
811 Ga0105243_10255697
812 Ga0105243_12549745
813 Ga0105241_10052905
814 Ga0105241_11537176
815 Ga0105241_11698025
816 Ga0105242_10128606
817 Ga0105242_10225419
818 Ga0105242_10613640
819 Ga0105242_10939912
820 Ga0105242_11183115
821 Ga0105248_10194786
822 Ga0105248_10943087
823 Ga0105248_11515195
824 Ga0105248_13133299
825 Ga0105237_11240998
826 Ga0105238_10056808
827 Ga0105238_10159678
828 Ga0105238_10754719
829 Ga0105249_10004343
830 Ga0105249_10094521
831 Ga0105249_11197667
832 Ga0105239_11001866
833 Ga0105239_13077266
834 Ga0105246_10036978
835 Ga0105246_10039973
836 Ga0157373_10045914
837 Ga0157370_10064765
838 Ga0157369_10006391
839 Ga0157369_10093950
840 Ga0157369_10550415
841 Ga0157374_10076782
842 Ga0157378_10453357
843 Ga0157378_11033211
844 Ga0157378_11117978
845 Ga0163162_10123733
846 Ga0163162_10370935
847 Ga0157372_10089816
848 Ga0157375_10023869
849 Ga0157375_10778514
850 Ga0157375_10958914
851 Ga0163163_10234452
852 Ga0163163_10390936
853 Ga0163163_10528637
854 Ga0157380_10061376
855 Ga0182008_10032607
856 Ga0182008_10306443
857 Ga0157377_10007906
858 Ga0157377_10215761
859 Ga0157377_10534335
860 Ga0157377_10990699
861 Ga0157379_10168554
862 Ga0157379_10494407
863 Ga0157379_11106703
864 Ga0157376_10295368
865 Ga0157376_10310580
866 Ga0157376_11444505
867 Ga0163161_10146165
868 Ga0163161_10362277
869 Ga0163161_10688606
870 Ga0163161_11553505
871 Ga0197907_10082848
872 Ga0197907_10988801
873 Ga0206356_10898175
874 Ga0206350_10879203
875 Ga0206354_10123109
876 Ga0206353_10440267
877 Ga0213873_10055886
878 Ga0213876_10044247
879 Ga0213876_10210194
880 Ga0213876_10467518
881 Ga0224712_10006104
882 Ga0224712_10084619
883 Ga0207682_10069071
884 Ga0207692_11060847
885 Ga0207642_10009885
886 Ga0207688_10004008
887 Ga0207688_10211537
888 Ga0207688_10298440
889 Ga0207688_10567633
890 Ga0207699_10219939
891 Ga0207645_10223891
892 Ga0207645_10225168
893 Ga0207643_10034181
894 Ga0207643_10039994
895 Ga0207705_10448704
896 Ga0207684_10221936
897 Ga0207684_10467213
898 Ga0207707_10203980
899 Ga0207695_10139522
900 Ga0207695_11508291
901 Ga0207693_10024171
902 Ga0207693_10053613
903 Ga0207693_10270483
904 Ga0207693_10373016
905 Ga0207663_10005888
906 Ga0207663_10153286
907 Ga0207663_10227936
908 Ga0207663_10638236
909 Ga0207662_11362309
910 Ga0207657_10014232
911 Ga0207657_10100202
912 Ga0207649_10215766
913 Ga0207649_10217282
914 Ga0207652_10292198
915 Ga0207652_10654255
916 Ga0207646_10106571
917 Ga0207646_10202557
918 Ga0207694_10412077
919 Ga0207650_10004674
920 Ga0207650_10119058
921 Ga0207659_10120039
922 Ga0207659_10264868
923 Ga0207687_10053135
924 Ga0207687_10081323
925 Ga0207687_10359257
926 Ga0207687_10372455
927 Ga0207687_10600758
928 Ga0207664_10027992
929 Ga0207664_11710208
930 Ga0207690_10816057
931 Ga0207690_11665208
932 Ga0207706_10016211
933 Ga0207706_10304398
934 Ga0207686_10363141
935 Ga0207686_10411529
936 Ga0207686_10540417
937 Ga0207709_10085529
938 Ga0207709_10183628
939 Ga0207709_11644043
940 Ga0207670_10072483
941 Ga0207670_10194648
942 Ga0207669_10074234
943 Ga0207669_10781340
944 Ga0207704_10124310
945 Ga0207704_10434293
946 Ga0207691_10125140
947 Ga0207661_10026503
948 Ga0207661_10203974
949 Ga0207667_10112501
950 Ga0207651_11026852
951 Ga0207712_10076244
952 Ga0207712_11321051
953 Ga0207668_10553252
954 Ga0207668_11863127
955 Ga0207640_10188289
956 Ga0207640_10464972
957 Ga0207658_12142964
958 Ga0207677_10693274
959 Ga0207677_10697565
960 Ga0207678_10267507
961 Ga0207678_11197476
962 Ga0207678_11240803
963 Ga0207708_10004461
964 Ga0207708_10015907
965 Ga0207708_10018783
966 Ga0207708_10571515
967 Ga0207708_10604979
968 Ga0207708_10653975
969 Ga0207702_10052239
970 Ga0207641_10396653
971 Ga0207648_10097405
972 Ga0207676_10052508
973 Ga0207676_10102538
974 Ga0207674_10047094
975 Ga0207674_10048883
976 Ga0207674_10389308
977 Ga0207674_11004231
978 Ga0207683_10155093
979 Ga0207698_10271604
980 Ga0207698_10380547
981 Ga0207428_10074149
982 Ga0207428_10089990
983 Ga0207428_10149895
984 Ga0268266_10168678
985 Ga0268265_11042014
986 Ga0265318_10001338
987 Ga0265323_10068874
988 Ga0265336_10127220
989 Ga0265338_10024643
990 Ga0265325_10020692
991 Ga0265340_10016190
992 Ga0265339_10262175
993 Ga0265327_10130344
994 Ga0265314_10003041
995 Ga0307413_10191937
996 Ga0307410_10369748
997 Ga0307410_10436297
998 Ga0307406_10011878
999 Ga0307407_10156362
1000 Ga0307409_100097298
1001 Ga0307409_101620127
1002 Ga0307416_103359655
1003 Ga0307411_10159474
1004 Ga0307415_100069096
1005 Ga0373948_0134812
1006 Ga0373944_0253202
1007 Ga0373932_0278357
1008 Ga0373945_0009721
1009 Ga0373945_0264717
1010 Ga0373953_0174541
1011 Ga0373957_0101743
1012 Ga0373943_0025689
1013 Ga0373955_0023341
1014 Ga0373942_0374525
1015 Ga0373931_0667317
1016 Ga0373927_0465558
1017 Ga0373933_0665097
1018 Ga0373947_0008872
1019 Ga0373947_0018602
1020 Ga0373937_0019256
1021 Ga0373937_0046355
1022 Ga0373925_0636141
1023 Ga0395899_0065842
1024 Ga0395900_0085793
1025 Ga0395900_0544157
1026 Ga0395898_0006285
1027 Ga0395898_0053164
1028 Ga0395898_0209637
1029 Ga0395905_0009137
1030 Ga0395905_0031831
1031 Ga0395905_0051835
1032 Ga0395901_0137729
1033 Ga0395901_0160073
1034 Ga0395901_0688834
1035 Ga0436365_0058952
1036 Ga0436365_0143973
1037 Ga0436365_0248508
1038 Ga0436365_0861017
1039 Ga0436365_1508828
1040 Ga0436363_1610031
1041 Ga0436362_1056279
1042 Ga0451849_1368384
1043 Ga0451855_1108427
1044 Ga0466966_0235695
1045 Ga0466963_0287993
1046 Ga0451576_0375522
1047 Ga0466967_0051294
1048 Ga0466967_0074652
1049 Ga0466967_0309373
1050 Ga0466967_1870012
1051 Ga0495592_0090155
1052 Ga0495603_0026104
1053 Ga0495603_0042380
1054 Ga0495603_0603527
1055 Ga0495629_0077601
1056 Ga0495629_0293548
1057 Ga0495641_0014098
1058 Ga0495641_0021531
1059 Ga0495641_0248421
1060 Ga0495651_0104608
1061 Ga0495651_0217448
1062 Ga0495653_0019338
1063 Ga0495653_0024967
1064 Ga0495580_0043545
1065 Ga0495582_0019645
1066 Ga0495582_0051481
1067 Ga0495605_0270539
1068 Ga0495639_0000860
1069 Ga0495639_0746700
1070 Ga0495662_0001129
1071 Ga0495664_0292888
1072 Ga0495594_0009237
1073 Ga0495594_0027804
1074 Ga0495596_0110418
1075 Ga0495608_0016564
1076 Ga0495608_0077641
1077 Ga0495618_0141848
1078 Ga0495618_0176146
1079 Ga0495628_0019390
1080 Ga0495628_0188894
1081 Ga0495630_0032628
1082 Ga0495630_0114390
1083 Ga0495666_0008748
1084 Ga0495652_0103537
1085 Ga0495652_0667464
1086 Ga0495665_0040059
1087 Ga0495640_0012827
1088 Ga0495640_0209750
1089 Ga0495587_0008513
1090 Ga0495587_0228781
1091 Ga0495645_0630769
1092 Ga0495667_0067555
1093 Ga0495667_0101214
1094 Ga0495656_0720601
1095 Ga0495634_0003038
1096 Ga0495634_0226411
1097 Ga0495635_0040325
1098 Ga0495635_0082353
1099 Ga0495588_0010588
1100 Ga0495657_0012342
1101 Ga0495657_0035779
1102 Ga0495599_0174254
1103 Ga0495599_0181139
1104 Ga0495599_0189180
1105 Ga0495623_0011387
1106 Ga0495646_0076814
1107 Ga0495647_0009782
1108 Ga0495658_0023800
1109 Ga0495658_0410192
1110 Ga0495613_0963998
1111 Ga0495624_0018736
1112 Ga0495600_0031967
1113 Ga0495600_0082532
1114 Ga0495600_0096701
1115 Ga0495581_0002982
1116 Ga0495581_0086530
1117 Ga0495604_0019379
1118 Ga0495604_0156041
1119 Ga0495674_0028591
1120 Ga0495674_0788418
1121 Ga0495676_0050544
1122 Ga0495676_0053418
1123 Ga0495676_0072532
1124 Ga0495676_0310484
1125 Ga0495680_0029851
1126 Ga0495675_0035914
1127 Ga0495684_0575457
1128 Ga0495593_0003057
1129 Ga0495602_0028115
1130 Ga0495602_0480492
1131 Ga0495614_0005196
1132 Ga0496100_0279470
1133 Ga0496100_0830263
1134 Ga0496101_0007909
1135 Ga0496101_0097360
1136 Ga0496101_0164936
1137 Ga0496101_0317688
1138 Ga0496102_0729562
1139 Ga0496102_0793155
1140 Ga0496102_1399463
1141 Ga0496102_1658472
1142 Ga0496103_0130749
1143 Ga0496103_0365129
1144 Ga0496104_0000329
1145 Ga0496104_0020636
1146 Ga0496104_1036143
1147 Ga0496105_0000128
1148 Ga0496105_0025579
1149 Ga0496105_0065873
1150 Ga0496105_0096786
1151 Ga0496105_0190744
1152 Ga0496106_0352419
1153 Ga0496107_0568206
1154 Ga0496108_0003277
1155 Ga0496108_0011668
1156 Ga0496108_0045870
1157 Ga0496108_0047503
1158 Ga0496109_0001074
1159 Ga0496109_0021992
1160 Ga0496109_0037349
1161 Ga0496109_1801441
1162 Ga0496110_0000072
1163 Ga0496110_0005532
1164 Ga0496110_1002629
1165 Ga0496111_0006668
1166 Ga0496111_0121336
1167 Ga0496111_0581334
1168 Ga0496112_0000825
1169 Ga0496112_0291168
1170 Ga0496112_0501212
1171 Ga0496112_1560680
1172 Ga0496113_0072492
1173 Ga0496113_0117590
1174 Ga0496114_0010251
1175 Ga0496114_0017409
1176 Ga0496114_0034912
1177 Ga0496114_0232809
1178 Ga0496114_0261477
1179 Ga0496114_0478358
1180 Ga0496115_0000319
1181 Ga0496115_0118725
1182 Ga0496115_1242220
1183 Ga0501031_0113866
1184 Ga0501033_0287930
1185 Ga0501036_0032237
1186 Ga0501036_0036181
1187 Ga0501037_0104278
1188 Ga0501037_0414687
1189 Ga0501038_0045947
1190 Ga0501038_0193765
1191 Ga0501039_0071915
1192 Ga0501040_0060606
1193 Ga0501041_0001853
1194 Ga0501042_0013127
1195 Ga0501042_0143445
1196 Ga0501043_0083464
1197 Ga0501043_0139451
1198 Ga0501046_0029995
1199 Ga0501048_0018140
1200 Ga0501048_0021855
1201 Ga0501067_0000362
1202 Ga0501068_0000450
1203 Ga0501068_0028455
1204 Ga0501068_0091092
1205 Ga0501068_0461363
1206 Ga0501069_0001047
1207 Ga0501069_0341270
1208 Ga0501069_0962889
1209 Ga0501070_0018157
1210 Ga0501071_0024582
1211 Ga0501071_0045623
1212 Ga0501071_1512978
1213 Ga0501072_0459943
1214 Ga0501074_0300370
1215 Ga0501074_0654141
1216 Ga0501075_0000756
1217 Ga0501075_0011969
1218 Ga0501076_0026916
1219 Ga0501077_0017511
1220 Ga0501077_0351638
1221 Ga0501079_0009716
1222 Ga0501079_0038520
1223 Ga0501079_0734743
1224 Ga0501080_0153122
1225 Ga0501080_0736445
1226 Ga0501081_0011978
1227 Ga0501081_0012134
1228 Ga0501081_0490416
1229 Ga0501081_0640766
1230 Ga0501083_0095191
1231 Ga0501083_0122416
1232 Ga0501283_128570
1233 Ga0501035_0396747
1234 Ga0501035_0457872
1235 Ga0501044_0479806
1236 Ga0501044_0736036
1237 Ga0501045_0007759
1238 Ga0501045_0028695
1239 nmdc:mga0yw44_489289_c1
1240 nmdc:mga05p37_21763_c1
1241 nmdc:mga05p37_30316_c1
1242 nmdc:mga05p37_662087_c1
1243 nmdc:mga0qj67_844618_c1
1244 nmdc:mga06r32_139506_c1
1245 nmdc:mga06r32_1704409_c1
1246 nmdc:mga06r32_757116_c1
1247 nmdc:mga08y16_14222_c1
1248 nmdc:mga08y16_143958_c1
1249 nmdc:mga0n895_36107_c1
1250 nmdc:mga0n895_614058_c1
1251 nmdc:mga0n895_645837_c1
1252 nmdc:mga0rr50_158249_c1
1253 nmdc:mga0rr50_251108_c1
1254 nmdc:mga0rr50_276292_c1
1255 nmdc:mga0rr50_770108_c1
1256 nmdc:mga08x19_12784_c1
1257 nmdc:mga0a205_201140_c1
1258 Ga0495601_0052964
1259 Ga0495601_0057067
1260 Ga0495601_0278465
1261 Ga0495612_0062041
1262 Ga0495612_0091046
1263 Ga0495612_0435311
1264 Ga0495655_0021464
1265 Ga0495655_0326068
1266 Ga0495595_0016406
1267 Ga0495595_0027254
1268 Ga0495619_0091677
1269 Ga0495619_0217524
1270 Ga0495619_0552476
1271 Ga0501084_0008738
1272 Ga0501084_0012113
1273 Ga0590075_210049
1274 Ga0501082_0452754
1275 Ga0466962_0041242
1276 Ga0530510_0002358
1277 Ga0530510_0017741
1278 Ga0530510_0019458
1279 Ga0530510_0147488
1280 Ga0530510_0851391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.953 1 130
4uxa-assembly3.cif.gz_R improved variant of (r)-selective manganese-dependent hydroxynitrile lyase from bacteria 0.9454 1 130
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.9387 1 130
4uxa-assembly3.cif.gz_R improved variant of (r)-selective manganese-dependent hydroxynitrile lyase from bacteria 0.9312 1 130
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9295 22 112
ID Description Score Start End Superfamily
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9556 1 130 2.60.120.10
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9412 1 130 2.60.120.10
2f4pA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9364 11 132 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8966 32 108 2.60.120.10
af_A0A0R0L0M3_22_151_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8907 36 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q6DG11-F1-model_v4 deleted 1 36 134
AF-A0A659YKM7-F1-model_v4 deleted 0.9985 40 126
AF-C1DR48-F1-model_v4 Cupin type-2 domain-containing protein 0.9974 27 130
AF-A0A4Q3QCU4-F1-model_v4 deleted 0.9965 36 130
AF-A0A530NJX1-F1-model_v4 deleted 0.9964 13 130

Map