F471724
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 640 | 331 | 614 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0218366|Ga0495686_0218366_365_1015 |
| Length | 216 |
| Sequence | MLKLVIGNKNYSSWSMRPWLALRANNIPFEEVLIHLYTDNPADKQRILSFSDAGKVPALVDGDVTVWDSLSIIEYLAEKFPQAKLWPEDRAARAHARSISAEMHSGFMALRNECGMNLHRPIRPVAMSDDALANVARIQAIWAECHQRYGGPFLFGAFGGADAMFAPVIHRFRTYAIPIPDKARHYVDAMDALPAFQQWTREGLAETWLIDRLEAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 4 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 5 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 6 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 7 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 8 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 9 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 10 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 11 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 12 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 13 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 14 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 15 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 16 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 17 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 18 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 19 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 20 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 131 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 132 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 133 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 141 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 142 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 152 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 153 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 177 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 179 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 180 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 259 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 260 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 261 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 262 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 263 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 264 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 265 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 297 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 300 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 301 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 302 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 304 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 306 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 307 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 308 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 309 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 310 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 311 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 313 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 315 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 316 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 317 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 318 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 319 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 320 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 322 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 324 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 325 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 329 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 330 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 331 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.08 |
| Metatranscriptomes | 0.16 |
| Isolates | 3.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.75 |
| Nodule | 3.12 |
| Rhizoplane | 7.5 |
| Rhizosphere | 71.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10009572 | 3300001989 | Bacteria | 3607 |
| 2 | JGI25406J46586_10000026 | 3300003203 | Bacteria | 70727 |
| 3 | Ga0065165_1017395 | 3300005262 | Bacteria | 2651 |
| 4 | Ga0070658_10349963 | 3300005327 | Bacteria | 1264 |
| 5 | Ga0070658_10456154 | 3300005327 | Bacteria | 1102 |
| 6 | Ga0070658_10655200 | 3300005327 | Bacteria | 911 |
| 7 | Ga0070683_100006084 | 3300005329 | Bacteria | 10117 |
| 8 | Ga0070683_100690191 | 3300005329 | Bacteria | 978 |
| 9 | Ga0070683_100947881 | 3300005329 | Bacteria | 826 |
| 10 | Ga0070680_100034532 | 3300005336 | Bacteria | 4077 |
| 11 | Ga0070680_100158688 | 3300005336 | Bacteria | 1900 |
| 12 | Ga0070680_100294497 | 3300005336 | Bacteria | 1376 |
| 13 | Ga0070660_100010127 | 3300005339 | Bacteria | 6654 |
| 14 | Ga0070660_100043237 | 3300005339 | Bacteria | 3442 |
| 15 | Ga0070660_100089916 | 3300005339 | Bacteria | 2420 |
| 16 | Ga0070660_100237406 | 3300005339 | Bacteria | 1484 |
| 17 | Ga0070689_100153675 | 3300005340 | Bacteria | 1857 |
| 18 | Ga0070691_10081942 | 3300005341 | Bacteria | 1581 |
| 19 | Ga0070659_100097120 | 3300005366 | Bacteria | 2367 |
| 20 | Ga0070659_100108418 | 3300005366 | Bacteria | 2240 |
| 21 | Ga0070709_10000449 | 3300005434 | Bacteria | 24812 |
| 22 | Ga0070709_10016820 | 3300005434 | Bacteria | 4184 |
| 23 | Ga0070714_100018483 | 3300005435 | Bacteria | 5662 |
| 24 | Ga0070714_100039060 | 3300005435 | Bacteria | 3994 |
| 25 | Ga0070713_100004374 | 3300005436 | Bacteria | 9489 |
| 26 | Ga0070713_100011736 | 3300005436 | Bacteria | 6396 |
| 27 | Ga0070713_100106574 | 3300005436 | Bacteria | 2437 |
| 28 | Ga0070710_10000080 | 3300005437 | Bacteria | 43770 |
| 29 | Ga0070710_10000659 | 3300005437 | Bacteria | 16374 |
| 30 | Ga0070711_100002916 | 3300005439 | Bacteria | 9857 |
| 31 | Ga0070711_100008835 | 3300005439 | Bacteria | 6183 |
| 32 | Ga0070711_100024730 | 3300005439 | Bacteria | 3922 |
| 33 | Ga0070711_100037586 | 3300005439 | Bacteria | 3249 |
| 34 | Ga0070663_100007909 | 3300005455 | Bacteria | 6510 |
| 35 | Ga0070662_100464440 | 3300005457 | Bacteria | 1052 |
| 36 | Ga0070681_10338057 | 3300005458 | Bacteria | 1415 |
| 37 | Ga0070681_10368200 | 3300005458 | Bacteria | 1347 |
| 38 | Ga0070706_100262045 | 3300005467 | Bacteria | 1613 |
| 39 | Ga0070679_100161352 | 3300005530 | Bacteria | 2216 |
| 40 | Ga0070679_100423564 | 3300005530 | Bacteria | 1276 |
| 41 | Ga0070679_100546941 | 3300005530 | Bacteria | 1101 |
| 42 | Ga0070684_100001571 | 3300005535 | Bacteria | 16495 |
| 43 | Ga0070684_100016701 | 3300005535 | Bacteria | 6007 |
| 44 | Ga0070684_100029571 | 3300005535 | Bacteria | 4645 |
| 45 | Ga0070684_100369618 | 3300005535 | Bacteria | 1320 |
| 46 | Ga0070684_100393690 | 3300005535 | Bacteria | 1277 |
| 47 | Ga0070697_100182139 | 3300005536 | Bacteria | 1781 |
| 48 | Ga0068853_100023815 | 3300005539 | Bacteria | 5130 |
| 49 | Ga0068853_100067568 | 3300005539 | Bacteria | 3105 |
| 50 | Ga0068853_100083101 | 3300005539 | Bacteria | 2805 |
| 51 | Ga0068853_101091107 | 3300005539 | Bacteria | 769 |
| 52 | Ga0070686_100348299 | 3300005544 | Bacteria | 1112 |
| 53 | Ga0070693_100081558 | 3300005547 | Bacteria | 1929 |
| 54 | Ga0068855_100050062 | 3300005563 | Bacteria | 4924 |
| 55 | Ga0068855_100088696 | 3300005563 | Bacteria | 3573 |
| 56 | Ga0068855_100170568 | 3300005563 | Bacteria | 2465 |
| 57 | Ga0068855_100252796 | 3300005563 | Bacteria | 1965 |
| 58 | Ga0068855_100284085 | 3300005563 | Bacteria | 1837 |
| 59 | Ga0068855_100350812 | 3300005563 | Bacteria | 1625 |
| 60 | Ga0070664_100790685 | 3300005564 | Bacteria | 887 |
| 61 | Ga0068857_100028534 | 3300005577 | Bacteria | 4924 |
| 62 | Ga0068857_100042940 | 3300005577 | Bacteria | 4011 |
| 63 | Ga0068857_100043461 | 3300005577 | Bacteria | 3985 |
| 64 | Ga0068857_100061636 | 3300005577 | Bacteria | 3332 |
| 65 | Ga0068857_100194972 | 3300005577 | Bacteria | 1846 |
| 66 | Ga0068854_100017928 | 3300005578 | Bacteria | 4745 |
| 67 | Ga0068854_100051548 | 3300005578 | Bacteria | 2949 |
| 68 | Ga0068856_100033539 | 3300005614 | Bacteria | 5027 |
| 69 | Ga0068856_100038823 | 3300005614 | Bacteria | 4674 |
| 70 | Ga0068856_100092345 | 3300005614 | Bacteria | 3012 |
| 71 | Ga0070702_100361608 | 3300005615 | Bacteria | 1026 |
| 72 | Ga0068852_100157062 | 3300005616 | Bacteria | 2120 |
| 73 | Ga0068852_100157696 | 3300005616 | Bacteria | 2116 |
| 74 | Ga0068852_100672476 | 3300005616 | Bacteria | 1044 |
| 75 | Ga0068852_100698085 | 3300005616 | Bacteria | 1025 |
| 76 | Ga0068866_10105260 | 3300005718 | Bacteria | 1564 |
| 77 | Ga0068851_10001148 | 3300005834 | Bacteria | 11480 |
| 78 | Ga0068851_10023052 | 3300005834 | Bacteria | 3039 |
| 79 | Ga0068858_100291476 | 3300005842 | Bacteria | 1556 |
| 80 | Ga0068860_100000149 | 3300005843 | Bacteria | 113068 |
| 81 | Ga0068862_100698830 | 3300005844 | Bacteria | 982 |
| 82 | Ga0081455_10004867 | 3300005937 | Bacteria | 14894 |
| 83 | Ga0081539_10000176 | 3300005985 | Bacteria | 150292 |
| 84 | Ga0070717_10053019 | 3300006028 | Bacteria | 3342 |
| 85 | Ga0075365_10039589 | 3300006038 | Bacteria | 3070 |
| 86 | Ga0075365_10063725 | 3300006038 | Bacteria | 2468 |
| 87 | Ga0075363_100087660 | 3300006048 | Bacteria | 1710 |
| 88 | Ga0075363_100153552 | 3300006048 | Bacteria | 1300 |
| 89 | Ga0075364_10035290 | 3300006051 | Bacteria | 3231 |
| 90 | Ga0075364_10256444 | 3300006051 | Bacteria | 1189 |
| 91 | Ga0070715_10002233 | 3300006163 | Bacteria | 5884 |
| 92 | Ga0070715_10043149 | 3300006163 | Bacteria | 1900 |
| 93 | Ga0070716_100016662 | 3300006173 | Bacteria | 3797 |
| 94 | Ga0070712_100069962 | 3300006175 | Bacteria | 2505 |
| 95 | Ga0070712_100145447 | 3300006175 | Bacteria | 1814 |
| 96 | Ga0070712_100847893 | 3300006175 | Bacteria | 786 |
| 97 | Ga0075367_10089186 | 3300006178 | Bacteria | 1875 |
| 98 | Ga0075367_10305603 | 3300006178 | Bacteria | 1001 |
| 99 | Ga0075369_10018014 | 3300006186 | Bacteria | 2871 |
| 100 | Ga0097621_100111977 | 3300006237 | Bacteria | 2307 |
| 101 | Ga0075370_10029487 | 3300006353 | Bacteria | 3057 |
| 102 | Ga0068871_100109013 | 3300006358 | Bacteria | 2327 |
| 103 | Ga0099822_1000400 | 3300006943 | Bacteria | 38677 |
| 104 | Ga0099794_10012128 | 3300007265 | Bacteria | 3708 |
| 105 | Ga0099794_10015218 | 3300007265 | Bacteria | 3391 |
| 106 | Ga0105250_10119756 | 3300009092 | Bacteria | 1081 |
| 107 | Ga0105240_10020104 | 3300009093 | Bacteria | 8914 |
| 108 | Ga0105240_10054780 | 3300009093 | Bacteria | 4996 |
| 109 | Ga0105240_10087114 | 3300009093 | Bacteria | 3825 |
| 110 | Ga0105240_10092299 | 3300009093 | Bacteria | 3697 |
| 111 | Ga0105240_10472136 | 3300009093 | Bacteria | 1400 |
| 112 | Ga0105245_10407659 | 3300009098 | Bacteria | 1360 |
| 113 | Ga0105247_10025759 | 3300009101 | Bacteria | 3550 |
| 114 | Ga0105241_10004323 | 3300009174 | Bacteria | 10508 |
| 115 | Ga0105241_10221508 | 3300009174 | Bacteria | 1590 |
| 116 | Ga0105242_10095071 | 3300009176 | Bacteria | 2515 |
| 117 | Ga0105248_10154194 | 3300009177 | Bacteria | 2592 |
| 118 | Ga0105237_10029701 | 3300009545 | Bacteria | 5554 |
| 119 | Ga0105237_10037282 | 3300009545 | Bacteria | 4916 |
| 120 | Ga0105237_10054428 | 3300009545 | Bacteria | 4009 |
| 121 | Ga0105237_10219727 | 3300009545 | Bacteria | 1900 |
| 122 | Ga0105238_10011154 | 3300009551 | Bacteria | 9038 |
| 123 | Ga0105238_10011212 | 3300009551 | Bacteria | 9017 |
| 124 | Ga0105238_10016910 | 3300009551 | Bacteria | 7402 |
| 125 | Ga0105238_10152115 | 3300009551 | Bacteria | 2289 |
| 126 | Ga0105249_10413799 | 3300009553 | Bacteria | 1381 |
| 127 | Ga0105249_10743664 | 3300009553 | Bacteria | 1043 |
| 128 | Ga0105239_10003480 | 3300010375 | Bacteria | 19264 |
| 129 | Ga0105239_10013429 | 3300010375 | Bacteria | 9100 |
| 130 | Ga0105239_10060036 | 3300010375 | Bacteria | 4173 |
| 131 | Ga0105239_10075501 | 3300010375 | Bacteria | 3706 |
| 132 | Ga0105239_10170516 | 3300010375 | Bacteria | 2433 |
| 133 | Ga0105239_10762030 | 3300010375 | Bacteria | 1108 |
| 134 | Ga0157369_10002568 | 3300013105 | Bacteria | 21726 |
| 135 | Ga0157369_10005939 | 3300013105 | Bacteria | 14174 |
| 136 | Ga0157369_10006143 | 3300013105 | Bacteria | 13941 |
| 137 | Ga0157369_10007826 | 3300013105 | Bacteria | 12301 |
| 138 | Ga0157374_10086392 | 3300013296 | Bacteria | 2984 |
| 139 | Ga0157378_10003347 | 3300013297 | Bacteria | 14261 |
| 140 | Ga0163162_10169001 | 3300013306 | Bacteria | 2311 |
| 141 | Ga0157372_10310660 | 3300013307 | Bacteria | 1835 |
| 142 | Ga0157375_10270261 | 3300013308 | Bacteria | 1862 |
| 143 | Ga0213876_10066783 | 3300021384 | Bacteria | 1899 |
| 144 | Ga0209130_1018991 | 3300025284 | Bacteria | 1604 |
| 145 | Ga0209564_1001156 | 3300025295 | Bacteria | 30779 |
| 146 | Ga0207656_10074735 | 3300025321 | Bacteria | 1513 |
| 147 | Ga0207656_10126263 | 3300025321 | Bacteria | 1195 |
| 148 | Ga0207696_1063848 | 3300025711 | Bacteria | 1031 |
| 149 | Ga0207692_10009474 | 3300025898 | Bacteria | 4071 |
| 150 | Ga0207692_10009749 | 3300025898 | Bacteria | 4022 |
| 151 | Ga0207692_10017192 | 3300025898 | Bacteria | 3220 |
| 152 | Ga0207642_10161128 | 3300025899 | Bacteria | 1205 |
| 153 | Ga0207710_10084874 | 3300025900 | Bacteria | 1474 |
| 154 | Ga0207647_10002180 | 3300025904 | Bacteria | 14930 |
| 155 | Ga0207647_10185340 | 3300025904 | Bacteria | 1207 |
| 156 | Ga0207685_10058283 | 3300025905 | Bacteria | 1518 |
| 157 | Ga0207685_10169893 | 3300025905 | Bacteria | 1003 |
| 158 | Ga0207685_10397508 | 3300025905 | Bacteria | 706 |
| 159 | Ga0207699_10000664 | 3300025906 | Bacteria | 16532 |
| 160 | Ga0207699_10006869 | 3300025906 | Bacteria | 5535 |
| 161 | Ga0207699_10018796 | 3300025906 | Bacteria | 3670 |
| 162 | Ga0207705_10249984 | 3300025909 | Bacteria | 1352 |
| 163 | Ga0207684_10335802 | 3300025910 | Bacteria | 1301 |
| 164 | Ga0207654_10000723 | 3300025911 | Bacteria | 18445 |
| 165 | Ga0207707_10002488 | 3300025912 | Bacteria | 16584 |
| 166 | Ga0207707_10010888 | 3300025912 | Bacteria | 7905 |
| 167 | Ga0207707_10392525 | 3300025912 | Bacteria | 1192 |
| 168 | Ga0207695_10000883 | 3300025913 | Bacteria | 54495 |
| 169 | Ga0207695_10024523 | 3300025913 | Bacteria | 6781 |
| 170 | Ga0207695_10069306 | 3300025913 | Bacteria | 3609 |
| 171 | Ga0207695_10183611 | 3300025913 | Bacteria | 2012 |
| 172 | Ga0207671_10067887 | 3300025914 | Bacteria | 2656 |
| 173 | Ga0207671_10294887 | 3300025914 | Bacteria | 1281 |
| 174 | Ga0207693_10000647 | 3300025915 | Bacteria | 31175 |
| 175 | Ga0207693_10011883 | 3300025915 | Bacteria | 7039 |
| 176 | Ga0207693_10016920 | 3300025915 | Bacteria | 5823 |
| 177 | Ga0207663_10001551 | 3300025916 | Bacteria | 10758 |
| 178 | Ga0207663_10006601 | 3300025916 | Bacteria | 5958 |
| 179 | Ga0207663_10373606 | 3300025916 | Bacteria | 1084 |
| 180 | Ga0207663_10573486 | 3300025916 | Bacteria | 884 |
| 181 | Ga0207660_10098743 | 3300025917 | Bacteria | 2178 |
| 182 | Ga0207660_10233563 | 3300025917 | Bacteria | 1446 |
| 183 | Ga0207657_10002501 | 3300025919 | Bacteria | 19880 |
| 184 | Ga0207657_10020762 | 3300025919 | Bacteria | 6200 |
| 185 | Ga0207657_10173149 | 3300025919 | Bacteria | 1748 |
| 186 | Ga0207652_10046496 | 3300025921 | Bacteria | 3703 |
| 187 | Ga0207652_10180671 | 3300025921 | Bacteria | 1896 |
| 188 | Ga0207652_10337782 | 3300025921 | Bacteria | 1360 |
| 189 | Ga0207652_10446680 | 3300025921 | Bacteria | 1166 |
| 190 | Ga0207694_10000436 | 3300025924 | Bacteria | 38791 |
| 191 | Ga0207694_10023201 | 3300025924 | Bacteria | 4711 |
| 192 | Ga0207694_10024072 | 3300025924 | Bacteria | 4624 |
| 193 | Ga0207694_10373829 | 3300025924 | Bacteria | 1182 |
| 194 | Ga0207700_10003574 | 3300025928 | Bacteria | 9057 |
| 195 | Ga0207700_10173994 | 3300025928 | Bacteria | 1798 |
| 196 | Ga0207700_10211758 | 3300025928 | Bacteria | 1639 |
| 197 | Ga0207700_10266657 | 3300025928 | Bacteria | 1468 |
| 198 | Ga0207664_10160156 | 3300025929 | Bacteria | 1919 |
| 199 | Ga0207706_10182208 | 3300025933 | Bacteria | 1844 |
| 200 | Ga0207706_10308617 | 3300025933 | Bacteria | 1378 |
| 201 | Ga0207670_10167281 | 3300025936 | Bacteria | 1646 |
| 202 | Ga0207665_10000363 | 3300025939 | Bacteria | 31449 |
| 203 | Ga0207665_10011531 | 3300025939 | Bacteria | 5806 |
| 204 | Ga0207711_10087811 | 3300025941 | Bacteria | 2729 |
| 205 | Ga0207711_11246893 | 3300025941 | Bacteria | 685 |
| 206 | Ga0207661_10001325 | 3300025944 | Bacteria | 16574 |
| 207 | Ga0207661_10005117 | 3300025944 | Bacteria | 9206 |
| 208 | Ga0207667_10020643 | 3300025949 | Bacteria | 7321 |
| 209 | Ga0207667_10021642 | 3300025949 | Bacteria | 7124 |
| 210 | Ga0207667_10022504 | 3300025949 | Bacteria | 6960 |
| 211 | Ga0207667_10162014 | 3300025949 | Bacteria | 2300 |
| 212 | Ga0207667_10619745 | 3300025949 | Bacteria | 1090 |
| 213 | Ga0207667_11009989 | 3300025949 | Bacteria | 819 |
| 214 | Ga0207712_10151871 | 3300025961 | Bacteria | 1790 |
| 215 | Ga0207640_10069528 | 3300025981 | Bacteria | 2364 |
| 216 | Ga0207639_10011261 | 3300026041 | Bacteria | 6205 |
| 217 | Ga0207639_10023096 | 3300026041 | Bacteria | 4487 |
| 218 | Ga0207639_10039677 | 3300026041 | Bacteria | 3509 |
| 219 | Ga0207639_10100001 | 3300026041 | Bacteria | 2341 |
| 220 | Ga0207678_10027223 | 3300026067 | Bacteria | 4986 |
| 221 | Ga0207678_10043518 | 3300026067 | Bacteria | 3885 |
| 222 | Ga0207678_10059796 | 3300026067 | Bacteria | 3279 |
| 223 | Ga0207678_10631457 | 3300026067 | Bacteria | 940 |
| 224 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 225 | Ga0207702_10012374 | 3300026078 | Bacteria | 7105 |
| 226 | Ga0207702_10073160 | 3300026078 | Bacteria | 2955 |
| 227 | Ga0207641_10235150 | 3300026088 | Bacteria | 1705 |
| 228 | Ga0207674_10007127 | 3300026116 | Bacteria | 13063 |
| 229 | Ga0207674_10010385 | 3300026116 | Bacteria | 10553 |
| 230 | Ga0207674_10029991 | 3300026116 | Bacteria | 5722 |
| 231 | Ga0207674_10144065 | 3300026116 | Bacteria | 2342 |
| 232 | Ga0207698_10054304 | 3300026142 | Bacteria | 3082 |
| 233 | Ga0207698_10128401 | 3300026142 | Bacteria | 2161 |
| 234 | Ga0207698_10338583 | 3300026142 | Bacteria | 1416 |
| 235 | Ga0207698_10480251 | 3300026142 | Bacteria | 1205 |
| 236 | Ga0209589_1000030 | 3300027357 | Bacteria | 147457 |
| 237 | Ga0209489_100056 | 3300027361 | Bacteria | 147457 |
| 238 | Ga0209700_100059 | 3300027363 | Bacteria | 147457 |
| 239 | Ga0209588_1038833 | 3300027671 | Bacteria | 1534 |
| 240 | Ga0268264_10000084 | 3300028381 | Bacteria | 242128 |
| 241 | Ga0265334_10018317 | 3300028573 | Bacteria | 2888 |
| 242 | Ga0307517_10000369 | 3300028786 | Bacteria | 77795 |
| 243 | Ga0307515_10256857 | 3300028794 | Bacteria | 1490 |
| 244 | Ga0265762_1037889 | 3300030760 | Bacteria | 935 |
| 245 | Ga0265330_10022725 | 3300031235 | Bacteria | 2853 |
| 246 | Ga0265330_10034706 | 3300031235 | Bacteria | 2252 |
| 247 | Ga0265330_10127812 | 3300031235 | Bacteria | 1082 |
| 248 | Ga0265328_10118074 | 3300031239 | Bacteria | 988 |
| 249 | Ga0265325_10035637 | 3300031241 | Bacteria | 2641 |
| 250 | Ga0265340_10020650 | 3300031247 | Bacteria | 3381 |
| 251 | Ga0265339_10121087 | 3300031249 | Bacteria | 1345 |
| 252 | Ga0265331_10035443 | 3300031250 | Bacteria | 2455 |
| 253 | Ga0265331_10118534 | 3300031250 | Bacteria | 1211 |
| 254 | Ga0265316_10146308 | 3300031344 | Bacteria | 1772 |
| 255 | Ga0265316_10326938 | 3300031344 | Bacteria | 1113 |
| 256 | Ga0307513_10267916 | 3300031456 | Bacteria | 1493 |
| 257 | Ga0307508_10000105 | 3300031616 | Bacteria | 99107 |
| 258 | Ga0307508_10116949 | 3300031616 | Bacteria | 2268 |
| 259 | Ga0307412_10241517 | 3300031911 | Bacteria | 1397 |
| 260 | Ga0307416_100230194 | 3300032002 | Bacteria | 1786 |
| 261 | Ga0307411_10395675 | 3300032005 | Bacteria | 1141 |
| 262 | Ga0307510_10074942 | 3300033180 | Bacteria | 3339 |
| 263 | Ga0373930_0008382 | 3300034816 | Bacteria | 1808 |
| 264 | Ga0373944_0071192 | 3300035089 | Bacteria | 1133 |
| 265 | Ga0373923_0008394 | 3300035111 | Bacteria | 3680 |
| 266 | Ga0373923_0063252 | 3300035111 | Bacteria | 1576 |
| 267 | Ga0373936_0131145 | 3300035113 | Bacteria | 1077 |
| 268 | Ga0373945_0004061 | 3300035116 | Bacteria | 4633 |
| 269 | Ga0373953_0000405 | 3300035117 | Bacteria | 11701 |
| 270 | Ga0373953_0059988 | 3300035117 | Bacteria | 1554 |
| 271 | Ga0373954_0000641 | 3300035118 | Bacteria | 13365 |
| 272 | Ga0373956_0000314 | 3300035119 | Bacteria | 19632 |
| 273 | Ga0373956_0092070 | 3300035119 | Bacteria | 1399 |
| 274 | Ga0373957_0011607 | 3300035120 | Bacteria | 2946 |
| 275 | Ga0373943_0107787 | 3300035170 | Bacteria | 1465 |
| 276 | Ga0373955_0000682 | 3300035172 | Bacteria | 14514 |
| 277 | Ga0373955_0094371 | 3300035172 | Bacteria | 1709 |
| 278 | Ga0373924_0002550 | 3300035410 | Bacteria | 6148 |
| 279 | Ga0373924_0007083 | 3300035410 | Bacteria | 4037 |
| 280 | Ga0373935_0071425 | 3300035692 | Bacteria | 2239 |
| 281 | Ga0373927_0001312 | 3300035695 | Bacteria | 18818 |
| 282 | Ga0373927_0002880 | 3300035695 | Bacteria | 12527 |
| 283 | Ga0373927_0020857 | 3300035695 | Bacteria | 4295 |
| 284 | Ga0373927_0041727 | 3300035695 | Bacteria | 2975 |
| 285 | Ga0373933_0001839 | 3300035724 | Bacteria | 12283 |
| 286 | Ga0373933_0014885 | 3300035724 | Bacteria | 4330 |
| 287 | Ga0373933_0121851 | 3300035724 | Bacteria | 1634 |
| 288 | Ga0373933_0264560 | 3300035724 | Bacteria | 1109 |
| 289 | Ga0373947_0001076 | 3300035725 | Bacteria | 16737 |
| 290 | Ga0373947_0015602 | 3300035725 | Bacteria | 4364 |
| 291 | Ga0373947_0485904 | 3300035725 | Bacteria | 838 |
| 292 | Ga0373937_0057020 | 3300036401 | Bacteria | 3587 |
| 293 | Ga0373937_0182458 | 3300036401 | Bacteria | 1971 |
| 294 | Ga0373937_0241079 | 3300036401 | Bacteria | 1703 |
| 295 | Ga0373925_0143564 | 3300037068 | Bacteria | 1870 |
| 296 | Ga0373925_0174163 | 3300037068 | Bacteria | 1700 |
| 297 | Ga0373925_0230349 | 3300037068 | Bacteria | 1481 |
| 298 | Ga0373925_0409333 | 3300037068 | Bacteria | 1107 |
| 299 | Ga0395900_0051871 | 3300037418 | Bacteria | 4224 |
| 300 | Ga0395900_0137986 | 3300037418 | Bacteria | 2498 |
| 301 | Ga0395900_0257120 | 3300037418 | Bacteria | 1745 |
| 302 | Ga0395898_0107612 | 3300037466 | Bacteria | 2674 |
| 303 | Ga0395905_0041909 | 3300037471 | Bacteria | 4296 |
| 304 | Ga0436364_0660550 | 3300037853 | Bacteria | 3422 |
| 305 | Ga0436364_0973183 | 3300037853 | Bacteria | 4376 |
| 306 | Ga0395901_0302736 | 3300038443 | Bacteria | 1657 |
| 307 | Ga0436365_0308170 | 3300039437 | Bacteria | 1987 |
| 308 | Ga0436365_0405046 | 3300039437 | Bacteria | 2522 |
| 309 | Ga0436365_1016429 | 3300039437 | Bacteria | 1096 |
| 310 | Ga0436365_1676896 | 3300039437 | Bacteria | 1134 |
| 311 | Ga0436360_0438666 | 3300039438 | Bacteria | 928 |
| 312 | Ga0451804_0023280 | 3300041463 | Bacteria | 1324 |
| 313 | Ga0451841_1402194 | 3300041498 | Bacteria | 1134 |
| 314 | Ga0466969_0088776 | 3300044656 | Bacteria | 1467 |
| 315 | Ga0466963_0258852 | 3300044694 | Bacteria | 1221 |
| 316 | Ga0466959_0013337 | 3300045049 | Bacteria | 5957 |
| 317 | Ga0466967_0010490 | 3300045976 | Bacteria | 6955 |
| 318 | Ga0495592_0002806 | 3300046454 | Bacteria | 12355 |
| 319 | Ga0495592_0012326 | 3300046454 | Bacteria | 6492 |
| 320 | Ga0495592_0109444 | 3300046454 | Bacteria | 1957 |
| 321 | Ga0495603_0002071 | 3300046455 | Bacteria | 11794 |
| 322 | Ga0495603_0003943 | 3300046455 | Bacteria | 8840 |
| 323 | Ga0495603_0040773 | 3300046455 | Bacteria | 2778 |
| 324 | Ga0495603_0188705 | 3300046455 | Bacteria | 1192 |
| 325 | Ga0495629_0000117 | 3300046459 | Bacteria | 70838 |
| 326 | Ga0495629_0000450 | 3300046459 | Bacteria | 34200 |
| 327 | Ga0495629_0082676 | 3300046459 | Bacteria | 2241 |
| 328 | Ga0495638_0029581 | 3300046460 | Bacteria | 3532 |
| 329 | Ga0495641_0011542 | 3300046461 | Bacteria | 5021 |
| 330 | Ga0495651_0003667 | 3300046462 | Bacteria | 11763 |
| 331 | Ga0495651_0043199 | 3300046462 | Bacteria | 3497 |
| 332 | Ga0495651_0156977 | 3300046462 | Bacteria | 1634 |
| 333 | Ga0495651_0193537 | 3300046462 | Bacteria | 1429 |
| 334 | Ga0495653_0001326 | 3300046463 | Bacteria | 19200 |
| 335 | Ga0495653_0012223 | 3300046463 | Bacteria | 7004 |
| 336 | Ga0495580_0074361 | 3300046472 | Bacteria | 2371 |
| 337 | Ga0495580_0334797 | 3300046472 | Bacteria | 1027 |
| 338 | Ga0495582_0000280 | 3300046473 | Bacteria | 28556 |
| 339 | Ga0495639_0001793 | 3300046475 | Bacteria | 9512 |
| 340 | Ga0495662_0054804 | 3300046476 | Bacteria | 1926 |
| 341 | Ga0495662_0104698 | 3300046476 | Bacteria | 1385 |
| 342 | Ga0495664_0018356 | 3300046477 | Bacteria | 4006 |
| 343 | Ga0495664_0025464 | 3300046477 | Bacteria | 3445 |
| 344 | Ga0495664_0048555 | 3300046477 | Bacteria | 2520 |
| 345 | Ga0495664_0096755 | 3300046477 | Bacteria | 1777 |
| 346 | Ga0495585_0195386 | 3300046492 | Bacteria | 1033 |
| 347 | Ga0495607_0039921 | 3300046501 | Bacteria | 2799 |
| 348 | Ga0495583_0179604 | 3300046506 | Bacteria | 867 |
| 349 | Ga0495606_0002759 | 3300046507 | Bacteria | 19690 |
| 350 | Ga0495608_0033261 | 3300046511 | Bacteria | 3486 |
| 351 | Ga0495608_0300036 | 3300046511 | Bacteria | 995 |
| 352 | Ga0495608_0369539 | 3300046511 | Bacteria | 880 |
| 353 | Ga0495610_0073948 | 3300046512 | Bacteria | 1582 |
| 354 | Ga0495610_0117594 | 3300046512 | Bacteria | 1169 |
| 355 | Ga0495616_0022639 | 3300046513 | Bacteria | 3392 |
| 356 | Ga0495618_0026249 | 3300046514 | Bacteria | 3621 |
| 357 | Ga0495618_0044155 | 3300046514 | Bacteria | 2811 |
| 358 | Ga0495618_0395090 | 3300046514 | Bacteria | 846 |
| 359 | Ga0495628_0013297 | 3300046516 | Bacteria | 6924 |
| 360 | Ga0495628_0039220 | 3300046516 | Bacteria | 3788 |
| 361 | Ga0495628_0294686 | 3300046516 | Bacteria | 1202 |
| 362 | Ga0495630_0046122 | 3300046517 | Bacteria | 3257 |
| 363 | Ga0495630_0661941 | 3300046517 | Bacteria | 799 |
| 364 | Ga0495637_0063025 | 3300046520 | Bacteria | 1516 |
| 365 | Ga0495643_0059444 | 3300046522 | Bacteria | 2032 |
| 366 | Ga0495648_0013322 | 3300046524 | Bacteria | 6085 |
| 367 | Ga0495652_0011659 | 3300046529 | Bacteria | 7944 |
| 368 | Ga0495652_0022099 | 3300046529 | Bacteria | 5649 |
| 369 | Ga0495665_0014378 | 3300046531 | Bacteria | 4269 |
| 370 | Ga0495665_0118116 | 3300046531 | Bacteria | 1389 |
| 371 | Ga0495640_0004186 | 3300046533 | Bacteria | 11535 |
| 372 | Ga0495640_0067869 | 3300046533 | Bacteria | 2401 |
| 373 | Ga0495640_0184018 | 3300046533 | Bacteria | 1330 |
| 374 | Ga0495587_0220185 | 3300046536 | Bacteria | 1070 |
| 375 | Ga0495587_0336020 | 3300046536 | Bacteria | 843 |
| 376 | Ga0495645_0013542 | 3300046543 | Bacteria | 5770 |
| 377 | Ga0495645_0130016 | 3300046543 | Bacteria | 1765 |
| 378 | Ga0495645_0151081 | 3300046543 | Bacteria | 1613 |
| 379 | Ga0495645_0481273 | 3300046543 | Bacteria | 779 |
| 380 | Ga0495622_0011358 | 3300046557 | Bacteria | 4114 |
| 381 | Ga0495667_0005317 | 3300046559 | Bacteria | 8701 |
| 382 | Ga0495667_0006879 | 3300046559 | Bacteria | 7724 |
| 383 | Ga0495634_0005151 | 3300046642 | Bacteria | 10092 |
| 384 | Ga0495634_0013779 | 3300046642 | Bacteria | 5839 |
| 385 | Ga0495634_0022393 | 3300046642 | Bacteria | 4452 |
| 386 | Ga0495635_0000949 | 3300046663 | Bacteria | 19120 |
| 387 | Ga0495635_0004949 | 3300046663 | Bacteria | 9276 |
| 388 | Ga0495635_0204794 | 3300046663 | Bacteria | 1337 |
| 389 | Ga0495661_0044317 | 3300046665 | Bacteria | 2728 |
| 390 | Ga0495588_0024744 | 3300046674 | Bacteria | 2985 |
| 391 | Ga0495588_0112664 | 3300046674 | Bacteria | 1433 |
| 392 | Ga0495657_0006888 | 3300046675 | Bacteria | 8829 |
| 393 | Ga0495657_0039426 | 3300046675 | Bacteria | 3245 |
| 394 | Ga0495657_0326332 | 3300046675 | Bacteria | 911 |
| 395 | Ga0495599_0001298 | 3300046678 | Bacteria | 14185 |
| 396 | Ga0495599_0228419 | 3300046678 | Bacteria | 1137 |
| 397 | Ga0495623_0004108 | 3300046679 | Bacteria | 9593 |
| 398 | Ga0495646_0019121 | 3300046680 | Bacteria | 4337 |
| 399 | Ga0495646_0065295 | 3300046680 | Bacteria | 2155 |
| 400 | Ga0495646_0142405 | 3300046680 | Bacteria | 1339 |
| 401 | Ga0495647_0003898 | 3300046681 | Bacteria | 4811 |
| 402 | Ga0495658_0000486 | 3300046683 | Bacteria | 21786 |
| 403 | Ga0495613_0014754 | 3300046689 | Bacteria | 5798 |
| 404 | Ga0495613_0125892 | 3300046689 | Bacteria | 1837 |
| 405 | Ga0495613_0318773 | 3300046689 | Bacteria | 1073 |
| 406 | Ga0495624_0022892 | 3300046690 | Bacteria | 4123 |
| 407 | Ga0495670_0020661 | 3300046691 | Bacteria | 3247 |
| 408 | Ga0495600_0003929 | 3300046809 | Bacteria | 8829 |
| 409 | Ga0495600_0053549 | 3300046809 | Bacteria | 2635 |
| 410 | Ga0495581_0006098 | 3300047315 | Bacteria | 6988 |
| 411 | Ga0495581_0256702 | 3300047315 | Bacteria | 1022 |
| 412 | Ga0495604_0002058 | 3300047317 | Bacteria | 16236 |
| 413 | Ga0495604_0143282 | 3300047317 | Bacteria | 1705 |
| 414 | Ga0495674_0003657 | 3300047319 | Bacteria | 14960 |
| 415 | Ga0495674_0010681 | 3300047319 | Bacteria | 8688 |
| 416 | Ga0495674_0029958 | 3300047319 | Bacteria | 4951 |
| 417 | Ga0495672_0099097 | 3300047320 | Bacteria | 1584 |
| 418 | Ga0495676_0037216 | 3300047321 | Bacteria | 4053 |
| 419 | Ga0495680_0000314 | 3300047322 | Bacteria | 54452 |
| 420 | Ga0495680_0133989 | 3300047322 | Bacteria | 1818 |
| 421 | Ga0495675_0001080 | 3300047444 | Bacteria | 16506 |
| 422 | Ga0495675_0023917 | 3300047444 | Bacteria | 3892 |
| 423 | Ga0495675_0195812 | 3300047444 | Bacteria | 1232 |
| 424 | Ga0495673_0010805 | 3300047469 | Bacteria | 4945 |
| 425 | Ga0495684_0000088 | 3300047471 | Bacteria | 64704 |
| 426 | Ga0495686_0218366 | 3300047472 | Bacteria | 1086 |
| 427 | Ga0495686_0227095 | 3300047472 | Bacteria | 1059 |
| 428 | Ga0495593_0000167 | 3300047673 | Bacteria | 33674 |
| 429 | Ga0495593_0003413 | 3300047673 | Bacteria | 9516 |
| 430 | Ga0495593_0128125 | 3300047673 | Bacteria | 1290 |
| 431 | Ga0495602_0015717 | 3300048088 | Bacteria | 7627 |
| 432 | Ga0495602_0046919 | 3300048088 | Bacteria | 3897 |
| 433 | Ga0495602_0337622 | 3300048088 | Bacteria | 1091 |
| 434 | Ga0495602_0408893 | 3300048088 | Bacteria | 966 |
| 435 | Ga0495614_0189626 | 3300048089 | Bacteria | 927 |
| 436 | Ga0495626_0063560 | 3300048091 | Bacteria | 1674 |
| 437 | Ga0496101_0016778 | 3300048904 | Bacteria | 4957 |
| 438 | Ga0496101_0350846 | 3300048904 | Bacteria | 1159 |
| 439 | Ga0496101_0392868 | 3300048904 | Bacteria | 1092 |
| 440 | Ga0496102_0013624 | 3300048905 | Bacteria | 7048 |
| 441 | Ga0496102_0318638 | 3300048905 | Bacteria | 1465 |
| 442 | Ga0496102_0331185 | 3300048905 | Bacteria | 1434 |
| 443 | Ga0496103_0180339 | 3300048906 | Bacteria | 1357 |
| 444 | Ga0496104_0154771 | 3300048907 | Bacteria | 2200 |
| 445 | Ga0496105_0010105 | 3300048908 | Bacteria | 7411 |
| 446 | Ga0496105_0027378 | 3300048908 | Bacteria | 4657 |
| 447 | Ga0496106_0006715 | 3300048909 | Bacteria | 8524 |
| 448 | Ga0496106_0123286 | 3300048909 | Bacteria | 2027 |
| 449 | Ga0496106_0219767 | 3300048909 | Bacteria | 1515 |
| 450 | Ga0496106_0817765 | 3300048909 | Bacteria | 739 |
| 451 | Ga0496107_0002627 | 3300048910 | Bacteria | 11751 |
| 452 | Ga0496107_0010249 | 3300048910 | Bacteria | 6505 |
| 453 | Ga0496107_0431622 | 3300048910 | Bacteria | 979 |
| 454 | Ga0496108_0000464 | 3300048911 | Bacteria | 32517 |
| 455 | Ga0496108_0016573 | 3300048911 | Bacteria | 6016 |
| 456 | Ga0496108_0087290 | 3300048911 | Bacteria | 2649 |
| 457 | Ga0496109_0000399 | 3300048912 | Bacteria | 39304 |
| 458 | Ga0496109_0044459 | 3300048912 | Bacteria | 4029 |
| 459 | Ga0496109_0862349 | 3300048912 | Bacteria | 843 |
| 460 | Ga0496110_0021541 | 3300048913 | Bacteria | 5460 |
| 461 | Ga0496110_0051766 | 3300048913 | Bacteria | 3608 |
| 462 | Ga0496110_0106972 | 3300048913 | Bacteria | 2510 |
| 463 | Ga0496110_0108063 | 3300048913 | Bacteria | 2498 |
| 464 | Ga0496111_0022356 | 3300048914 | Bacteria | 4426 |
| 465 | Ga0496111_0103387 | 3300048914 | Bacteria | 2095 |
| 466 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 467 | Ga0496112_0006770 | 3300048915 | Bacteria | 10100 |
| 468 | Ga0496112_0007959 | 3300048915 | Bacteria | 9452 |
| 469 | Ga0496112_0078259 | 3300048915 | Bacteria | 3270 |
| 470 | Ga0496112_0307608 | 3300048915 | Bacteria | 1530 |
| 471 | Ga0496113_0018089 | 3300048916 | Bacteria | 4904 |
| 472 | Ga0496113_0026494 | 3300048916 | Bacteria | 4145 |
| 473 | Ga0496113_0081376 | 3300048916 | Bacteria | 2482 |
| 474 | Ga0496113_0152558 | 3300048916 | Bacteria | 1823 |
| 475 | Ga0496114_0019470 | 3300048917 | Bacteria | 5498 |
| 476 | Ga0496114_0072004 | 3300048917 | Bacteria | 2906 |
| 477 | Ga0496114_0156654 | 3300048917 | Bacteria | 1978 |
| 478 | Ga0496115_0029721 | 3300048918 | Bacteria | 4294 |
| 479 | Ga0496115_0126920 | 3300048918 | Bacteria | 2102 |
| 480 | Ga0496115_0154640 | 3300048918 | Bacteria | 1894 |
| 481 | Ga0496115_0290250 | 3300048918 | Bacteria | 1342 |
| 482 | Ga0496116_0024869 | 3300048919 | Bacteria | 4416 |
| 483 | Ga0496117_0030136 | 3300048920 | Bacteria | 4169 |
| 484 | Ga0496117_0054945 | 3300048920 | Bacteria | 2786 |
| 485 | Ga0496118_0063023 | 3300048921 | Bacteria | 2731 |
| 486 | Ga0496118_0172612 | 3300048921 | Bacteria | 1318 |
| 487 | Ga0496119_0034120 | 3300048922 | Bacteria | 3359 |
| 488 | Ga0496119_0082553 | 3300048922 | Bacteria | 1848 |
| 489 | Ga0496120_0116032 | 3300048923 | Bacteria | 1391 |
| 490 | Ga0496121_0026862 | 3300048924 | Bacteria | 5406 |
| 491 | Ga0496121_0083202 | 3300048924 | Bacteria | 2527 |
| 492 | Ga0496121_0136675 | 3300048924 | Bacteria | 1825 |
| 493 | Ga0496121_0144425 | 3300048924 | Bacteria | 1760 |
| 494 | Ga0496121_0193608 | 3300048924 | Bacteria | 1455 |
| 495 | Ga0496121_0258092 | 3300048924 | Bacteria | 1205 |
| 496 | Ga0496122_0062839 | 3300048925 | Bacteria | 2715 |
| 497 | Ga0496122_0117495 | 3300048925 | Bacteria | 1726 |
| 498 | Ga0496122_0221446 | 3300048925 | Bacteria | 1085 |
| 499 | Ga0496123_0013979 | 3300048926 | Bacteria | 6685 |
| 500 | Ga0496123_0061756 | 3300048926 | Bacteria | 2405 |
| 501 | Ga0496124_0264121 | 3300048927 | Bacteria | 1265 |
| 502 | Ga0496125_0000125 | 3300048928 | Bacteria | 169979 |
| 503 | Ga0496125_0033246 | 3300048928 | Bacteria | 4567 |
| 504 | Ga0496125_0144717 | 3300048928 | Bacteria | 1645 |
| 505 | Ga0496125_0479760 | 3300048928 | Bacteria | 705 |
| 506 | Ga0496126_0020631 | 3300048929 | Bacteria | 6454 |
| 507 | Ga0496126_0032435 | 3300048929 | Bacteria | 4920 |
| 508 | Ga0496126_0041180 | 3300048929 | Bacteria | 4277 |
| 509 | Ga0496126_0124826 | 3300048929 | Bacteria | 2229 |
| 510 | Ga0496126_0153241 | 3300048929 | Bacteria | 1974 |
| 511 | Ga0496126_0159370 | 3300048929 | Bacteria | 1929 |
| 512 | Ga0496126_0188182 | 3300048929 | Bacteria | 1750 |
| 513 | Ga0496126_0271184 | 3300048929 | Bacteria | 1408 |
| 514 | Ga0496126_0444150 | 3300048929 | Bacteria | 1045 |
| 515 | Ga0496126_0553580 | 3300048929 | Bacteria | 912 |
| 516 | Ga0496126_0780442 | 3300048929 | Bacteria | 735 |
| 517 | Ga0501032_0202709 | 3300049569 | Bacteria | 1294 |
| 518 | Ga0501034_0096888 | 3300049571 | Bacteria | 2945 |
| 519 | Ga0501036_0054046 | 3300049572 | Bacteria | 3400 |
| 520 | Ga0501036_0069177 | 3300049572 | Bacteria | 2987 |
| 521 | Ga0501036_0305003 | 3300049572 | Bacteria | 1331 |
| 522 | Ga0501037_0024331 | 3300049573 | Bacteria | 4479 |
| 523 | Ga0501037_0070684 | 3300049573 | Bacteria | 2539 |
| 524 | Ga0501037_0179731 | 3300049573 | Bacteria | 1501 |
| 525 | Ga0501037_0267176 | 3300049573 | Bacteria | 1194 |
| 526 | Ga0501038_0006497 | 3300049574 | Bacteria | 10821 |
| 527 | Ga0501038_0008894 | 3300049574 | Bacteria | 9216 |
| 528 | Ga0501040_0083241 | 3300049576 | Bacteria | 2219 |
| 529 | Ga0501041_0104797 | 3300049577 | Bacteria | 1752 |
| 530 | Ga0501043_0019191 | 3300049579 | Bacteria | 5367 |
| 531 | Ga0501043_0396605 | 3300049579 | Bacteria | 1043 |
| 532 | Ga0501043_0608526 | 3300049579 | Bacteria | 806 |
| 533 | Ga0501047_0064573 | 3300049581 | Bacteria | 3531 |
| 534 | Ga0501047_0157239 | 3300049581 | Bacteria | 2146 |
| 535 | Ga0501047_0604310 | 3300049581 | Bacteria | 918 |
| 536 | Ga0501067_0004867 | 3300049583 | Bacteria | 7456 |
| 537 | Ga0501067_0243148 | 3300049583 | Bacteria | 1002 |
| 538 | Ga0501070_0048707 | 3300049586 | Bacteria | 3519 |
| 539 | Ga0501070_0060938 | 3300049586 | Bacteria | 3127 |
| 540 | Ga0501070_0352771 | 3300049586 | Bacteria | 1194 |
| 541 | Ga0501071_0279643 | 3300049587 | Bacteria | 1263 |
| 542 | Ga0501072_0657879 | 3300049588 | Bacteria | 824 |
| 543 | Ga0501073_0010841 | 3300049589 | Bacteria | 6674 |
| 544 | Ga0501073_0073376 | 3300049589 | Bacteria | 2383 |
| 545 | Ga0501074_0011477 | 3300049590 | Bacteria | 6442 |
| 546 | Ga0501074_0108495 | 3300049590 | Bacteria | 1987 |
| 547 | Ga0501077_0458076 | 3300049593 | Bacteria | 817 |
| 548 | Ga0501079_0064135 | 3300049741 | Bacteria | 2834 |
| 549 | Ga0501080_0045880 | 3300049742 | Bacteria | 4069 |
| 550 | Ga0501080_0068846 | 3300049742 | Bacteria | 3292 |
| 551 | Ga0501080_0345970 | 3300049742 | Bacteria | 1343 |
| 552 | Ga0501035_0021488 | 3300049822 | Bacteria | 5933 |
| 553 | Ga0501035_0129458 | 3300049822 | Bacteria | 2201 |
| 554 | Ga0501035_0140799 | 3300049822 | Bacteria | 2097 |
| 555 | Ga0501035_0176199 | 3300049822 | Bacteria | 1844 |
| 556 | Ga0501044_0052081 | 3300049823 | Bacteria | 4220 |
| 557 | Ga0501044_0067371 | 3300049823 | Bacteria | 3647 |
| 558 | Ga0501044_0087577 | 3300049823 | Bacteria | 3145 |
| 559 | Ga0501044_0145565 | 3300049823 | Bacteria | 2355 |
| 560 | Ga0501044_0226552 | 3300049823 | Bacteria | 1818 |
| 561 | Ga0501044_0494392 | 3300049823 | Bacteria | 1125 |
| 562 | nmdc:mga00v17_102830_c1 | 3300050491 | Bacteria | 1805 |
| 563 | nmdc:mga0yw44_52887_c1 | 3300050492 | Bacteria | 2464 |
| 564 | nmdc:mga0k408_491537_c1 | 3300050493 | Bacteria | 727 |
| 565 | nmdc:mga06z11_101791_c1 | 3300050494 | Bacteria | 1577 |
| 566 | nmdc:mga0sz30_10422_c1 | 3300050516 | Bacteria | 3563 |
| 567 | Ga0495601_0021302 | 3300053077 | Bacteria | 3969 |
| 568 | Ga0495601_0026803 | 3300053077 | Bacteria | 3560 |
| 569 | Ga0495601_0072006 | 3300053077 | Bacteria | 2208 |
| 570 | Ga0495601_0105904 | 3300053077 | Bacteria | 1818 |
| 571 | Ga0495612_0031500 | 3300053078 | Bacteria | 2138 |
| 572 | Ga0495612_0084555 | 3300053078 | Bacteria | 1336 |
| 573 | Ga0500635_0021142 | 3300053080 | Bacteria | 2001 |
| 574 | Ga0495595_0000602 | 3300053084 | Bacteria | 13704 |
| 575 | Ga0495619_0000166 | 3300053085 | Bacteria | 48296 |
| 576 | Ga0500578_0240391 | 3300053086 | Bacteria | 1094 |
| 577 | Ga0500643_006227 | 3300053087 | Bacteria | 5015 |
| 578 | Ga0500566_0005486 | 3300053094 | Bacteria | 7547 |
| 579 | Ga0500650_0000314 | 3300053098 | Bacteria | 11712 |
| 580 | Ga0500554_078704 | 3300053102 | Bacteria | 1083 |
| 581 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 582 | Ga0500562_036129 | 3300053108 | Bacteria | 1309 |
| 583 | Ga0500592_001447 | 3300053116 | Bacteria | 3847 |
| 584 | Ga0500592_016088 | 3300053116 | Bacteria | 1201 |
| 585 | Ga0500594_0032451 | 3300053118 | Bacteria | 1383 |
| 586 | Ga0500595_001257 | 3300053119 | Bacteria | 13957 |
| 587 | Ga0500595_003606 | 3300053119 | Bacteria | 7179 |
| 588 | Ga0500595_006150 | 3300053119 | Bacteria | 5138 |
| 589 | Ga0500595_023234 | 3300053119 | Bacteria | 2182 |
| 590 | Ga0500607_107007 | 3300053121 | Bacteria | 1378 |
| 591 | Ga0500608_057032 | 3300053122 | Bacteria | 1871 |
| 592 | Ga0500618_028750 | 3300053125 | Bacteria | 1314 |
| 593 | Ga0500642_0000016 | 3300053130 | Bacteria | 176560 |
| 594 | Ga0500642_0050391 | 3300053130 | Bacteria | 1835 |
| 595 | Ga0500658_0112092 | 3300053134 | Bacteria | 1201 |
| 596 | Ga0500559_0000675 | 3300053136 | Bacteria | 22834 |
| 597 | Ga0500568_0000994 | 3300053139 | Bacteria | 19383 |
| 598 | Ga0500568_0002965 | 3300053139 | Bacteria | 9713 |
| 599 | Ga0500568_0035032 | 3300053139 | Bacteria | 2051 |
| 600 | Ga0500577_0000249 | 3300053142 | Bacteria | 13959 |
| 601 | Ga0500586_001227 | 3300053145 | Bacteria | 5359 |
| 602 | Ga0500603_000599 | 3300053150 | Bacteria | 8965 |
| 603 | Ga0500604_0007338 | 3300053151 | Bacteria | 2918 |
| 604 | Ga0500604_0050497 | 3300053151 | Bacteria | 1282 |
| 605 | Ga0500616_0001314 | 3300053153 | Bacteria | 24544 |
| 606 | Ga0500622_0002221 | 3300053156 | Bacteria | 14299 |
| 607 | Ga0500622_0029814 | 3300053156 | Bacteria | 2867 |
| 608 | Ga0500627_0057085 | 3300053158 | Bacteria | 1711 |
| 609 | Ga0500627_0135131 | 3300053158 | Bacteria | 1114 |
| 610 | Ga0500633_0038469 | 3300053160 | Bacteria | 1594 |
| 611 | Ga0500637_0149635 | 3300053178 | Bacteria | 1349 |
| 612 | Ga0500611_070160 | 3300053727 | Bacteria | 852 |
| 613 | Ga0501084_0522553 | 3300054114 | Bacteria | 1003 |
| 614 | Ga0501082_0121061 | 3300060353 | Bacteria | 2268 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2513237096 | 2513659635 | 212 |
| 2 | iso_pu_bacteria | 2513237098 | 2513673630 | 212 |
| 3 | iso_pu_bacteria | 2513237145 | 2513921645 | 212 |
| 4 | iso_pu_bacteria | 2667528175 | 2671117964 | 212 |
| 5 | iso_pu_bacteria | 2728368998 | 2728754436 | 212 |
| 6 | iso_pu_bacteria | 2791355197 | 2793073746 | 212 |
| 7 | iso_pu_bacteria | 2885374607 | 2885381606 | 212 |
| 8 | iso_pu_bacteria | 2903748898 | 2903756527 | 212 |
| 9 | iso_pu_bacteria | 2903768456 | 2903778124 | 212 |
| 10 | iso_pu_bacteria | 2906610324 | 2906617471 | 212 |
| 11 | iso_pu_bacteria | 2906660503 | 2906668026 | 212 |
| 12 | iso_pu_bacteria | 2908739725 | 2908743721 | 212 |
| 13 | iso_pu_bacteria | 2922425934 | 2922429146 | 212 |
| 14 | iso_pu_bacteria | 2935630451 | 2935634261 | 212 |
| 15 | iso_pu_bacteria | 2941507105 | 2941511151 | 212 |
| 16 | iso_pu_bacteria | 2941515067 | 2941518535 | 212 |
| 17 | iso_pu_bacteria | 2941523033 | 2941527202 | 212 |
| 18 | iso_pu_bacteria | 3005474847 | 3005479316 | 212 |
| 19 | iso_pu_bacteria | 8019555841 | 8019557743 | 212 |
| 20 | iso_pu_bacteria | 8019565922 | 8019567556 | 212 |
| 21 | iso_pu_bacteria | 8056681323 | 8056684037 | 212 |
| 22 | iso_pu_bacteria | 8056689827 | 8056695735 | 212 |
| 23 | iso_pu_bacteria | 2602042107 | 2603856701 | 213 |
| 24 | iso_pu_bacteria | 2857524615 | 2857528177 | 213 |
| 25 | iso_pu_bacteria | 2893066018 | 2893068619 | 213 |
| 26 | iso_pu_bacteria | 2919073203 | 2919075605 | 213 |
| 27 | 3300047472 | Ga0495686_0218366 | Ga0495686_0218366_365_1015 | 214 |
| 28 | 3300005615 | Ga0070702_100361608 | Ga0070702_1003616081 | 215 |
| 29 | 3300005616 | Ga0068852_100157062 | Ga0068852_1001570622 | 215 |
| 30 | 3300005937 | Ga0081455_10004867 | Ga0081455_1000486716 | 215 |
| 31 | 3300006237 | Ga0097621_100111977 | Ga0097621_1001119773 | 215 |
| 32 | 3300006358 | Ga0068871_100109013 | Ga0068871_1001090134 | 215 |
| 33 | 3300009174 | Ga0105241_10221508 | Ga0105241_102215082 | 215 |
| 34 | 3300009177 | Ga0105248_10154194 | Ga0105248_101541944 | 215 |
| 35 | 3300009545 | Ga0105237_10029701 | Ga0105237_100297016 | 215 |
| 36 | 3300010375 | Ga0105239_10060036 | Ga0105239_100600362 | 215 |
| 37 | 3300025941 | Ga0207711_10087811 | Ga0207711_100878112 | 215 |
| 38 | 3300026088 | Ga0207641_10235150 | Ga0207641_102351502 | 215 |
| 39 | 3300026142 | Ga0207698_10128401 | Ga0207698_101284011 | 215 |
| 40 | 3300034816 | Ga0373930_0008382 | Ga0373930_0008382_647_1300 | 215 |
| 41 | 3300035089 | Ga0373944_0071192 | Ga0373944_0071192_151_804 | 215 |
| 42 | 3300035695 | Ga0373927_0020857 | Ga0373927_0020857_1272_1925 | 215 |
| 43 | 3300035725 | Ga0373947_0485904 | Ga0373947_0485904_87_740 | 215 |
| 44 | 3300037068 | Ga0373925_0143564 | Ga0373925_0143564_599_1252 | 215 |
| 45 | 3300048904 | Ga0496101_0016778 | Ga0496101_0016778_1065_1718 | 215 |
| 46 | 3300048905 | Ga0496102_0013624 | Ga0496102_0013624_4764_5417 | 215 |
| 47 | 3300048906 | Ga0496103_0180339 | Ga0496103_0180339_620_1273 | 215 |
| 48 | 3300048907 | Ga0496104_0154771 | Ga0496104_0154771_419_1072 | 215 |
| 49 | 3300048908 | Ga0496105_0010105 | Ga0496105_0010105_3435_4088 | 215 |
| 50 | 3300048909 | Ga0496106_0123286 | Ga0496106_0123286_580_1233 | 215 |
| 51 | 3300048910 | Ga0496107_0010249 | Ga0496107_0010249_159_812 | 215 |
| 52 | 3300048911 | Ga0496108_0016573 | Ga0496108_0016573_1628_2281 | 215 |
| 53 | 3300048912 | Ga0496109_0044459 | Ga0496109_0044459_227_880 | 215 |
| 54 | 3300048913 | Ga0496110_0051766 | Ga0496110_0051766_2618_3271 | 215 |
| 55 | 3300048914 | Ga0496111_0022356 | Ga0496111_0022356_2502_3155 | 215 |
| 56 | 3300048915 | Ga0496112_0078259 | Ga0496112_0078259_260_913 | 215 |
| 57 | 3300048916 | Ga0496113_0026494 | Ga0496113_0026494_3245_3898 | 215 |
| 58 | 3300048917 | Ga0496114_0019470 | Ga0496114_0019470_247_900 | 215 |
| 59 | 3300048918 | Ga0496115_0029721 | Ga0496115_0029721_1496_2149 | 215 |
| 60 | 3300049823 | Ga0501044_0067371 | Ga0501044_0067371_175_825 | 215 |
| 61 | 3300005329 | Ga0070683_100947881 | Ga0070683_1009478811 | 216 |
| 62 | 3300005340 | Ga0070689_100153675 | Ga0070689_1001536752 | 216 |
| 63 | 3300005434 | Ga0070709_10000449 | Ga0070709_1000044915 | 216 |
| 64 | 3300005435 | Ga0070714_100018483 | Ga0070714_1000184834 | 216 |
| 65 | 3300005437 | Ga0070710_10000080 | Ga0070710_1000008030 | 216 |
| 66 | 3300005439 | Ga0070711_100002916 | Ga0070711_1000029165 | 216 |
| 67 | 3300005439 | Ga0070711_100008835 | Ga0070711_1000088352 | 216 |
| 68 | 3300005439 | Ga0070711_100037586 | Ga0070711_1000375862 | 216 |
| 69 | 3300005457 | Ga0070662_100464440 | Ga0070662_1004644401 | 216 |
| 70 | 3300005535 | Ga0070684_100393690 | Ga0070684_1003936902 | 216 |
| 71 | 3300005544 | Ga0070686_100348299 | Ga0070686_1003482992 | 216 |
| 72 | 3300005563 | Ga0068855_100088696 | Ga0068855_1000886964 | 216 |
| 73 | 3300005616 | Ga0068852_100672476 | Ga0068852_1006724762 | 216 |
| 74 | 3300005718 | Ga0068866_10105260 | Ga0068866_101052602 | 216 |
| 75 | 3300005844 | Ga0068862_100698830 | Ga0068862_1006988301 | 216 |
| 76 | 3300006038 | Ga0075365_10063725 | Ga0075365_100637252 | 216 |
| 77 | 3300006048 | Ga0075363_100153552 | Ga0075363_1001535521 | 216 |
| 78 | 3300006051 | Ga0075364_10256444 | Ga0075364_102564442 | 216 |
| 79 | 3300006163 | Ga0070715_10043149 | Ga0070715_100431492 | 216 |
| 80 | 3300006175 | Ga0070712_100145447 | Ga0070712_1001454472 | 216 |
| 81 | 3300006175 | Ga0070712_100847893 | Ga0070712_1008478931 | 216 |
| 82 | 3300006178 | Ga0075367_10305603 | Ga0075367_103056031 | 216 |
| 83 | 3300006353 | Ga0075370_10029487 | Ga0075370_100294872 | 216 |
| 84 | 3300006943 | Ga0099822_1000400 | Ga0099822_100040027 | 216 |
| 85 | 3300009098 | Ga0105245_10407659 | Ga0105245_104076591 | 216 |
| 86 | 3300009551 | Ga0105238_10016910 | Ga0105238_100169102 | 216 |
| 87 | 3300009553 | Ga0105249_10413799 | Ga0105249_104137991 | 216 |
| 88 | 3300009553 | Ga0105249_10743664 | Ga0105249_107436641 | 216 |
| 89 | 3300010375 | Ga0105239_10170516 | Ga0105239_101705162 | 216 |
| 90 | 3300010375 | Ga0105239_10762030 | Ga0105239_107620302 | 216 |
| 91 | 3300013296 | Ga0157374_10086392 | Ga0157374_100863924 | 216 |
| 92 | 3300013297 | Ga0157378_10003347 | Ga0157378_100033477 | 216 |
| 93 | 3300013308 | Ga0157375_10270261 | Ga0157375_102702611 | 216 |
| 94 | 3300025898 | Ga0207692_10009474 | Ga0207692_100094745 | 216 |
| 95 | 3300025898 | Ga0207692_10009749 | Ga0207692_100097492 | 216 |
| 96 | 3300025899 | Ga0207642_10161128 | Ga0207642_101611281 | 216 |
| 97 | 3300025905 | Ga0207685_10058283 | Ga0207685_100582832 | 216 |
| 98 | 3300025906 | Ga0207699_10000664 | Ga0207699_1000066411 | 216 |
| 99 | 3300025915 | Ga0207693_10011883 | Ga0207693_100118833 | 216 |
| 100 | 3300025915 | Ga0207693_10016920 | Ga0207693_100169202 | 216 |
| 101 | 3300025916 | Ga0207663_10006601 | Ga0207663_100066015 | 216 |
| 102 | 3300025916 | Ga0207663_10373606 | Ga0207663_103736062 | 216 |
| 103 | 3300025916 | Ga0207663_10573486 | Ga0207663_105734862 | 216 |
| 104 | 3300025924 | Ga0207694_10024072 | Ga0207694_100240723 | 216 |
| 105 | 3300025928 | Ga0207700_10211758 | Ga0207700_102117582 | 216 |
| 106 | 3300025929 | Ga0207664_10160156 | Ga0207664_101601562 | 216 |
| 107 | 3300025933 | Ga0207706_10308617 | Ga0207706_103086172 | 216 |
| 108 | 3300025936 | Ga0207670_10167281 | Ga0207670_101672812 | 216 |
| 109 | 3300025939 | Ga0207665_10011531 | Ga0207665_100115315 | 216 |
| 110 | 3300026142 | Ga0207698_10480251 | Ga0207698_104802511 | 216 |
| 111 | 3300027357 | Ga0209589_1000030 | Ga0209589_100003031 | 216 |
| 112 | 3300027361 | Ga0209489_100056 | Ga0209489_10005631 | 216 |
| 113 | 3300027363 | Ga0209700_100059 | Ga0209700_10005931 | 216 |
| 114 | 3300028786 | Ga0307517_10000369 | Ga0307517_1000036975 | 216 |
| 115 | 3300028794 | Ga0307515_10256857 | Ga0307515_102568572 | 216 |
| 116 | 3300031456 | Ga0307513_10267916 | Ga0307513_102679162 | 216 |
| 117 | 3300031616 | Ga0307508_10000105 | Ga0307508_1000010544 | 216 |
| 118 | 3300031616 | Ga0307508_10116949 | Ga0307508_101169494 | 216 |
| 119 | 3300032002 | Ga0307416_100230194 | Ga0307416_1002301941 | 216 |
| 120 | 3300032005 | Ga0307411_10395675 | Ga0307411_103956752 | 216 |
| 121 | 3300037068 | Ga0373925_0174163 | Ga0373925_0174163_930_1586 | 216 |
| 122 | 3300037471 | Ga0395905_0041909 | Ga0395905_0041909_1723_2376 | 216 |
| 123 | 3300039438 | Ga0436360_0438666 | Ga0436360_0438666_258_911 | 216 |
| 124 | 3300046455 | Ga0495603_0188705 | Ga0495603_0188705_60_716 | 216 |
| 125 | 3300046472 | Ga0495580_0334797 | Ga0495580_0334797_173_829 | 216 |
| 126 | 3300046492 | Ga0495585_0195386 | Ga0495585_0195386_288_944 | 216 |
| 127 | 3300046543 | Ga0495645_0481273 | Ga0495645_0481273_30_686 | 216 |
| 128 | 3300046674 | Ga0495588_0112664 | Ga0495588_0112664_519_1175 | 216 |
| 129 | 3300048908 | Ga0496105_0027378 | Ga0496105_0027378_702_1355 | 216 |
| 130 | 3300048909 | Ga0496106_0817765 | Ga0496106_0817765_66_719 | 216 |
| 131 | 3300048911 | Ga0496108_0087290 | Ga0496108_0087290_1928_2581 | 216 |
| 132 | 3300048913 | Ga0496110_0021541 | Ga0496110_0021541_184_837 | 216 |
| 133 | 3300048915 | Ga0496112_0006770 | Ga0496112_0006770_1494_2147 | 216 |
| 134 | 3300048916 | Ga0496113_0081376 | Ga0496113_0081376_145_798 | 216 |
| 135 | 3300048917 | Ga0496114_0156654 | Ga0496114_0156654_751_1404 | 216 |
| 136 | 3300048918 | Ga0496115_0126920 | Ga0496115_0126920_254_910 | 216 |
| 137 | 3300048924 | Ga0496121_0136675 | Ga0496121_0136675_517_1170 | 216 |
| 138 | 3300048929 | Ga0496126_0188182 | Ga0496126_0188182_711_1367 | 216 |
| 139 | 3300048929 | Ga0496126_0780442 | Ga0496126_0780442_24_680 | 216 |
| 140 | 3300050493 | nmdc:mga0k408_491537_c1 | nmdc:mga0k408_491537_c1_49_705 | 216 |
| 141 | 3300053151 | Ga0500604_0050497 | Ga0500604_0050497_282_938 | 216 |
| 142 | 3300001989 | JGI24739J22299_10009572 | JGI24739J22299_100095724 | 217 |
| 143 | 3300003203 | JGI25406J46586_10000026 | JGI25406J46586_1000002633 | 217 |
| 144 | 3300005262 | Ga0065165_1017395 | Ga0065165_10173953 | 217 |
| 145 | 3300005327 | Ga0070658_10349963 | Ga0070658_103499632 | 217 |
| 146 | 3300005327 | Ga0070658_10456154 | Ga0070658_104561542 | 217 |
| 147 | 3300005327 | Ga0070658_10655200 | Ga0070658_106552001 | 217 |
| 148 | 3300005329 | Ga0070683_100006084 | Ga0070683_1000060843 | 217 |
| 149 | 3300005329 | Ga0070683_100690191 | Ga0070683_1006901912 | 217 |
| 150 | 3300005336 | Ga0070680_100034532 | Ga0070680_1000345325 | 217 |
| 151 | 3300005336 | Ga0070680_100158688 | Ga0070680_1001586882 | 217 |
| 152 | 3300005336 | Ga0070680_100294497 | Ga0070680_1002944972 | 217 |
| 153 | 3300005339 | Ga0070660_100010127 | Ga0070660_1000101274 | 217 |
| 154 | 3300005339 | Ga0070660_100043237 | Ga0070660_1000432371 | 217 |
| 155 | 3300005339 | Ga0070660_100089916 | Ga0070660_1000899164 | 217 |
| 156 | 3300005339 | Ga0070660_100237406 | Ga0070660_1002374062 | 217 |
| 157 | 3300005341 | Ga0070691_10081942 | Ga0070691_100819422 | 217 |
| 158 | 3300005366 | Ga0070659_100097120 | Ga0070659_1000971202 | 217 |
| 159 | 3300005366 | Ga0070659_100108418 | Ga0070659_1001084181 | 217 |
| 160 | 3300005434 | Ga0070709_10016820 | Ga0070709_100168204 | 217 |
| 161 | 3300005435 | Ga0070714_100039060 | Ga0070714_1000390605 | 217 |
| 162 | 3300005436 | Ga0070713_100004374 | Ga0070713_1000043748 | 217 |
| 163 | 3300005436 | Ga0070713_100011736 | Ga0070713_1000117363 | 217 |
| 164 | 3300005436 | Ga0070713_100106574 | Ga0070713_1001065743 | 217 |
| 165 | 3300005437 | Ga0070710_10000659 | Ga0070710_1000065916 | 217 |
| 166 | 3300005439 | Ga0070711_100024730 | Ga0070711_1000247303 | 217 |
| 167 | 3300005455 | Ga0070663_100007909 | Ga0070663_1000079095 | 217 |
| 168 | 3300005458 | Ga0070681_10338057 | Ga0070681_103380572 | 217 |
| 169 | 3300005458 | Ga0070681_10368200 | Ga0070681_103682002 | 217 |
| 170 | 3300005467 | Ga0070706_100262045 | Ga0070706_1002620452 | 217 |
| 171 | 3300005530 | Ga0070679_100161352 | Ga0070679_1001613522 | 217 |
| 172 | 3300005530 | Ga0070679_100423564 | Ga0070679_1004235642 | 217 |
| 173 | 3300005530 | Ga0070679_100546941 | Ga0070679_1005469411 | 217 |
| 174 | 3300005535 | Ga0070684_100001571 | Ga0070684_10000157110 | 217 |
| 175 | 3300005535 | Ga0070684_100016701 | Ga0070684_1000167012 | 217 |
| 176 | 3300005535 | Ga0070684_100029571 | Ga0070684_1000295713 | 217 |
| 177 | 3300005535 | Ga0070684_100369618 | Ga0070684_1003696182 | 217 |
| 178 | 3300005536 | Ga0070697_100182139 | Ga0070697_1001821392 | 217 |
| 179 | 3300005539 | Ga0068853_100023815 | Ga0068853_1000238157 | 217 |
| 180 | 3300005539 | Ga0068853_100067568 | Ga0068853_1000675682 | 217 |
| 181 | 3300005539 | Ga0068853_100083101 | Ga0068853_1000831014 | 217 |
| 182 | 3300005539 | Ga0068853_101091107 | Ga0068853_1010911071 | 217 |
| 183 | 3300005547 | Ga0070693_100081558 | Ga0070693_1000815584 | 217 |
| 184 | 3300005563 | Ga0068855_100050062 | Ga0068855_1000500625 | 217 |
| 185 | 3300005563 | Ga0068855_100170568 | Ga0068855_1001705683 | 217 |
| 186 | 3300005563 | Ga0068855_100252796 | Ga0068855_1002527963 | 217 |
| 187 | 3300005563 | Ga0068855_100284085 | Ga0068855_1002840853 | 217 |
| 188 | 3300005563 | Ga0068855_100350812 | Ga0068855_1003508121 | 217 |
| 189 | 3300005564 | Ga0070664_100790685 | Ga0070664_1007906851 | 217 |
| 190 | 3300005577 | Ga0068857_100028534 | Ga0068857_1000285345 | 217 |
| 191 | 3300005577 | Ga0068857_100042940 | Ga0068857_1000429405 | 217 |
| 192 | 3300005577 | Ga0068857_100043461 | Ga0068857_1000434614 | 217 |
| 193 | 3300005577 | Ga0068857_100061636 | Ga0068857_1000616363 | 217 |
| 194 | 3300005577 | Ga0068857_100194972 | Ga0068857_1001949723 | 217 |
| 195 | 3300005578 | Ga0068854_100017928 | Ga0068854_1000179284 | 217 |
| 196 | 3300005578 | Ga0068854_100051548 | Ga0068854_1000515483 | 217 |
| 197 | 3300005614 | Ga0068856_100033539 | Ga0068856_1000335395 | 217 |
| 198 | 3300005614 | Ga0068856_100038823 | Ga0068856_1000388234 | 217 |
| 199 | 3300005614 | Ga0068856_100092345 | Ga0068856_1000923453 | 217 |
| 200 | 3300005616 | Ga0068852_100157696 | Ga0068852_1001576962 | 217 |
| 201 | 3300005616 | Ga0068852_100698085 | Ga0068852_1006980852 | 217 |
| 202 | 3300005834 | Ga0068851_10001148 | Ga0068851_1000114813 | 217 |
| 203 | 3300005834 | Ga0068851_10023052 | Ga0068851_100230524 | 217 |
| 204 | 3300005842 | Ga0068858_100291476 | Ga0068858_1002914761 | 217 |
| 205 | 3300005843 | Ga0068860_100000149 | Ga0068860_10000014974 | 217 |
| 206 | 3300005985 | Ga0081539_10000176 | Ga0081539_10000176154 | 217 |
| 207 | 3300006028 | Ga0070717_10053019 | Ga0070717_100530191 | 217 |
| 208 | 3300006038 | Ga0075365_10039589 | Ga0075365_100395893 | 217 |
| 209 | 3300006048 | Ga0075363_100087660 | Ga0075363_1000876602 | 217 |
| 210 | 3300006051 | Ga0075364_10035290 | Ga0075364_100352903 | 217 |
| 211 | 3300006163 | Ga0070715_10002233 | Ga0070715_100022332 | 217 |
| 212 | 3300006173 | Ga0070716_100016662 | Ga0070716_1000166622 | 217 |
| 213 | 3300006175 | Ga0070712_100069962 | Ga0070712_1000699622 | 217 |
| 214 | 3300006178 | Ga0075367_10089186 | Ga0075367_100891862 | 217 |
| 215 | 3300006186 | Ga0075369_10018014 | Ga0075369_100180142 | 217 |
| 216 | 3300007265 | Ga0099794_10012128 | Ga0099794_100121283 | 217 |
| 217 | 3300007265 | Ga0099794_10015218 | Ga0099794_100152184 | 217 |
| 218 | 3300009092 | Ga0105250_10119756 | Ga0105250_101197561 | 217 |
| 219 | 3300009093 | Ga0105240_10020104 | Ga0105240_100201043 | 217 |
| 220 | 3300009093 | Ga0105240_10054780 | Ga0105240_100547806 | 217 |
| 221 | 3300009093 | Ga0105240_10087114 | Ga0105240_100871142 | 217 |
| 222 | 3300009093 | Ga0105240_10092299 | Ga0105240_100922996 | 217 |
| 223 | 3300009093 | Ga0105240_10472136 | Ga0105240_104721362 | 217 |
| 224 | 3300009101 | Ga0105247_10025759 | Ga0105247_100257593 | 217 |
| 225 | 3300009174 | Ga0105241_10004323 | Ga0105241_100043238 | 217 |
| 226 | 3300009176 | Ga0105242_10095071 | Ga0105242_100950711 | 217 |
| 227 | 3300009545 | Ga0105237_10037282 | Ga0105237_100372826 | 217 |
| 228 | 3300009545 | Ga0105237_10054428 | Ga0105237_100544286 | 217 |
| 229 | 3300009545 | Ga0105237_10219727 | Ga0105237_102197273 | 217 |
| 230 | 3300009551 | Ga0105238_10011154 | Ga0105238_100111544 | 217 |
| 231 | 3300009551 | Ga0105238_10011212 | Ga0105238_100112124 | 217 |
| 232 | 3300009551 | Ga0105238_10152115 | Ga0105238_101521152 | 217 |
| 233 | 3300010375 | Ga0105239_10003480 | Ga0105239_100034808 | 217 |
| 234 | 3300010375 | Ga0105239_10013429 | Ga0105239_100134292 | 217 |
| 235 | 3300010375 | Ga0105239_10075501 | Ga0105239_100755014 | 217 |
| 236 | 3300013105 | Ga0157369_10002568 | Ga0157369_1000256814 | 217 |
| 237 | 3300013105 | Ga0157369_10005939 | Ga0157369_100059394 | 217 |
| 238 | 3300013105 | Ga0157369_10006143 | Ga0157369_1000614310 | 217 |
| 239 | 3300013105 | Ga0157369_10007826 | Ga0157369_1000782610 | 217 |
| 240 | 3300013306 | Ga0163162_10169001 | Ga0163162_101690011 | 217 |
| 241 | 3300013307 | Ga0157372_10310660 | Ga0157372_103106601 | 217 |
| 242 | 3300021384 | Ga0213876_10066783 | Ga0213876_100667831 | 217 |
| 243 | 3300025284 | Ga0209130_1018991 | Ga0209130_10189912 | 217 |
| 244 | 3300025295 | Ga0209564_1001156 | Ga0209564_100115624 | 217 |
| 245 | 3300025321 | Ga0207656_10074735 | Ga0207656_100747352 | 217 |
| 246 | 3300025321 | Ga0207656_10126263 | Ga0207656_101262632 | 217 |
| 247 | 3300025711 | Ga0207696_1063848 | Ga0207696_10638482 | 217 |
| 248 | 3300025898 | Ga0207692_10017192 | Ga0207692_100171922 | 217 |
| 249 | 3300025900 | Ga0207710_10084874 | Ga0207710_100848741 | 217 |
| 250 | 3300025904 | Ga0207647_10002180 | Ga0207647_1000218010 | 217 |
| 251 | 3300025904 | Ga0207647_10185340 | Ga0207647_101853402 | 217 |
| 252 | 3300025905 | Ga0207685_10169893 | Ga0207685_101698931 | 217 |
| 253 | 3300025905 | Ga0207685_10397508 | Ga0207685_103975081 | 217 |
| 254 | 3300025906 | Ga0207699_10006869 | Ga0207699_100068692 | 217 |
| 255 | 3300025906 | Ga0207699_10018796 | Ga0207699_100187961 | 217 |
| 256 | 3300025909 | Ga0207705_10249984 | Ga0207705_102499842 | 217 |
| 257 | 3300025910 | Ga0207684_10335802 | Ga0207684_103358022 | 217 |
| 258 | 3300025911 | Ga0207654_10000723 | Ga0207654_1000072315 | 217 |
| 259 | 3300025912 | Ga0207707_10002488 | Ga0207707_1000248812 | 217 |
| 260 | 3300025912 | Ga0207707_10010888 | Ga0207707_100108883 | 217 |
| 261 | 3300025912 | Ga0207707_10392525 | Ga0207707_103925252 | 217 |
| 262 | 3300025913 | Ga0207695_10000883 | Ga0207695_1000088321 | 217 |
| 263 | 3300025913 | Ga0207695_10024523 | Ga0207695_100245237 | 217 |
| 264 | 3300025913 | Ga0207695_10069306 | Ga0207695_100693063 | 217 |
| 265 | 3300025913 | Ga0207695_10183611 | Ga0207695_101836112 | 217 |
| 266 | 3300025914 | Ga0207671_10067887 | Ga0207671_100678873 | 217 |
| 267 | 3300025914 | Ga0207671_10294887 | Ga0207671_102948872 | 217 |
| 268 | 3300025915 | Ga0207693_10000647 | Ga0207693_100006477 | 217 |
| 269 | 3300025916 | Ga0207663_10001551 | Ga0207663_100015512 | 217 |
| 270 | 3300025917 | Ga0207660_10098743 | Ga0207660_100987432 | 217 |
| 271 | 3300025917 | Ga0207660_10233563 | Ga0207660_102335633 | 217 |
| 272 | 3300025919 | Ga0207657_10002501 | Ga0207657_100025013 | 217 |
| 273 | 3300025919 | Ga0207657_10020762 | Ga0207657_100207624 | 217 |
| 274 | 3300025919 | Ga0207657_10173149 | Ga0207657_101731493 | 217 |
| 275 | 3300025921 | Ga0207652_10046496 | Ga0207652_100464965 | 217 |
| 276 | 3300025921 | Ga0207652_10180671 | Ga0207652_101806712 | 217 |
| 277 | 3300025921 | Ga0207652_10337782 | Ga0207652_103377822 | 217 |
| 278 | 3300025921 | Ga0207652_10446680 | Ga0207652_104466801 | 217 |
| 279 | 3300025924 | Ga0207694_10000436 | Ga0207694_1000043616 | 217 |
| 280 | 3300025924 | Ga0207694_10023201 | Ga0207694_100232015 | 217 |
| 281 | 3300025924 | Ga0207694_10373829 | Ga0207694_103738291 | 217 |
| 282 | 3300025928 | Ga0207700_10003574 | Ga0207700_1000357411 | 217 |
| 283 | 3300025928 | Ga0207700_10173994 | Ga0207700_101739942 | 217 |
| 284 | 3300025928 | Ga0207700_10266657 | Ga0207700_102666572 | 217 |
| 285 | 3300025933 | Ga0207706_10182208 | Ga0207706_101822083 | 217 |
| 286 | 3300025939 | Ga0207665_10000363 | Ga0207665_1000036325 | 217 |
| 287 | 3300025941 | Ga0207711_11246893 | Ga0207711_112468931 | 217 |
| 288 | 3300025944 | Ga0207661_10001325 | Ga0207661_1000132510 | 217 |
| 289 | 3300025944 | Ga0207661_10005117 | Ga0207661_100051179 | 217 |
| 290 | 3300025949 | Ga0207667_10020643 | Ga0207667_100206434 | 217 |
| 291 | 3300025949 | Ga0207667_10021642 | Ga0207667_100216425 | 217 |
| 292 | 3300025949 | Ga0207667_10022504 | Ga0207667_100225042 | 217 |
| 293 | 3300025949 | Ga0207667_10162014 | Ga0207667_101620143 | 217 |
| 294 | 3300025949 | Ga0207667_10619745 | Ga0207667_106197451 | 217 |
| 295 | 3300025949 | Ga0207667_11009989 | Ga0207667_110099891 | 217 |
| 296 | 3300025961 | Ga0207712_10151871 | Ga0207712_101518714 | 217 |
| 297 | 3300025981 | Ga0207640_10069528 | Ga0207640_100695283 | 217 |
| 298 | 3300026041 | Ga0207639_10011261 | Ga0207639_100112616 | 217 |
| 299 | 3300026041 | Ga0207639_10023096 | Ga0207639_100230963 | 217 |
| 300 | 3300026041 | Ga0207639_10039677 | Ga0207639_100396773 | 217 |
| 301 | 3300026041 | Ga0207639_10100001 | Ga0207639_101000014 | 217 |
| 302 | 3300026067 | Ga0207678_10027223 | Ga0207678_100272234 | 217 |
| 303 | 3300026067 | Ga0207678_10043518 | Ga0207678_100435185 | 217 |
| 304 | 3300026067 | Ga0207678_10059796 | Ga0207678_100597963 | 217 |
| 305 | 3300026067 | Ga0207678_10631457 | Ga0207678_106314571 | 217 |
| 306 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005118 | 217 |
| 307 | 3300026078 | Ga0207702_10012374 | Ga0207702_100123745 | 217 |
| 308 | 3300026078 | Ga0207702_10073160 | Ga0207702_100731603 | 217 |
| 309 | 3300026116 | Ga0207674_10007127 | Ga0207674_1000712711 | 217 |
| 310 | 3300026116 | Ga0207674_10010385 | Ga0207674_1001038511 | 217 |
| 311 | 3300026116 | Ga0207674_10029991 | Ga0207674_100299916 | 217 |
| 312 | 3300026116 | Ga0207674_10144065 | Ga0207674_101440652 | 217 |
| 313 | 3300026142 | Ga0207698_10054304 | Ga0207698_100543042 | 217 |
| 314 | 3300026142 | Ga0207698_10338583 | Ga0207698_103385832 | 217 |
| 315 | 3300027671 | Ga0209588_1038833 | Ga0209588_10388331 | 217 |
| 316 | 3300028381 | Ga0268264_10000084 | Ga0268264_10000084111 | 217 |
| 317 | 3300028573 | Ga0265334_10018317 | Ga0265334_100183174 | 217 |
| 318 | 3300030760 | Ga0265762_1037889 | Ga0265762_10378891 | 217 |
| 319 | 3300031235 | Ga0265330_10022725 | Ga0265330_100227252 | 217 |
| 320 | 3300031235 | Ga0265330_10034706 | Ga0265330_100347062 | 217 |
| 321 | 3300031235 | Ga0265330_10127812 | Ga0265330_101278122 | 217 |
| 322 | 3300031239 | Ga0265328_10118074 | Ga0265328_101180741 | 217 |
| 323 | 3300031241 | Ga0265325_10035637 | Ga0265325_100356371 | 217 |
| 324 | 3300031247 | Ga0265340_10020650 | Ga0265340_100206504 | 217 |
| 325 | 3300031249 | Ga0265339_10121087 | Ga0265339_101210872 | 217 |
| 326 | 3300031250 | Ga0265331_10035443 | Ga0265331_100354432 | 217 |
| 327 | 3300031250 | Ga0265331_10118534 | Ga0265331_101185341 | 217 |
| 328 | 3300031344 | Ga0265316_10146308 | Ga0265316_101463082 | 217 |
| 329 | 3300031344 | Ga0265316_10326938 | Ga0265316_103269382 | 217 |
| 330 | 3300031911 | Ga0307412_10241517 | Ga0307412_102415172 | 217 |
| 331 | 3300033180 | Ga0307510_10074942 | Ga0307510_100749425 | 217 |
| 332 | 3300035111 | Ga0373923_0008394 | Ga0373923_0008394_1140_1796 | 217 |
| 333 | 3300035111 | Ga0373923_0063252 | Ga0373923_0063252_861_1517 | 217 |
| 334 | 3300035113 | Ga0373936_0131145 | Ga0373936_0131145_160_816 | 217 |
| 335 | 3300035116 | Ga0373945_0004061 | Ga0373945_0004061_2899_3555 | 217 |
| 336 | 3300035117 | Ga0373953_0000405 | Ga0373953_0000405_1654_2310 | 217 |
| 337 | 3300035117 | Ga0373953_0059988 | Ga0373953_0059988_555_1211 | 217 |
| 338 | 3300035118 | Ga0373954_0000641 | Ga0373954_0000641_3472_4128 | 217 |
| 339 | 3300035119 | Ga0373956_0000314 | Ga0373956_0000314_15730_16386 | 217 |
| 340 | 3300035119 | Ga0373956_0092070 | Ga0373956_0092070_638_1321 | 217 |
| 341 | 3300035120 | Ga0373957_0011607 | Ga0373957_0011607_686_1342 | 217 |
| 342 | 3300035170 | Ga0373943_0107787 | Ga0373943_0107787_331_987 | 217 |
| 343 | 3300035172 | Ga0373955_0000682 | Ga0373955_0000682_7645_8301 | 217 |
| 344 | 3300035172 | Ga0373955_0094371 | Ga0373955_0094371_347_1030 | 217 |
| 345 | 3300035410 | Ga0373924_0002550 | Ga0373924_0002550_137_793 | 217 |
| 346 | 3300035410 | Ga0373924_0007083 | Ga0373924_0007083_668_1351 | 217 |
| 347 | 3300035692 | Ga0373935_0071425 | Ga0373935_0071425_1096_1752 | 217 |
| 348 | 3300035695 | Ga0373927_0001312 | Ga0373927_0001312_15260_15916 | 217 |
| 349 | 3300035695 | Ga0373927_0002880 | Ga0373927_0002880_6356_7012 | 217 |
| 350 | 3300035695 | Ga0373927_0041727 | Ga0373927_0041727_139_795 | 217 |
| 351 | 3300035724 | Ga0373933_0001839 | Ga0373933_0001839_1720_2376 | 217 |
| 352 | 3300035724 | Ga0373933_0014885 | Ga0373933_0014885_1435_2118 | 217 |
| 353 | 3300035724 | Ga0373933_0121851 | Ga0373933_0121851_89_745 | 217 |
| 354 | 3300035724 | Ga0373933_0264560 | Ga0373933_0264560_348_1004 | 217 |
| 355 | 3300035725 | Ga0373947_0001076 | Ga0373947_0001076_8784_9440 | 217 |
| 356 | 3300035725 | Ga0373947_0015602 | Ga0373947_0015602_3554_4210 | 217 |
| 357 | 3300036401 | Ga0373937_0057020 | Ga0373937_0057020_10_666 | 217 |
| 358 | 3300036401 | Ga0373937_0182458 | Ga0373937_0182458_331_987 | 217 |
| 359 | 3300036401 | Ga0373937_0241079 | Ga0373937_0241079_850_1533 | 217 |
| 360 | 3300037068 | Ga0373925_0230349 | Ga0373925_0230349_497_1153 | 217 |
| 361 | 3300037068 | Ga0373925_0409333 | Ga0373925_0409333_399_1055 | 217 |
| 362 | 3300037418 | Ga0395900_0051871 | Ga0395900_0051871_1563_2219 | 217 |
| 363 | 3300037418 | Ga0395900_0137986 | Ga0395900_0137986_1474_2130 | 217 |
| 364 | 3300037418 | Ga0395900_0257120 | Ga0395900_0257120_771_1427 | 217 |
| 365 | 3300037466 | Ga0395898_0107612 | Ga0395898_0107612_28_684 | 217 |
| 366 | 3300037853 | Ga0436364_0660550 | Ga0436364_0660550_1360_2016 | 217 |
| 367 | 3300037853 | Ga0436364_0973183 | Ga0436364_0973183_3505_4161 | 217 |
| 368 | 3300038443 | Ga0395901_0302736 | Ga0395901_0302736_496_1152 | 217 |
| 369 | 3300039437 | Ga0436365_0308170 | Ga0436365_0308170_1043_1702 | 217 |
| 370 | 3300039437 | Ga0436365_0405046 | Ga0436365_0405046_1737_2393 | 217 |
| 371 | 3300039437 | Ga0436365_1016429 | Ga0436365_1016429_341_1000 | 217 |
| 372 | 3300039437 | Ga0436365_1676896 | Ga0436365_1676896_320_976 | 217 |
| 373 | 3300041463 | Ga0451804_0023280 | Ga0451804_0023280_120_779 | 217 |
| 374 | 3300041498 | Ga0451841_1402194 | Ga0451841_1402194_81_740 | 217 |
| 375 | 3300044656 | Ga0466969_0088776 | Ga0466969_0088776_78_734 | 217 |
| 376 | 3300044694 | Ga0466963_0258852 | Ga0466963_0258852_372_1028 | 217 |
| 377 | 3300045049 | Ga0466959_0013337 | Ga0466959_0013337_3361_4017 | 217 |
| 378 | 3300045976 | Ga0466967_0010490 | Ga0466967_0010490_4850_5509 | 217 |
| 379 | 3300046454 | Ga0495592_0002806 | Ga0495592_0002806_3476_4132 | 217 |
| 380 | 3300046454 | Ga0495592_0012326 | Ga0495592_0012326_4855_5538 | 217 |
| 381 | 3300046454 | Ga0495592_0109444 | Ga0495592_0109444_1110_1766 | 217 |
| 382 | 3300046455 | Ga0495603_0002071 | Ga0495603_0002071_4321_4977 | 217 |
| 383 | 3300046455 | Ga0495603_0003943 | Ga0495603_0003943_3930_4586 | 217 |
| 384 | 3300046455 | Ga0495603_0040773 | Ga0495603_0040773_32_688 | 217 |
| 385 | 3300046459 | Ga0495629_0000117 | Ga0495629_0000117_28654_29310 | 217 |
| 386 | 3300046459 | Ga0495629_0000450 | Ga0495629_0000450_27265_27921 | 217 |
| 387 | 3300046459 | Ga0495629_0082676 | Ga0495629_0082676_1151_1834 | 217 |
| 388 | 3300046460 | Ga0495638_0029581 | Ga0495638_0029581_753_1409 | 217 |
| 389 | 3300046461 | Ga0495641_0011542 | Ga0495641_0011542_3320_3976 | 217 |
| 390 | 3300046462 | Ga0495651_0003667 | Ga0495651_0003667_5856_6512 | 217 |
| 391 | 3300046462 | Ga0495651_0043199 | Ga0495651_0043199_79_762 | 217 |
| 392 | 3300046462 | Ga0495651_0156977 | Ga0495651_0156977_960_1616 | 217 |
| 393 | 3300046462 | Ga0495651_0193537 | Ga0495651_0193537_216_1013 | 217 |
| 394 | 3300046463 | Ga0495653_0001326 | Ga0495653_0001326_11911_12567 | 217 |
| 395 | 3300046463 | Ga0495653_0012223 | Ga0495653_0012223_6122_6805 | 217 |
| 396 | 3300046472 | Ga0495580_0074361 | Ga0495580_0074361_717_1373 | 217 |
| 397 | 3300046473 | Ga0495582_0000280 | Ga0495582_0000280_12599_13255 | 217 |
| 398 | 3300046475 | Ga0495639_0001793 | Ga0495639_0001793_3156_3812 | 217 |
| 399 | 3300046476 | Ga0495662_0054804 | Ga0495662_0054804_547_1203 | 217 |
| 400 | 3300046476 | Ga0495662_0104698 | Ga0495662_0104698_169_852 | 217 |
| 401 | 3300046477 | Ga0495664_0018356 | Ga0495664_0018356_2679_3338 | 217 |
| 402 | 3300046477 | Ga0495664_0025464 | Ga0495664_0025464_1248_1904 | 217 |
| 403 | 3300046477 | Ga0495664_0048555 | Ga0495664_0048555_158_955 | 217 |
| 404 | 3300046477 | Ga0495664_0096755 | Ga0495664_0096755_642_1325 | 217 |
| 405 | 3300046501 | Ga0495607_0039921 | Ga0495607_0039921_897_1553 | 217 |
| 406 | 3300046506 | Ga0495583_0179604 | Ga0495583_0179604_188_844 | 217 |
| 407 | 3300046507 | Ga0495606_0002759 | Ga0495606_0002759_1730_2386 | 217 |
| 408 | 3300046511 | Ga0495608_0033261 | Ga0495608_0033261_1249_1905 | 217 |
| 409 | 3300046511 | Ga0495608_0300036 | Ga0495608_0300036_164_820 | 217 |
| 410 | 3300046511 | Ga0495608_0369539 | Ga0495608_0369539_80_763 | 217 |
| 411 | 3300046512 | Ga0495610_0073948 | Ga0495610_0073948_352_1008 | 217 |
| 412 | 3300046512 | Ga0495610_0117594 | Ga0495610_0117594_271_927 | 217 |
| 413 | 3300046513 | Ga0495616_0022639 | Ga0495616_0022639_102_758 | 217 |
| 414 | 3300046514 | Ga0495618_0026249 | Ga0495618_0026249_2753_3409 | 217 |
| 415 | 3300046514 | Ga0495618_0044155 | Ga0495618_0044155_509_1165 | 217 |
| 416 | 3300046514 | Ga0495618_0395090 | Ga0495618_0395090_144_827 | 217 |
| 417 | 3300046516 | Ga0495628_0013297 | Ga0495628_0013297_6196_6879 | 217 |
| 418 | 3300046516 | Ga0495628_0039220 | Ga0495628_0039220_797_1453 | 217 |
| 419 | 3300046516 | Ga0495628_0294686 | Ga0495628_0294686_392_1048 | 217 |
| 420 | 3300046517 | Ga0495630_0046122 | Ga0495630_0046122_1827_2483 | 217 |
| 421 | 3300046517 | Ga0495630_0661941 | Ga0495630_0661941_48_704 | 217 |
| 422 | 3300046520 | Ga0495637_0063025 | Ga0495637_0063025_144_800 | 217 |
| 423 | 3300046522 | Ga0495643_0059444 | Ga0495643_0059444_637_1293 | 217 |
| 424 | 3300046524 | Ga0495648_0013322 | Ga0495648_0013322_542_1198 | 217 |
| 425 | 3300046529 | Ga0495652_0011659 | Ga0495652_0011659_1510_2166 | 217 |
| 426 | 3300046529 | Ga0495652_0022099 | Ga0495652_0022099_4946_5629 | 217 |
| 427 | 3300046531 | Ga0495665_0014378 | Ga0495665_0014378_530_1186 | 217 |
| 428 | 3300046531 | Ga0495665_0118116 | Ga0495665_0118116_39_695 | 217 |
| 429 | 3300046533 | Ga0495640_0004186 | Ga0495640_0004186_6969_7625 | 217 |
| 430 | 3300046533 | Ga0495640_0067869 | Ga0495640_0067869_1687_2343 | 217 |
| 431 | 3300046533 | Ga0495640_0184018 | Ga0495640_0184018_280_963 | 217 |
| 432 | 3300046536 | Ga0495587_0220185 | Ga0495587_0220185_367_1050 | 217 |
| 433 | 3300046536 | Ga0495587_0336020 | Ga0495587_0336020_155_811 | 217 |
| 434 | 3300046543 | Ga0495645_0013542 | Ga0495645_0013542_2647_3303 | 217 |
| 435 | 3300046543 | Ga0495645_0130016 | Ga0495645_0130016_923_1582 | 217 |
| 436 | 3300046543 | Ga0495645_0151081 | Ga0495645_0151081_435_1118 | 217 |
| 437 | 3300046557 | Ga0495622_0011358 | Ga0495622_0011358_1861_2517 | 217 |
| 438 | 3300046559 | Ga0495667_0005317 | Ga0495667_0005317_5252_5908 | 217 |
| 439 | 3300046559 | Ga0495667_0006879 | Ga0495667_0006879_6872_7555 | 217 |
| 440 | 3300046642 | Ga0495634_0005151 | Ga0495634_0005151_6457_7113 | 217 |
| 441 | 3300046642 | Ga0495634_0013779 | Ga0495634_0013779_1227_1910 | 217 |
| 442 | 3300046642 | Ga0495634_0022393 | Ga0495634_0022393_3012_3668 | 217 |
| 443 | 3300046663 | Ga0495635_0000949 | Ga0495635_0000949_11570_12226 | 217 |
| 444 | 3300046663 | Ga0495635_0004949 | Ga0495635_0004949_253_909 | 217 |
| 445 | 3300046663 | Ga0495635_0204794 | Ga0495635_0204794_505_1188 | 217 |
| 446 | 3300046665 | Ga0495661_0044317 | Ga0495661_0044317_1829_2485 | 217 |
| 447 | 3300046674 | Ga0495588_0024744 | Ga0495588_0024744_1750_2406 | 217 |
| 448 | 3300046675 | Ga0495657_0006888 | Ga0495657_0006888_5380_6036 | 217 |
| 449 | 3300046675 | Ga0495657_0039426 | Ga0495657_0039426_578_1261 | 217 |
| 450 | 3300046675 | Ga0495657_0326332 | Ga0495657_0326332_209_865 | 217 |
| 451 | 3300046678 | Ga0495599_0001298 | Ga0495599_0001298_5651_6307 | 217 |
| 452 | 3300046678 | Ga0495599_0228419 | Ga0495599_0228419_205_861 | 217 |
| 453 | 3300046679 | Ga0495623_0004108 | Ga0495623_0004108_5856_6512 | 217 |
| 454 | 3300046680 | Ga0495646_0019121 | Ga0495646_0019121_402_1058 | 217 |
| 455 | 3300046680 | Ga0495646_0065295 | Ga0495646_0065295_922_1578 | 217 |
| 456 | 3300046680 | Ga0495646_0142405 | Ga0495646_0142405_324_1007 | 217 |
| 457 | 3300046681 | Ga0495647_0003898 | Ga0495647_0003898_3135_3791 | 217 |
| 458 | 3300046683 | Ga0495658_0000486 | Ga0495658_0000486_17032_17688 | 217 |
| 459 | 3300046689 | Ga0495613_0014754 | Ga0495613_0014754_3883_4539 | 217 |
| 460 | 3300046689 | Ga0495613_0125892 | Ga0495613_0125892_626_1282 | 217 |
| 461 | 3300046689 | Ga0495613_0318773 | Ga0495613_0318773_44_700 | 217 |
| 462 | 3300046690 | Ga0495624_0022892 | Ga0495624_0022892_1720_2376 | 217 |
| 463 | 3300046691 | Ga0495670_0020661 | Ga0495670_0020661_2054_2710 | 217 |
| 464 | 3300046809 | Ga0495600_0003929 | Ga0495600_0003929_2922_3578 | 217 |
| 465 | 3300046809 | Ga0495600_0053549 | Ga0495600_0053549_1152_1835 | 217 |
| 466 | 3300047315 | Ga0495581_0006098 | Ga0495581_0006098_4710_5366 | 217 |
| 467 | 3300047315 | Ga0495581_0256702 | Ga0495581_0256702_42_698 | 217 |
| 468 | 3300047317 | Ga0495604_0002058 | Ga0495604_0002058_6218_6874 | 217 |
| 469 | 3300047317 | Ga0495604_0143282 | Ga0495604_0143282_947_1630 | 217 |
| 470 | 3300047319 | Ga0495674_0003657 | Ga0495674_0003657_1193_1849 | 217 |
| 471 | 3300047319 | Ga0495674_0010681 | Ga0495674_0010681_1396_2079 | 217 |
| 472 | 3300047319 | Ga0495674_0029958 | Ga0495674_0029958_140_796 | 217 |
| 473 | 3300047320 | Ga0495672_0099097 | Ga0495672_0099097_758_1414 | 217 |
| 474 | 3300047321 | Ga0495676_0037216 | Ga0495676_0037216_1890_2546 | 217 |
| 475 | 3300047322 | Ga0495680_0000314 | Ga0495680_0000314_8364_9020 | 217 |
| 476 | 3300047322 | Ga0495680_0133989 | Ga0495680_0133989_774_1571 | 217 |
| 477 | 3300047444 | Ga0495675_0001080 | Ga0495675_0001080_1582_2238 | 217 |
| 478 | 3300047444 | Ga0495675_0023917 | Ga0495675_0023917_782_1465 | 217 |
| 479 | 3300047444 | Ga0495675_0195812 | Ga0495675_0195812_161_817 | 217 |
| 480 | 3300047469 | Ga0495673_0010805 | Ga0495673_0010805_2394_3050 | 217 |
| 481 | 3300047471 | Ga0495684_0000088 | Ga0495684_0000088_60578_61234 | 217 |
| 482 | 3300047472 | Ga0495686_0227095 | Ga0495686_0227095_124_810 | 217 |
| 483 | 3300047673 | Ga0495593_0000167 | Ga0495593_0000167_32303_32959 | 217 |
| 484 | 3300047673 | Ga0495593_0003413 | Ga0495593_0003413_3142_3798 | 217 |
| 485 | 3300047673 | Ga0495593_0128125 | Ga0495593_0128125_142_825 | 217 |
| 486 | 3300048088 | Ga0495602_0015717 | Ga0495602_0015717_1720_2376 | 217 |
| 487 | 3300048088 | Ga0495602_0046919 | Ga0495602_0046919_811_1494 | 217 |
| 488 | 3300048088 | Ga0495602_0337622 | Ga0495602_0337622_14_670 | 217 |
| 489 | 3300048088 | Ga0495602_0408893 | Ga0495602_0408893_180_836 | 217 |
| 490 | 3300048089 | Ga0495614_0189626 | Ga0495614_0189626_48_704 | 217 |
| 491 | 3300048091 | Ga0495626_0063560 | Ga0495626_0063560_19_675 | 217 |
| 492 | 3300048904 | Ga0496101_0350846 | Ga0496101_0350846_258_1010 | 217 |
| 493 | 3300048904 | Ga0496101_0392868 | Ga0496101_0392868_305_991 | 217 |
| 494 | 3300048905 | Ga0496102_0318638 | Ga0496102_0318638_31_690 | 217 |
| 495 | 3300048905 | Ga0496102_0331185 | Ga0496102_0331185_590_1276 | 217 |
| 496 | 3300048909 | Ga0496106_0006715 | Ga0496106_0006715_4705_5457 | 217 |
| 497 | 3300048909 | Ga0496106_0219767 | Ga0496106_0219767_181_867 | 217 |
| 498 | 3300048910 | Ga0496107_0002627 | Ga0496107_0002627_1813_2565 | 217 |
| 499 | 3300048910 | Ga0496107_0431622 | Ga0496107_0431622_252_938 | 217 |
| 500 | 3300048911 | Ga0496108_0000464 | Ga0496108_0000464_17203_17955 | 217 |
| 501 | 3300048912 | Ga0496109_0000399 | Ga0496109_0000399_37763_38515 | 217 |
| 502 | 3300048912 | Ga0496109_0862349 | Ga0496109_0862349_108_764 | 217 |
| 503 | 3300048913 | Ga0496110_0106972 | Ga0496110_0106972_179_931 | 217 |
| 504 | 3300048913 | Ga0496110_0108063 | Ga0496110_0108063_300_956 | 217 |
| 505 | 3300048914 | Ga0496111_0103387 | Ga0496111_0103387_729_1385 | 217 |
| 506 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_114497_115153 | 217 |
| 507 | 3300048915 | Ga0496112_0007959 | Ga0496112_0007959_2637_3389 | 217 |
| 508 | 3300048915 | Ga0496112_0307608 | Ga0496112_0307608_525_1184 | 217 |
| 509 | 3300048916 | Ga0496113_0018089 | Ga0496113_0018089_139_891 | 217 |
| 510 | 3300048916 | Ga0496113_0152558 | Ga0496113_0152558_908_1564 | 217 |
| 511 | 3300048917 | Ga0496114_0072004 | Ga0496114_0072004_2100_2756 | 217 |
| 512 | 3300048918 | Ga0496115_0154640 | Ga0496115_0154640_714_1466 | 217 |
| 513 | 3300048918 | Ga0496115_0290250 | Ga0496115_0290250_256_942 | 217 |
| 514 | 3300048919 | Ga0496116_0024869 | Ga0496116_0024869_1709_2365 | 217 |
| 515 | 3300048920 | Ga0496117_0030136 | Ga0496117_0030136_1490_2146 | 217 |
| 516 | 3300048920 | Ga0496117_0054945 | Ga0496117_0054945_1886_2542 | 217 |
| 517 | 3300048921 | Ga0496118_0063023 | Ga0496118_0063023_1284_1940 | 217 |
| 518 | 3300048921 | Ga0496118_0172612 | Ga0496118_0172612_309_965 | 217 |
| 519 | 3300048922 | Ga0496119_0034120 | Ga0496119_0034120_2548_3204 | 217 |
| 520 | 3300048922 | Ga0496119_0082553 | Ga0496119_0082553_12_668 | 217 |
| 521 | 3300048923 | Ga0496120_0116032 | Ga0496120_0116032_55_711 | 217 |
| 522 | 3300048924 | Ga0496121_0026862 | Ga0496121_0026862_2425_3081 | 217 |
| 523 | 3300048924 | Ga0496121_0083202 | Ga0496121_0083202_669_1325 | 217 |
| 524 | 3300048924 | Ga0496121_0144425 | Ga0496121_0144425_444_1100 | 217 |
| 525 | 3300048924 | Ga0496121_0193608 | Ga0496121_0193608_708_1364 | 217 |
| 526 | 3300048924 | Ga0496121_0258092 | Ga0496121_0258092_513_1169 | 217 |
| 527 | 3300048925 | Ga0496122_0062839 | Ga0496122_0062839_1815_2471 | 217 |
| 528 | 3300048925 | Ga0496122_0117495 | Ga0496122_0117495_576_1232 | 217 |
| 529 | 3300048925 | Ga0496122_0221446 | Ga0496122_0221446_245_901 | 217 |
| 530 | 3300048926 | Ga0496123_0013979 | Ga0496123_0013979_4384_5040 | 217 |
| 531 | 3300048926 | Ga0496123_0061756 | Ga0496123_0061756_254_910 | 217 |
| 532 | 3300048927 | Ga0496124_0264121 | Ga0496124_0264121_221_877 | 217 |
| 533 | 3300048928 | Ga0496125_0000125 | Ga0496125_0000125_65534_66193 | 217 |
| 534 | 3300048928 | Ga0496125_0033246 | Ga0496125_0033246_753_1409 | 217 |
| 535 | 3300048928 | Ga0496125_0144717 | Ga0496125_0144717_807_1463 | 217 |
| 536 | 3300048928 | Ga0496125_0479760 | Ga0496125_0479760_26_682 | 217 |
| 537 | 3300048929 | Ga0496126_0020631 | Ga0496126_0020631_5206_5871 | 217 |
| 538 | 3300048929 | Ga0496126_0032435 | Ga0496126_0032435_3775_4431 | 217 |
| 539 | 3300048929 | Ga0496126_0041180 | Ga0496126_0041180_3454_4110 | 217 |
| 540 | 3300048929 | Ga0496126_0124826 | Ga0496126_0124826_181_837 | 217 |
| 541 | 3300048929 | Ga0496126_0153241 | Ga0496126_0153241_748_1407 | 217 |
| 542 | 3300048929 | Ga0496126_0159370 | Ga0496126_0159370_1029_1685 | 217 |
| 543 | 3300048929 | Ga0496126_0271184 | Ga0496126_0271184_293_949 | 217 |
| 544 | 3300048929 | Ga0496126_0444150 | Ga0496126_0444150_80_736 | 217 |
| 545 | 3300048929 | Ga0496126_0553580 | Ga0496126_0553580_14_670 | 217 |
| 546 | 3300049569 | Ga0501032_0202709 | Ga0501032_0202709_209_865 | 217 |
| 547 | 3300049571 | Ga0501034_0096888 | Ga0501034_0096888_1683_2339 | 217 |
| 548 | 3300049572 | Ga0501036_0054046 | Ga0501036_0054046_136_792 | 217 |
| 549 | 3300049572 | Ga0501036_0069177 | Ga0501036_0069177_1720_2376 | 217 |
| 550 | 3300049572 | Ga0501036_0305003 | Ga0501036_0305003_330_986 | 217 |
| 551 | 3300049573 | Ga0501037_0024331 | Ga0501037_0024331_1508_2164 | 217 |
| 552 | 3300049573 | Ga0501037_0070684 | Ga0501037_0070684_970_1626 | 217 |
| 553 | 3300049573 | Ga0501037_0179731 | Ga0501037_0179731_271_927 | 217 |
| 554 | 3300049573 | Ga0501037_0267176 | Ga0501037_0267176_267_923 | 217 |
| 555 | 3300049574 | Ga0501038_0006497 | Ga0501038_0006497_4347_5003 | 217 |
| 556 | 3300049574 | Ga0501038_0008894 | Ga0501038_0008894_8204_8860 | 217 |
| 557 | 3300049576 | Ga0501040_0083241 | Ga0501040_0083241_515_1171 | 217 |
| 558 | 3300049577 | Ga0501041_0104797 | Ga0501041_0104797_134_796 | 217 |
| 559 | 3300049579 | Ga0501043_0019191 | Ga0501043_0019191_1331_1987 | 217 |
| 560 | 3300049579 | Ga0501043_0396605 | Ga0501043_0396605_360_1016 | 217 |
| 561 | 3300049579 | Ga0501043_0608526 | Ga0501043_0608526_67_723 | 217 |
| 562 | 3300049581 | Ga0501047_0064573 | Ga0501047_0064573_1134_1790 | 217 |
| 563 | 3300049581 | Ga0501047_0157239 | Ga0501047_0157239_1002_1658 | 217 |
| 564 | 3300049581 | Ga0501047_0604310 | Ga0501047_0604310_130_786 | 217 |
| 565 | 3300049583 | Ga0501067_0004867 | Ga0501067_0004867_3475_4131 | 217 |
| 566 | 3300049583 | Ga0501067_0243148 | Ga0501067_0243148_156_812 | 217 |
| 567 | 3300049586 | Ga0501070_0048707 | Ga0501070_0048707_258_914 | 217 |
| 568 | 3300049586 | Ga0501070_0060938 | Ga0501070_0060938_483_1139 | 217 |
| 569 | 3300049586 | Ga0501070_0352771 | Ga0501070_0352771_516_1172 | 217 |
| 570 | 3300049587 | Ga0501071_0279643 | Ga0501071_0279643_268_924 | 217 |
| 571 | 3300049588 | Ga0501072_0657879 | Ga0501072_0657879_16_672 | 217 |
| 572 | 3300049589 | Ga0501073_0010841 | Ga0501073_0010841_2826_3482 | 217 |
| 573 | 3300049589 | Ga0501073_0073376 | Ga0501073_0073376_879_1535 | 217 |
| 574 | 3300049590 | Ga0501074_0011477 | Ga0501074_0011477_5652_6308 | 217 |
| 575 | 3300049590 | Ga0501074_0108495 | Ga0501074_0108495_156_812 | 217 |
| 576 | 3300049593 | Ga0501077_0458076 | Ga0501077_0458076_85_741 | 217 |
| 577 | 3300049741 | Ga0501079_0064135 | Ga0501079_0064135_2044_2700 | 217 |
| 578 | 3300049742 | Ga0501080_0045880 | Ga0501080_0045880_1322_1978 | 217 |
| 579 | 3300049742 | Ga0501080_0068846 | Ga0501080_0068846_1757_2413 | 217 |
| 580 | 3300049742 | Ga0501080_0345970 | Ga0501080_0345970_497_1153 | 217 |
| 581 | 3300049822 | Ga0501035_0021488 | Ga0501035_0021488_4090_4746 | 217 |
| 582 | 3300049822 | Ga0501035_0129458 | Ga0501035_0129458_1048_1704 | 217 |
| 583 | 3300049822 | Ga0501035_0140799 | Ga0501035_0140799_1328_1984 | 217 |
| 584 | 3300049822 | Ga0501035_0176199 | Ga0501035_0176199_809_1465 | 217 |
| 585 | 3300049823 | Ga0501044_0052081 | Ga0501044_0052081_593_1249 | 217 |
| 586 | 3300049823 | Ga0501044_0087577 | Ga0501044_0087577_1214_1870 | 217 |
| 587 | 3300049823 | Ga0501044_0145565 | Ga0501044_0145565_589_1245 | 217 |
| 588 | 3300049823 | Ga0501044_0226552 | Ga0501044_0226552_233_889 | 217 |
| 589 | 3300049823 | Ga0501044_0494392 | Ga0501044_0494392_122_778 | 217 |
| 590 | 3300050491 | nmdc:mga00v17_102830_c1 | nmdc:mga00v17_102830_c1_730_1386 | 217 |
| 591 | 3300050492 | nmdc:mga0yw44_52887_c1 | nmdc:mga0yw44_52887_c1_1085_1741 | 217 |
| 592 | 3300050494 | nmdc:mga06z11_101791_c1 | nmdc:mga06z11_101791_c1_417_1073 | 217 |
| 593 | 3300050516 | nmdc:mga0sz30_10422_c1 | nmdc:mga0sz30_10422_c1_946_1602 | 217 |
| 594 | 3300053077 | Ga0495601_0021302 | Ga0495601_0021302_2781_3440 | 217 |
| 595 | 3300053077 | Ga0495601_0026803 | Ga0495601_0026803_2878_3534 | 217 |
| 596 | 3300053077 | Ga0495601_0072006 | Ga0495601_0072006_243_899 | 217 |
| 597 | 3300053077 | Ga0495601_0105904 | Ga0495601_0105904_899_1582 | 217 |
| 598 | 3300053078 | Ga0495612_0031500 | Ga0495612_0031500_908_1567 | 217 |
| 599 | 3300053078 | Ga0495612_0084555 | Ga0495612_0084555_20_703 | 217 |
| 600 | 3300053080 | Ga0500635_0021142 | Ga0500635_0021142_498_1154 | 217 |
| 601 | 3300053084 | Ga0495595_0000602 | Ga0495595_0000602_5332_5988 | 217 |
| 602 | 3300053085 | Ga0495619_0000166 | Ga0495619_0000166_44847_45503 | 217 |
| 603 | 3300053086 | Ga0500578_0240391 | Ga0500578_0240391_59_715 | 217 |
| 604 | 3300053087 | Ga0500643_006227 | Ga0500643_006227_2527_3183 | 217 |
| 605 | 3300053094 | Ga0500566_0005486 | Ga0500566_0005486_4866_5522 | 217 |
| 606 | 3300053098 | Ga0500650_0000314 | Ga0500650_0000314_9082_9738 | 217 |
| 607 | 3300053102 | Ga0500554_078704 | Ga0500554_078704_191_847 | 217 |
| 608 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_463147_463803 | 217 |
| 609 | 3300053108 | Ga0500562_036129 | Ga0500562_036129_110_766 | 217 |
| 610 | 3300053116 | Ga0500592_001447 | Ga0500592_001447_1565_2221 | 217 |
| 611 | 3300053116 | Ga0500592_016088 | Ga0500592_016088_463_1119 | 217 |
| 612 | 3300053118 | Ga0500594_0032451 | Ga0500594_0032451_310_966 | 217 |
| 613 | 3300053119 | Ga0500595_001257 | Ga0500595_001257_9334_10020 | 217 |
| 614 | 3300053119 | Ga0500595_003606 | Ga0500595_003606_1058_1714 | 217 |
| 615 | 3300053119 | Ga0500595_006150 | Ga0500595_006150_2539_3195 | 217 |
| 616 | 3300053119 | Ga0500595_023234 | Ga0500595_023234_570_1241 | 217 |
| 617 | 3300053121 | Ga0500607_107007 | Ga0500607_107007_623_1279 | 217 |
| 618 | 3300053122 | Ga0500608_057032 | Ga0500608_057032_213_869 | 217 |
| 619 | 3300053125 | Ga0500618_028750 | Ga0500618_028750_175_831 | 217 |
| 620 | 3300053130 | Ga0500642_0000016 | Ga0500642_0000016_173921_174577 | 217 |
| 621 | 3300053130 | Ga0500642_0050391 | Ga0500642_0050391_657_1328 | 217 |
| 622 | 3300053134 | Ga0500658_0112092 | Ga0500658_0112092_234_890 | 217 |
| 623 | 3300053136 | Ga0500559_0000675 | Ga0500559_0000675_2189_2845 | 217 |
| 624 | 3300053139 | Ga0500568_0000994 | Ga0500568_0000994_16504_17160 | 217 |
| 625 | 3300053139 | Ga0500568_0002965 | Ga0500568_0002965_8541_9227 | 217 |
| 626 | 3300053139 | Ga0500568_0035032 | Ga0500568_0035032_453_1109 | 217 |
| 627 | 3300053142 | Ga0500577_0000249 | Ga0500577_0000249_11239_11895 | 217 |
| 628 | 3300053145 | Ga0500586_001227 | Ga0500586_001227_957_1613 | 217 |
| 629 | 3300053150 | Ga0500603_000599 | Ga0500603_000599_822_1478 | 217 |
| 630 | 3300053151 | Ga0500604_0007338 | Ga0500604_0007338_2066_2722 | 217 |
| 631 | 3300053153 | Ga0500616_0001314 | Ga0500616_0001314_21699_22355 | 217 |
| 632 | 3300053156 | Ga0500622_0002221 | Ga0500622_0002221_12963_13619 | 217 |
| 633 | 3300053156 | Ga0500622_0029814 | Ga0500622_0029814_1039_1695 | 217 |
| 634 | 3300053158 | Ga0500627_0057085 | Ga0500627_0057085_358_1014 | 217 |
| 635 | 3300053158 | Ga0500627_0135131 | Ga0500627_0135131_91_747 | 217 |
| 636 | 3300053160 | Ga0500633_0038469 | Ga0500633_0038469_249_905 | 217 |
| 637 | 3300053178 | Ga0500637_0149635 | Ga0500637_0149635_532_1188 | 217 |
| 638 | 3300053727 | Ga0500611_070160 | Ga0500611_070160_32_688 | 217 |
| 639 | 3300054114 | Ga0501084_0522553 | Ga0501084_0522553_63_719 | 217 |
| 640 | 3300060353 | Ga0501082_0121061 | Ga0501082_0121061_177_833 | 217 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mp4-assembly1.cif.gz_B | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8992 | 1 | 203 |
| 4mp4-assembly2.cif.gz_C-2 | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8931 | 1 | 203 |
| 4mp4-assembly2.cif.gz_C-2 | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8716 | 1 | 203 |
| 4mp4-assembly1.cif.gz_B | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8472 | 1 | 203 |
| 4jbb-assembly1.cif.gz_A-2 | crystal structure of glutathione s-transferase a6tby7(target efi-507184) from klebsiella pneumoniae mgh 78578, gsh complex | 0.8433 | 2 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3Z8I7_45_138_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9013 | 1 | 81 | 3.40.30.10 |
| 3ljrB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8988 | 1 | 81 | 3.40.30.10 |
| 4mpgB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8908 | 1 | 81 | 3.40.30.10 |
| 2c3nB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8895 | 3 | 81 | 3.40.30.10 |
| af_Q54JU2_4_83_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8839 | 3 | 81 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F7QP79-F1-model_v4 | Glutathione S-transferase (EC 2.5.1.18) | 0.9965 | 1 | 216 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A844TFJ1-F1-model_v4 | Glutathione S-transferase | 0.9913 | 1 | 215 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-F7QP79-F1-model_v4 | Glutathione S-transferase (EC 2.5.1.18) | 0.9874 | 1 | 216 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A090N6Z3-F1-model_v4 | Glutathione S-transferase | 0.9835 | 104 | 216 |
|
| AF-A0A348G0D0-F1-model_v4 | Glutathione S-transferase | 0.9819 | 3 | 217 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar