F471690

General Info

Members Datasets Scaffolds Average Seq Length
640 231 633 231

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10184906|Ga0207657_101849062
Length 258
Sequence MVKKPLFPRRCAEDKARAATGRRKPVVLPLLLSLAIVGSDVETATAKVPMDPNNPSCPKDLNWSTYRPMRFTYMEVEGLHILKAEGVIDADVASRLQAAIDEHKQIDEIWLRSPGGDARAGNEAGKLIRKLSLPTRIPSSWACFSACNFMFMGGPIRYVDGGGLFVVHMFTHVGDKDAVQAEVSKGADATAQLIGDVEQDSAMLASEDNDFLIKMGVSRKLLTEVMYKQKAVSAAADKSTRRCLTESETGRYNVANAR

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
6 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
7 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
218 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
219 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
226 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
227 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
228 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
229 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0.62
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.62
Nodule 0
Rhizoplane 2.97
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001923 3300001915 Bacteria 5607
2 JGI24740J21852_10000589 3300001979 Bacteria 15669
3 JGI24740J21852_10012508 3300001979 Bacteria 3197
4 JGI24739J22299_10006394 3300001989 Bacteria 4448
5 JGI24739J22299_10036502 3300001989 Bacteria 1660
6 JGI24737J22298_10000717 3300001990 Bacteria 11659
7 JGI24735J21928_10005017 3300002067 Bacteria 4406
8 JGI24738J21930_10003360 3300002075 Bacteria 4056
9 JGI24751J29686_10018154 3300002459 Bacteria 1454
10 rootH2_10242183 3300003320 Bacteria 1985
11 Ga0055536_1004420 3300003781 Bacteria 7198
12 Ga0055536_1007529 3300003781 Bacteria 4851
13 Ga0055536_1041416 3300003781 Bacteria 1087
14 Ga0055530_10000174 3300003791 Bacteria 58795
15 Ga0055530_10000411 3300003791 Bacteria 38127
16 Ga0055531_10001746 3300003794 Bacteria 15529
17 Ga0055531_10014294 3300003794 Bacteria 3584
18 Ga0065712_10026688 3300005290 Bacteria 1383
19 Ga0065712_10069709 3300005290 Bacteria 6834
20 Ga0065715_10096862 3300005293 Bacteria 3806
21 Ga0065715_10140770 3300005293 Bacteria 1857
22 Ga0070658_10000205 3300005327 Bacteria 52211
23 Ga0070658_10000891 3300005327 Bacteria 25556
24 Ga0070658_10009153 3300005327 Bacteria 7961
25 Ga0070658_10022228 3300005327 Bacteria 5089
26 Ga0070658_10034793 3300005327 Bacteria 4054
27 Ga0070658_10059348 3300005327 Bacteria 3115
28 Ga0070658_10072962 3300005327 Bacteria 2814
29 Ga0070658_10083456 3300005327 Bacteria 2626
30 Ga0070658_10121389 3300005327 Bacteria 2171
31 Ga0070658_10131772 3300005327 Bacteria 2084
32 Ga0070658_10161080 3300005327 Bacteria 1882
33 Ga0070658_10229267 3300005327 Bacteria 1572
34 Ga0070676_10069234 3300005328 Bacteria 2115
35 Ga0070683_100002492 3300005329 Bacteria 14662
36 Ga0070683_100066511 3300005329 Bacteria 3357
37 Ga0070683_100809647 3300005329 Bacteria 898
38 Ga0070690_100037433 3300005330 Bacteria 3057
39 Ga0070670_100002488 3300005331 Bacteria 15189
40 Ga0070670_100003822 3300005331 Bacteria 12544
41 Ga0070670_100018791 3300005331 Bacteria 5925
42 Ga0070670_100259621 3300005331 Bacteria 1514
43 Ga0070670_100288311 3300005331 Bacteria 1434
44 Ga0070670_100352222 3300005331 Bacteria 1294
45 Ga0070677_10000856 3300005333 Bacteria 10029
46 Ga0070677_10014371 3300005333 Bacteria 2785
47 Ga0070677_10096094 3300005333 Bacteria 1298
48 Ga0070677_10172307 3300005333 Bacteria 1024
49 Ga0070677_10265619 3300005333 Bacteria 858
50 Ga0068869_100416478 3300005334 Bacteria 1108
51 Ga0070666_10000168 3300005335 Bacteria 45111
52 Ga0070666_10000385 3300005335 Bacteria 27714
53 Ga0070666_10065096 3300005335 Bacteria 2473
54 Ga0070666_10122415 3300005335 Bacteria 1804
55 Ga0070666_10335537 3300005335 Bacteria 1080
56 Ga0070680_100001856 3300005336 Bacteria 15485
57 Ga0070680_100033201 3300005336 Bacteria 4158
58 Ga0070680_100033649 3300005336 Bacteria 4133
59 Ga0070682_100011208 3300005337 Bacteria 5115
60 Ga0070682_100223535 3300005337 Bacteria 1342
61 Ga0068868_100329085 3300005338 Bacteria 1304
62 Ga0070660_100000009 3300005339 Bacteria 145691
63 Ga0070660_100001447 3300005339 Bacteria 16220
64 Ga0070660_100007404 3300005339 Bacteria 7646
65 Ga0070660_100009003 3300005339 Bacteria 7004
66 Ga0070660_100015642 3300005339 Bacteria 5483
67 Ga0070660_100018047 3300005339 Bacteria 5148
68 Ga0070660_100050051 3300005339 Bacteria 3214
69 Ga0070660_100171776 3300005339 Bacteria 1751
70 Ga0070660_100294495 3300005339 Bacteria 1329
71 Ga0070661_100000100 3300005344 Bacteria 70585
72 Ga0070661_100000272 3300005344 Bacteria 41918
73 Ga0070661_100003998 3300005344 Bacteria 10140
74 Ga0070661_100004554 3300005344 Bacteria 9537
75 Ga0070661_100093937 3300005344 Bacteria 2222
76 Ga0070661_100133218 3300005344 Bacteria 1868
77 Ga0070661_100170285 3300005344 Bacteria 1653
78 Ga0070661_100184699 3300005344 Bacteria 1588
79 Ga0070661_100494099 3300005344 Bacteria 979
80 Ga0070661_100625755 3300005344 Unclassified 872
81 Ga0070692_10005301 3300005345 Bacteria 5479
82 Ga0070692_10009601 3300005345 Bacteria 4368
83 Ga0070692_10060806 3300005345 Bacteria 1990
84 Ga0070692_10062491 3300005345 Bacteria 1965
85 Ga0070668_100043084 3300005347 Bacteria 3461
86 Ga0070669_100000110 3300005353 Bacteria 79144
87 Ga0070669_100379190 3300005353 Bacteria 1153
88 Ga0070669_100435099 3300005353 Bacteria 1079
89 Ga0070669_100526128 3300005353 Bacteria 984
90 Ga0070675_100001558 3300005354 Bacteria 16951
91 Ga0070675_100002760 3300005354 Bacteria 13196
92 Ga0070671_100000004 3300005355 Bacteria 262155
93 Ga0070671_100003268 3300005355 Bacteria 12653
94 Ga0070671_100027694 3300005355 Bacteria 4666
95 Ga0070671_100331139 3300005355 Bacteria 1298
96 Ga0070674_100006704 3300005356 Bacteria 6738
97 Ga0070673_100033005 3300005364 Bacteria 3904
98 Ga0070673_100075351 3300005364 Bacteria 2721
99 Ga0070673_100143721 3300005364 Bacteria 2015
100 Ga0070673_100280595 3300005364 Bacteria 1461
101 Ga0070673_100325450 3300005364 Bacteria 1359
102 Ga0070659_100000001 3300005366 Bacteria 576390
103 Ga0070659_100000048 3300005366 Bacteria 98245
104 Ga0070659_100026112 3300005366 Bacteria 4492
105 Ga0070659_100037728 3300005366 Bacteria 3767
106 Ga0070659_100039337 3300005366 Bacteria 3691
107 Ga0070659_100098108 3300005366 Bacteria 2356
108 Ga0070659_100135269 3300005366 Bacteria 2004
109 Ga0070659_100200954 3300005366 Bacteria 1641
110 Ga0070659_100215587 3300005366 Bacteria 1583
111 Ga0070667_100003299 3300005367 Bacteria 13798
112 Ga0070667_100003776 3300005367 Bacteria 12872
113 Ga0070667_100236690 3300005367 Bacteria 1629
114 Ga0070667_100720688 3300005367 Bacteria 923
115 Ga0070705_100096057 3300005440 Bacteria 1859
116 Ga0070708_100046595 3300005445 Bacteria 3826
117 Ga0070708_100260947 3300005445 Bacteria 1629
118 Ga0070663_100003985 3300005455 Bacteria 8618
119 Ga0070663_100008255 3300005455 Bacteria 6399
120 Ga0070663_100046589 3300005455 Bacteria 3068
121 Ga0070663_100207552 3300005455 Bacteria 1532
122 Ga0070662_100000035 3300005457 Bacteria 77342
123 Ga0070662_100006246 3300005457 Bacteria 7674
124 Ga0070662_100010614 3300005457 Bacteria 6056
125 Ga0070662_100052774 3300005457 Bacteria 2941
126 Ga0070662_100370102 3300005457 Bacteria 1177
127 Ga0070662_100410576 3300005457 Bacteria 1119
128 Ga0070681_10032307 3300005458 Bacteria 5252
129 Ga0070681_10086088 3300005458 Bacteria 3095
130 Ga0070681_10174003 3300005458 Bacteria 2074
131 Ga0070681_10396576 3300005458 Bacteria 1291
132 Ga0068867_100063594 3300005459 Bacteria 2743
133 Ga0070685_10506620 3300005466 Bacteria 855
134 Ga0070679_100000007 3300005530 Bacteria 195373
135 Ga0070679_100123415 3300005530 Bacteria 2573
136 Ga0070679_100229411 3300005530 Bacteria 1816
137 Ga0070679_100255097 3300005530 Bacteria 1709
138 Ga0070679_100438485 3300005530 Bacteria 1251
139 Ga0070684_100034504 3300005535 Bacteria 4326
140 Ga0070684_100235931 3300005535 Bacteria 1671
141 Ga0068853_100001248 3300005539 Bacteria 18175
142 Ga0068853_100008412 3300005539 Bacteria 8290
143 Ga0068853_100008550 3300005539 Bacteria 8225
144 Ga0070672_100011897 3300005543 Bacteria 6083
145 Ga0070672_100035416 3300005543 Bacteria 3795
146 Ga0070672_100357355 3300005543 Bacteria 1246
147 Ga0070686_100782141 3300005544 Bacteria 768
148 Ga0070693_100003192 3300005547 Bacteria 7608
149 Ga0070693_100066300 3300005547 Bacteria 2113
150 Ga0070665_100005659 3300005548 Bacteria 12847
151 Ga0070665_100008493 3300005548 Bacteria 10388
152 Ga0070665_100018140 3300005548 Bacteria 7060
153 Ga0070665_100276521 3300005548 Bacteria 1681
154 Ga0068855_100001487 3300005563 Bacteria 29322
155 Ga0068855_100005300 3300005563 Bacteria 15748
156 Ga0068855_100022719 3300005563 Bacteria 7516
157 Ga0068855_100275469 3300005563 Bacteria 1870
158 Ga0068855_100487748 3300005563 Bacteria 1341
159 Ga0068855_100546441 3300005563 Bacteria 1254
160 Ga0070664_100000025 3300005564 Bacteria 93173
161 Ga0070664_100009261 3300005564 Bacteria 7992
162 Ga0070664_100015867 3300005564 Bacteria 6167
163 Ga0070664_100177385 3300005564 Bacteria 1892
164 Ga0070664_100259314 3300005564 Bacteria 1564
165 Ga0068857_100044888 3300005577 Bacteria 3920
166 Ga0068857_100074968 3300005577 Bacteria 3016
167 Ga0068854_100002258 3300005578 Bacteria 11855
168 Ga0068854_100005024 3300005578 Bacteria 8340
169 Ga0068854_100009160 3300005578 Bacteria 6384
170 Ga0068854_100161568 3300005578 Bacteria 1735
171 Ga0068856_100000124 3300005614 Bacteria 77469
172 Ga0068856_100145935 3300005614 Bacteria 2374
173 Ga0068852_100025719 3300005616 Bacteria 4774
174 Ga0068852_100090579 3300005616 Bacteria 2735
175 Ga0068852_100111711 3300005616 Bacteria 2485
176 Ga0068852_100291754 3300005616 Bacteria 1576
177 Ga0068852_100621536 3300005616 Bacteria 1086
178 Ga0068852_100761845 3300005616 Unclassified 980
179 Ga0068859_100003489 3300005617 Bacteria 16009
180 Ga0068864_100002725 3300005618 Bacteria 14543
181 Ga0068864_100015927 3300005618 Bacteria 6258
182 Ga0068864_100037788 3300005618 Bacteria 4122
183 Ga0068864_100149531 3300005618 Bacteria 2114
184 Ga0068861_100082375 3300005719 Bacteria 2521
185 Ga0068863_100003546 3300005841 Bacteria 15401
186 Ga0068863_100080154 3300005841 Bacteria 3092
187 Ga0068863_100782081 3300005841 Bacteria 951
188 Ga0068858_100020174 3300005842 Bacteria 6232
189 Ga0068858_100087372 3300005842 Bacteria 2900
190 Ga0068860_100114241 3300005843 Bacteria 2582
191 Ga0068860_100131997 3300005843 Bacteria 2397
192 Ga0068860_100761851 3300005843 Bacteria 980
193 Ga0068862_100000137 3300005844 Bacteria 82832
194 Ga0075362_10083482 3300006177 Bacteria 1475
195 Ga0075369_10104765 3300006186 Bacteria 1271
196 Ga0097621_100135322 3300006237 Bacteria 2101
197 Ga0075429_100369150 3300006880 Bacteria 1256
198 Ga0097620_100003489 3300006931 Bacteria 16009
199 Ga0105251_10034221 3300009011 Bacteria 2516
200 Ga0105241_10007654 3300009174 Bacteria 7941
201 Ga0105241_10495843 3300009174 Bacteria 1088
202 Ga0105248_10000163 3300009177 Bacteria 77658
203 Ga0105248_10050891 3300009177 Bacteria 4648
204 Ga0105248_10060179 3300009177 Bacteria 4264
205 Ga0105248_10065042 3300009177 Bacteria 4093
206 Ga0105248_10085823 3300009177 Bacteria 3542
207 Ga0105248_10687413 3300009177 Bacteria 1154
208 Ga0105032_102250 3300009979 Bacteria 1733
209 Ga0157373_10014215 3300013100 Bacteria 5838
210 Ga0157373_10034144 3300013100 Bacteria 3654
211 Ga0157373_10062477 3300013100 Bacteria 2638
212 Ga0157373_10097653 3300013100 Bacteria 2068
213 Ga0157373_10115569 3300013100 Bacteria 1886
214 Ga0157371_10000672 3300013102 Bacteria 40585
215 Ga0157371_10002007 3300013102 Bacteria 20125
216 Ga0157371_10014100 3300013102 Bacteria 6045
217 Ga0157371_10035809 3300013102 Bacteria 3556
218 Ga0157371_10048881 3300013102 Bacteria 3006
219 Ga0157371_10172413 3300013102 Bacteria 1546
220 Ga0157371_10234269 3300013102 Bacteria 1320
221 Ga0157370_10006105 3300013104 Bacteria 13369
222 Ga0157370_10075562 3300013104 Bacteria 3176
223 Ga0157370_10121765 3300013104 Bacteria 2436
224 Ga0157369_11302964 3300013105 Bacteria 740
225 Ga0157374_10009045 3300013296 Bacteria 8537
226 Ga0157374_10307682 3300013296 Bacteria 1569
227 Ga0163162_10010318 3300013306 Bacteria 9078
228 Ga0163162_10064370 3300013306 Bacteria 3712
229 Ga0163162_10191390 3300013306 Bacteria 2173
230 Ga0157372_10016123 3300013307 Bacteria 8017
231 Ga0157372_10417075 3300013307 Bacteria 1564
232 Ga0157372_10819941 3300013307 Bacteria 1081
233 Ga0157375_10040145 3300013308 Bacteria 4510
234 Ga0157375_10461669 3300013308 Bacteria 1435
235 Ga0163163_10000173 3300014325 Bacteria 67717
236 Ga0157380_10036892 3300014326 Bacteria 3785
237 Ga0157380_10294745 3300014326 Bacteria 1491
238 Ga0157379_10027263 3300014968 Bacteria 5086
239 Ga0157379_10102917 3300014968 Bacteria 2563
240 Ga0157379_10379977 3300014968 Bacteria 1296
241 Ga0157376_10462108 3300014969 Bacteria 1240
242 Ga0163161_10076026 3300017792 Bacteria 2465
243 Ga0206354_10674928 3300020081 Bacteria 6934
244 Ga0206353_10506404 3300020082 Bacteria 9344
245 Ga0209676_1000084 3300025292 Bacteria 274330
246 Ga0209676_1000259 3300025292 Bacteria 111746
247 Ga0209676_1000678 3300025292 Bacteria 48300
248 Ga0209025_1010159 3300025294 Bacteria 6422
249 Ga0209050_1000104 3300025298 Bacteria 228921
250 Ga0209050_1007666 3300025298 Bacteria 5977
251 Ga0209050_1019516 3300025298 Bacteria 2570
252 Ga0209257_1000120 3300025304 Bacteria 223025
253 Ga0209257_1000174 3300025304 Bacteria 165255
254 Ga0209257_1005689 3300025304 Bacteria 8578
255 Ga0207697_10000451 3300025315 Bacteria 23156
256 Ga0207656_10007328 3300025321 Bacteria 4011
257 Ga0207682_10042150 3300025893 Bacteria 1864
258 Ga0207682_10062117 3300025893 Bacteria 1565
259 Ga0207710_10003852 3300025900 Bacteria 6632
260 Ga0207688_10074169 3300025901 Bacteria 1935
261 Ga0207688_10083783 3300025901 Bacteria 1824
262 Ga0207680_10000161 3300025903 Bacteria 32807
263 Ga0207680_10006032 3300025903 Bacteria 5834
264 Ga0207680_10055809 3300025903 Bacteria 2382
265 Ga0207680_10447164 3300025903 Bacteria 917
266 Ga0207647_10036516 3300025904 Bacteria 3122
267 Ga0207647_10049924 3300025904 Bacteria 2593
268 Ga0207647_10070577 3300025904 Bacteria 2110
269 Ga0207647_10091412 3300025904 Bacteria 1815
270 Ga0207645_10011848 3300025907 Bacteria 5936
271 Ga0207705_10000114 3300025909 Bacteria 90132
272 Ga0207705_10000169 3300025909 Bacteria 69941
273 Ga0207705_10003282 3300025909 Bacteria 12322
274 Ga0207705_10003511 3300025909 Bacteria 11939
275 Ga0207705_10007396 3300025909 Bacteria 8078
276 Ga0207705_10012849 3300025909 Bacteria 6045
277 Ga0207705_10038735 3300025909 Bacteria 3414
278 Ga0207705_10043520 3300025909 Bacteria 3226
279 Ga0207705_10049349 3300025909 Bacteria 3029
280 Ga0207705_10061940 3300025909 Bacteria 2702
281 Ga0207705_10114906 3300025909 Bacteria 1992
282 Ga0207654_10093294 3300025911 Bacteria 1840
283 Ga0207654_10402296 3300025911 Bacteria 952
284 Ga0207707_10020600 3300025912 Bacteria 5760
285 Ga0207707_10048025 3300025912 Bacteria 3718
286 Ga0207707_10286356 3300025912 Bacteria 1426
287 Ga0207660_10000781 3300025917 Bacteria 21158
288 Ga0207660_10008547 3300025917 Bacteria 6625
289 Ga0207660_10177722 3300025917 Bacteria 1651
290 Ga0207657_10000071 3300025919 Bacteria 93725
291 Ga0207657_10000143 3300025919 Bacteria 72146
292 Ga0207657_10000339 3300025919 Bacteria 49518
293 Ga0207657_10001497 3300025919 Bacteria 24993
294 Ga0207657_10013044 3300025919 Bacteria 8167
295 Ga0207657_10013464 3300025919 Bacteria 8022
296 Ga0207657_10014544 3300025919 Bacteria 7673
297 Ga0207657_10022921 3300025919 Bacteria 5827
298 Ga0207657_10051586 3300025919 Bacteria 3576
299 Ga0207657_10075695 3300025919 Bacteria 2840
300 Ga0207657_10184906 3300025919 Bacteria 1683
301 Ga0207649_10000301 3300025920 Bacteria 37967
302 Ga0207649_10002551 3300025920 Bacteria 10140
303 Ga0207649_10003864 3300025920 Bacteria 8172
304 Ga0207649_10006077 3300025920 Bacteria 6553
305 Ga0207649_10025249 3300025920 Bacteria 3463
306 Ga0207649_10193481 3300025920 Bacteria 1432
307 Ga0207649_10214724 3300025920 Bacteria 1367
308 Ga0207649_10275508 3300025920 Bacteria 1221
309 Ga0207649_10286639 3300025920 Bacteria 1199
310 Ga0207652_10000001 3300025921 Bacteria 1006643
311 Ga0207652_10000002 3300025921 Bacteria 878035
312 Ga0207652_10002862 3300025921 Bacteria 14449
313 Ga0207652_10141837 3300025921 Bacteria 2149
314 Ga0207652_10423876 3300025921 Bacteria 1200
315 Ga0207681_10000010 3300025923 Bacteria 403379
316 Ga0207681_10030658 3300025923 Bacteria 3507
317 Ga0207681_10368761 3300025923 Bacteria 1153
318 Ga0207650_10006332 3300025925 Bacteria 8065
319 Ga0207650_10014197 3300025925 Bacteria 5533
320 Ga0207650_10046670 3300025925 Bacteria 3190
321 Ga0207650_10113594 3300025925 Bacteria 2100
322 Ga0207650_10265622 3300025925 Bacteria 1393
323 Ga0207650_10298081 3300025925 Bacteria 1316
324 Ga0207650_10347600 3300025925 Bacteria 1219
325 Ga0207659_10002790 3300025926 Bacteria 10406
326 Ga0207659_10003942 3300025926 Bacteria 8959
327 Ga0207644_10000007 3300025931 Bacteria 381778
328 Ga0207644_10004781 3300025931 Bacteria 8811
329 Ga0207644_10020504 3300025931 Bacteria 4494
330 Ga0207644_10061996 3300025931 Bacteria 2710
331 Ga0207644_10136879 3300025931 Bacteria 1882
332 Ga0207644_10144151 3300025931 Bacteria 1837
333 Ga0207690_10000001 3300025932 Bacteria 807539
334 Ga0207690_10000002 3300025932 Bacteria 807473
335 Ga0207690_10000003 3300025932 Bacteria 783011
336 Ga0207690_10000004 3300025932 Bacteria 746138
337 Ga0207690_10000045 3300025932 Bacteria 116965
338 Ga0207690_10001260 3300025932 Bacteria 16012
339 Ga0207690_10048003 3300025932 Bacteria 2836
340 Ga0207690_10051667 3300025932 Bacteria 2750
341 Ga0207690_10076511 3300025932 Bacteria 2324
342 Ga0207690_10220590 3300025932 Bacteria 1451
343 Ga0207690_10285454 3300025932 Unclassified 1287
344 Ga0207706_10000086 3300025933 Bacteria 95284
345 Ga0207706_10000655 3300025933 Bacteria 36583
346 Ga0207706_10001639 3300025933 Bacteria 22161
347 Ga0207706_10024453 3300025933 Bacteria 5415
348 Ga0207706_10072223 3300025933 Bacteria 3035
349 Ga0207706_10076256 3300025933 Bacteria 2949
350 Ga0207706_10443529 3300025933 Bacteria 1123
351 Ga0207706_10533938 3300025933 Archaea 1011
352 Ga0207669_10011088 3300025937 Bacteria 4372
353 Ga0207691_10018829 3300025940 Bacteria 6539
354 Ga0207691_10043465 3300025940 Bacteria 4141
355 Ga0207691_10266424 3300025940 Bacteria 1476
356 Ga0207711_10003283 3300025941 Bacteria 14060
357 Ga0207711_10035421 3300025941 Bacteria 4230
358 Ga0207711_10062006 3300025941 Bacteria 3225
359 Ga0207711_10102504 3300025941 Bacteria 2533
360 Ga0207711_10473918 3300025941 Bacteria 1166
361 Ga0207661_10001017 3300025944 Bacteria 18588
362 Ga0207661_10052798 3300025944 Bacteria 3249
363 Ga0207679_10000315 3300025945 Bacteria 36328
364 Ga0207679_10022222 3300025945 Bacteria 4316
365 Ga0207679_10229674 3300025945 Bacteria 1566
366 Ga0207679_10267409 3300025945 Bacteria 1461
367 Ga0207667_10001152 3300025949 Bacteria 33245
368 Ga0207667_10007254 3300025949 Bacteria 13374
369 Ga0207667_10063862 3300025949 Bacteria 3846
370 Ga0207667_10209199 3300025949 Bacteria 2000
371 Ga0207667_10457860 3300025949 Bacteria 1296
372 Ga0207667_10548717 3300025949 Bacteria 1169
373 Ga0207667_10562165 3300025949 Unclassified 1153
374 Ga0207667_10688336 3300025949 Bacteria 1026
375 Ga0207651_10003619 3300025960 Bacteria 7616
376 Ga0207651_10027613 3300025960 Bacteria 3568
377 Ga0207651_10127095 3300025960 Bacteria 1944
378 Ga0207651_10148610 3300025960 Bacteria 1821
379 Ga0207651_10229555 3300025960 Bacteria 1506
380 Ga0207651_10283163 3300025960 Bacteria 1371
381 Ga0207712_10010049 3300025961 Bacteria 5998
382 Ga0207668_10000833 3300025972 Bacteria 18632
383 Ga0207668_10034653 3300025972 Bacteria 3354
384 Ga0207668_10265396 3300025972 Bacteria 1401
385 Ga0207640_10002078 3300025981 Bacteria 10783
386 Ga0207640_10046418 3300025981 Bacteria 2795
387 Ga0207640_10082219 3300025981 Bacteria 2205
388 Ga0207640_10100046 3300025981 Bacteria 2030
389 Ga0207640_10300370 3300025981 Bacteria 1270
390 Ga0207658_10020002 3300025986 Bacteria 4633
391 Ga0207658_10021745 3300025986 Bacteria 4457
392 Ga0207658_10043215 3300025986 Bacteria 3274
393 Ga0207658_10075063 3300025986 Bacteria 2571
394 Ga0207658_10868635 3300025986 Bacteria 820
395 Ga0207677_10339731 3300026023 Bacteria 1254
396 Ga0207703_10003236 3300026035 Bacteria 13693
397 Ga0207703_10081551 3300026035 Bacteria 2697
398 Ga0207639_10000330 3300026041 Bacteria 32864
399 Ga0207639_10005870 3300026041 Bacteria 8319
400 Ga0207639_10026732 3300026041 Bacteria 4195
401 Ga0207639_10150647 3300026041 Bacteria 1948
402 Ga0207639_10438045 3300026041 Bacteria 1184
403 Ga0207639_10614507 3300026041 Bacteria 1003
404 Ga0207678_10000311 3300026067 Bacteria 43860
405 Ga0207678_10000860 3300026067 Bacteria 27872
406 Ga0207678_10001094 3300026067 Bacteria 24866
407 Ga0207678_10002439 3300026067 Bacteria 16899
408 Ga0207678_10004994 3300026067 Bacteria 11892
409 Ga0207708_10128903 3300026075 Bacteria 1976
410 Ga0207702_10000254 3300026078 Bacteria 61680
411 Ga0207702_10375271 3300026078 Bacteria 1366
412 Ga0207641_10013557 3300026088 Bacteria 6685
413 Ga0207641_10054968 3300026088 Bacteria 3380
414 Ga0207648_10128530 3300026089 Bacteria 2229
415 Ga0207648_10185202 3300026089 Bacteria 1844
416 Ga0207676_10014324 3300026095 Bacteria 5704
417 Ga0207676_10015134 3300026095 Bacteria 5563
418 Ga0207676_10132224 3300026095 Bacteria 2123
419 Ga0207674_10003121 3300026116 Bacteria 20439
420 Ga0207674_10006008 3300026116 Bacteria 14358
421 Ga0207674_10037187 3300026116 Bacteria 5065
422 Ga0207675_100000263 3300026118 Bacteria 50093
423 Ga0207683_10311648 3300026121 Bacteria 1441
424 Ga0207698_10000709 3300026142 Bacteria 19311
425 Ga0207698_10018296 3300026142 Bacteria 4771
426 Ga0207698_10047293 3300026142 Bacteria 3258
427 Ga0207698_10278117 3300026142 Bacteria 1547
428 Ga0207698_10280607 3300026142 Bacteria 1541
429 Ga0207698_10489882 3300026142 Bacteria 1194
430 Ga0209967_1009632 3300027364 Bacteria 1341
431 Ga0209974_10026721 3300027876 Bacteria 1910
432 Ga0268266_10004883 3300028379 Bacteria 12720
433 Ga0268266_10009531 3300028379 Bacteria 8546
434 Ga0268265_10000058 3300028380 Bacteria 154702
435 Ga0268265_10385394 3300028380 Bacteria 1291
436 Ga0268264_10000551 3300028381 Bacteria 47040
437 Ga0268264_10091432 3300028381 Bacteria 2625
438 Ga0268264_10588568 3300028381 Bacteria 1095
439 Ga0307408_100047464 3300031548 Bacteria 3076
440 Ga0307408_100073112 3300031548 Bacteria 2540
441 Ga0307408_100078544 3300031548 Bacteria 2460
442 Ga0307408_100122696 3300031548 Bacteria 2015
443 Ga0307408_100200343 3300031548 Bacteria 1615
444 Ga0307408_100827649 3300031548 Bacteria 842
445 Ga0307405_10142746 3300031731 Bacteria 1672
446 Ga0307405_10151949 3300031731 Bacteria 1629
447 Ga0307413_10074132 3300031824 Bacteria 2154
448 Ga0307413_10163160 3300031824 Bacteria 1568
449 Ga0307413_10249731 3300031824 Bacteria 1315
450 Ga0307413_10275322 3300031824 Bacteria 1262
451 Ga0307410_10000261 3300031852 Bacteria 20155
452 Ga0307410_10090751 3300031852 Bacteria 2168
453 Ga0307410_10178997 3300031852 Bacteria 1604
454 Ga0307406_10040283 3300031901 Bacteria 2904
455 Ga0307406_10044209 3300031901 Bacteria 2791
456 Ga0307406_10058770 3300031901 Bacteria 2472
457 Ga0307406_10060187 3300031901 Bacteria 2448
458 Ga0307406_10099297 3300031901 Bacteria 1979
459 Ga0307406_10203358 3300031901 Bacteria 1460
460 Ga0307406_10291410 3300031901 Bacteria 1250
461 Ga0307407_10045989 3300031903 Bacteria 2469
462 Ga0307407_10061262 3300031903 Bacteria 2199
463 Ga0307407_10109132 3300031903 Bacteria 1734
464 Ga0307407_10134860 3300031903 Bacteria 1585
465 Ga0307412_10051332 3300031911 Bacteria 2725
466 Ga0307412_10151272 3300031911 Unclassified 1713
467 Ga0307412_10274042 3300031911 Bacteria 1322
468 Ga0307412_10279922 3300031911 Bacteria 1309
469 Ga0307409_100006234 3300031995 Bacteria 6983
470 Ga0307409_100019633 3300031995 Bacteria 4583
471 Ga0307409_100098361 3300031995 Bacteria 2420
472 Ga0307409_100099925 3300031995 Bacteria 2404
473 Ga0307409_100314768 3300031995 Bacteria 1462
474 Ga0307409_100387531 3300031995 Bacteria 1331
475 Ga0307409_100403773 3300031995 Bacteria 1306
476 Ga0307409_100441808 3300031995 Bacteria 1253
477 Ga0307416_100024506 3300032002 Bacteria 4406
478 Ga0307416_100043416 3300032002 Bacteria 3520
479 Ga0307416_100049063 3300032002 Bacteria 3354
480 Ga0307416_100078026 3300032002 Bacteria 2784
481 Ga0307416_100079708 3300032002 Bacteria 2761
482 Ga0307416_100093504 3300032002 Bacteria 2590
483 Ga0307416_100816971 3300032002 Bacteria 1029
484 Ga0307416_100890323 3300032002 Bacteria 990
485 Ga0307416_100907445 3300032002 Bacteria 981
486 Ga0307414_10003389 3300032004 Bacteria 8514
487 Ga0307414_10005872 3300032004 Bacteria 6791
488 Ga0307414_10013889 3300032004 Bacteria 4809
489 Ga0307414_10024201 3300032004 Bacteria 3867
490 Ga0307414_10026432 3300032004 Bacteria 3736
491 Ga0307414_10172174 3300032004 Bacteria 1732
492 Ga0307414_10253186 3300032004 Bacteria 1465
493 Ga0307411_10000435 3300032005 Bacteria 14250
494 Ga0307411_10121216 3300032005 Bacteria 1892
495 Ga0307411_10139206 3300032005 Bacteria 1787
496 Ga0307411_10379034 3300032005 Bacteria 1163
497 Ga0307415_100017743 3300032126 Bacteria 4275
498 Ga0307415_100051096 3300032126 Bacteria 2804
499 Ga0307415_100065900 3300032126 Bacteria 2525
500 Ga0307415_100070061 3300032126 Bacteria 2461
501 Ga0307415_100235118 3300032126 Bacteria 1478
502 Ga0307415_100393024 3300032126 Bacteria 1181
503 Ga0307415_100416483 3300032126 Bacteria 1151
504 Ga0307415_100585481 3300032126 Bacteria 990
505 Ga0373931_0000615 3300035691 Bacteria 14756
506 Ga0395899_0000627 3300037312 Bacteria 36773
507 Ga0395899_0277352 3300037312 Bacteria 1141
508 Ga0395900_0000031 3300037418 Bacteria 262393
509 Ga0395900_0065765 3300037418 Bacteria 3725
510 Ga0395900_0094359 3300037418 Bacteria 3073
511 Ga0395900_0252134 3300037418 Bacteria 1766
512 Ga0395900_0631238 3300037418 Bacteria 1009
513 Ga0395898_0007893 3300037466 Bacteria 11293
514 Ga0395898_0094103 3300037466 Bacteria 2880
515 Ga0395898_0606956 3300037466 Bacteria 1037
516 Ga0395898_0803226 3300037466 Bacteria 881
517 Ga0395905_0017857 3300037471 Bacteria 6740
518 Ga0395905_0075140 3300037471 Bacteria 3167
519 Ga0395905_0133096 3300037471 Bacteria 2338
520 Ga0395905_0315035 3300037471 Bacteria 1453
521 Ga0395905_0588252 3300037471 Bacteria 1015
522 Ga0395905_0719699 3300037471 Bacteria 900
523 Ga0395901_0000035 3300038443 Bacteria 223888
524 Ga0395901_0075249 3300038443 Bacteria 3522
525 Ga0395901_0157213 3300038443 Bacteria 2387
526 Ga0395901_0373059 3300038443 Bacteria 1469
527 Ga0436363_0927763 3300039450 Bacteria 1052
528 Ga0439432_015801 3300042006 Bacteria 2545
529 Ga0466963_0014150 3300044694 Bacteria 4915
530 Ga0466963_0040285 3300044694 Bacteria 3062
531 Ga0466963_0072538 3300044694 Bacteria 2319
532 Ga0466963_0089475 3300044694 Bacteria 2094
533 Ga0466963_0234558 3300044694 Bacteria 1286
534 Ga0466963_0268955 3300044694 Bacteria 1197
535 Ga0466963_0277621 3300044694 Bacteria 1177
536 Ga0466971_0126550 3300044719 Bacteria 1184
537 Ga0466957_0004719 3300044842 Bacteria 7631
538 Ga0466957_0226773 3300044842 Bacteria 1235
539 Ga0466959_0055897 3300045049 Bacteria 2880
540 Ga0466959_0368910 3300045049 Bacteria 978
541 Ga0466958_0008138 3300045836 Bacteria 5804
542 Ga0466958_0084393 3300045836 Bacteria 1959
543 Ga0466958_0165580 3300045836 Bacteria 1398
544 Ga0466967_0006738 3300045976 Bacteria 8174
545 Ga0466967_0029374 3300045976 Bacteria 4600
546 Ga0466967_0033123 3300045976 Bacteria 4372
547 Ga0466967_0118704 3300045976 Bacteria 2440
548 Ga0466967_0189016 3300045976 Bacteria 1945
549 Ga0495638_0000012 3300046460 Bacteria 435577
550 Ga0495638_0116240 3300046460 Bacteria 1584
551 Ga0495639_0022368 3300046475 Bacteria 2773
552 Ga0495583_0000411 3300046506 Bacteria 65040
553 Ga0495632_0000832 3300046519 Bacteria 27194
554 Ga0495644_0055732 3300046523 Bacteria 1485
555 Ga0495648_0000038 3300046524 Bacteria 191612
556 Ga0495648_0000184 3300046524 Bacteria 72048
557 Ga0495663_0001490 3300046525 Bacteria 7363
558 Ga0495663_0138365 3300046525 Bacteria 825
559 Ga0495598_0000380 3300046537 Bacteria 7966
560 Ga0495598_0016388 3300046537 Bacteria 1890
561 Ga0495621_0005448 3300046539 Bacteria 3659
562 Ga0495633_0004956 3300046558 Bacteria 8311
563 Ga0495633_0169494 3300046558 Bacteria 1006
564 Ga0495668_0000001 3300046616 Bacteria 1013420
565 Ga0495668_0026836 3300046616 Bacteria 3266
566 Ga0495668_0225755 3300046616 Bacteria 1025
567 Ga0495625_0001920 3300046660 Bacteria 23504
568 Ga0495669_0001484 3300046684 Bacteria 9678
569 Ga0495669_0001528 3300046684 Bacteria 9519
570 Ga0495669_0001747 3300046684 Bacteria 8899
571 Ga0495669_0003474 3300046684 Bacteria 6494
572 Ga0495670_0006811 3300046691 Bacteria 5624
573 Ga0495671_0000034 3300046692 Bacteria 195385
574 Ga0495677_0003525 3300047445 Bacteria 6071
575 Ga0495677_0064025 3300047445 Bacteria 1366
576 Ga0495673_0000013 3300047469 Bacteria 612902
577 Ga0495673_0000209 3300047469 Bacteria 88818
578 Ga0495686_0002251 3300047472 Bacteria 18609
579 Ga0495686_0011425 3300047472 Bacteria 6256
580 Ga0496106_0234506 3300048909 Bacteria 1466
581 Ga0496106_0564936 3300048909 Bacteria 912
582 Ga0496107_0012723 3300048910 Bacteria 5879
583 Ga0496108_0005745 3300048911 Bacteria 10047
584 Ga0496108_0019346 3300048911 Bacteria 5591
585 Ga0496108_0062013 3300048911 Bacteria 3148
586 Ga0496108_0190811 3300048911 Bacteria 1776
587 Ga0496109_0029185 3300048912 Bacteria 4939
588 Ga0496109_0532693 3300048912 Bacteria 1108
589 Ga0496110_0002728 3300048913 Bacteria 13339
590 Ga0496110_0153254 3300048913 Bacteria 2087
591 Ga0496110_0192550 3300048913 Bacteria 1852
592 Ga0496110_0212205 3300048913 Bacteria 1760
593 Ga0496111_0019022 3300048914 Bacteria 4763
594 Ga0496111_0200044 3300048914 Bacteria 1485
595 Ga0496112_0006500 3300048915 Bacteria 10275
596 Ga0496113_0244549 3300048916 Unclassified 1432
597 Ga0496113_0260113 3300048916 Bacteria 1386
598 Ga0496114_0596378 3300048917 Bacteria 974
599 Ga0501032_0025564 3300049569 Bacteria 4069
600 Ga0501033_0124595 3300049570 Bacteria 1868
601 Ga0501034_0108480 3300049571 Bacteria 2767
602 Ga0501034_0140758 3300049571 Bacteria 2392
603 Ga0501036_0009156 3300049572 Bacteria 8141
604 Ga0501037_0137245 3300049573 Bacteria 1751
605 Ga0501038_0017779 3300049574 Bacteria 6425
606 Ga0501039_0043147 3300049575 Bacteria 3484
607 Ga0501042_0318644 3300049578 Bacteria 1123
608 Ga0501043_0099213 3300049579 Bacteria 2289
609 Ga0501047_0015016 3300049581 Bacteria 7370
610 Ga0501080_0307448 3300049742 Bacteria 1437
611 Ga0501044_0209960 3300049823 Bacteria 1901
612 Ga0501044_0389567 3300049823 Bacteria 1307
613 nmdc:mga03683_20042_c1 3300050489 Bacteria 1041
614 Ga0500643_040626 3300053087 Bacteria 1369
615 Ga0500644_0000116 3300053088 Bacteria 49989
616 Ga0500646_0014915 3300053090 Bacteria 2020
617 Ga0500647_0094470 3300053091 Bacteria 1431
618 Ga0500608_000516 3300053122 Bacteria 14465
619 Ga0500608_048483 3300053122 Bacteria 2041
620 Ga0500618_014785 3300053125 Bacteria 1986
621 Ga0500658_0209570 3300053134 Bacteria 892
622 Ga0500564_000005 3300053138 Bacteria 99735
623 Ga0500568_0016977 3300053139 Bacteria 3222
624 Ga0500616_0002764 3300053153 Bacteria 14172
625 Ga0500627_0000149 3300053158 Bacteria 20586
626 Ga0500636_0018800 3300053177 Bacteria 4086
627 Ga0500567_001181 3300053723 Bacteria 10288
628 Ga0500625_000039 3300053729 Bacteria 43868
629 Ga0500587_004581 3300053739 Bacteria 1893
630 Ga0587062_005260 3300059639 Bacteria 1420
631 Ga0587072_012509 3300059643 Bacteria 1404
632 Ga0466962_0046581 3300061719 Bacteria 2072
633 Ga0466962_0080265 3300061719 Bacteria 1560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0719699 Ga0395905_0719699_302_871 187
2 3300005544 Ga0070686_100782141 Ga0070686_1007821411 188
3 3300046525 Ga0495663_0138365 Ga0495663_0138365_188_763 188
4 3300048917 Ga0496114_0596378 Ga0496114_0596378_60_635 188
5 3300005339 Ga0070660_100007404 Ga0070660_1000074047 195
6 3300005366 Ga0070659_100000001 Ga0070659_100000001542 195
7 3300025919 Ga0207657_10014544 Ga0207657_100145447 195
8 3300025932 Ga0207690_10000001 Ga0207690_10000001156 195
9 3300025932 Ga0207690_10000002 Ga0207690_10000002156 195
10 3300025932 Ga0207690_10000003 Ga0207690_10000003156 195
11 3300025932 Ga0207690_10000004 Ga0207690_10000004156 195
12 3300026075 Ga0207708_10128903 Ga0207708_101289031 197
13 3300025933 Ga0207706_10533938 Ga0207706_105339382 201
14 3300025960 Ga0207651_10148610 Ga0207651_101486103 201
15 3300053739 Ga0500587_004581 Ga0500587_004581_598_1329 201
16 3300005331 Ga0070670_100259621 Ga0070670_1002596212 202
17 3300005578 Ga0068854_100002258 Ga0068854_10000225815 202
18 3300013104 Ga0157370_10121765 Ga0157370_101217652 202
19 3300025925 Ga0207650_10265622 Ga0207650_102656221 202
20 3300025981 Ga0207640_10002078 Ga0207640_100020785 202
21 3300025981 Ga0207640_10300370 Ga0207640_103003702 202
22 3300031548 Ga0307408_100122696 Ga0307408_1001226962 202
23 3300031901 Ga0307406_10060187 Ga0307406_100601872 202
24 3300032004 Ga0307414_10005872 Ga0307414_100058729 202
25 3300031995 Ga0307409_100387531 Ga0307409_1003875312 203
26 3300005843 Ga0068860_100114241 Ga0068860_1001142413 205
27 3300028381 Ga0268264_10091432 Ga0268264_100914322 205
28 3300032005 Ga0307411_10379034 Ga0307411_103790342 205
29 3300053090 Ga0500646_0014915 Ga0500646_0014915_1354_1995 205
30 3300005336 Ga0070680_100001856 Ga0070680_1000018563 207
31 3300039450 Ga0436363_0927763 Ga0436363_0927763_17_649 207
32 3300045049 Ga0466959_0368910 Ga0466959_0368910_319_948 207
33 3300048916 Ga0496113_0244549 Ga0496113_0244549_764_1393 207
34 3300053134 Ga0500658_0209570 Ga0500658_0209570_221_856 207
35 3300032004 Ga0307414_10253186 Ga0307414_102531862 208
36 3300049571 Ga0501034_0140758 Ga0501034_0140758_1218_1976 208
37 3300049742 Ga0501080_0307448 Ga0501080_0307448_570_1328 208
38 3300002459 JGI24751J29686_10018154 JGI24751J29686_100181542 209
39 3300005445 Ga0070708_100046595 Ga0070708_1000465954 209
40 3300032004 Ga0307414_10013889 Ga0307414_100138893 209
41 3300046684 Ga0495669_0003474 Ga0495669_0003474_4711_5409 209
42 3300053158 Ga0500627_0000149 Ga0500627_0000149_7397_8107 209
43 3300049569 Ga0501032_0025564 Ga0501032_0025564_1268_1951 210
44 3300049570 Ga0501033_0124595 Ga0501033_0124595_324_1007 210
45 3300049571 Ga0501034_0108480 Ga0501034_0108480_1828_2511 210
46 3300049572 Ga0501036_0009156 Ga0501036_0009156_5586_6269 210
47 3300049573 Ga0501037_0137245 Ga0501037_0137245_534_1217 210
48 3300049574 Ga0501038_0017779 Ga0501038_0017779_1417_2100 210
49 3300049575 Ga0501039_0043147 Ga0501039_0043147_1650_2333 210
50 3300049578 Ga0501042_0318644 Ga0501042_0318644_222_905 210
51 3300049579 Ga0501043_0099213 Ga0501043_0099213_1210_1893 210
52 3300049581 Ga0501047_0015016 Ga0501047_0015016_6364_7047 210
53 3300049823 Ga0501044_0209960 Ga0501044_0209960_1074_1757 210
54 3300005539 Ga0068853_100008412 Ga0068853_1000084123 211
55 3300005563 Ga0068855_100546441 Ga0068855_1005464412 211
56 3300025949 Ga0207667_10457860 Ga0207667_104578602 211
57 3300026041 Ga0207639_10150647 Ga0207639_101506472 211
58 3300026116 Ga0207674_10006008 Ga0207674_1000600810 211
59 3300031548 Ga0307408_100078544 Ga0307408_1000785443 211
60 3300031548 Ga0307408_100200343 Ga0307408_1002003431 211
61 3300031731 Ga0307405_10142746 Ga0307405_101427463 211
62 3300031824 Ga0307413_10249731 Ga0307413_102497312 211
63 3300031911 Ga0307412_10051332 Ga0307412_100513323 211
64 3300031995 Ga0307409_100098361 Ga0307409_1000983613 211
65 3300031995 Ga0307409_100441808 Ga0307409_1004418082 211
66 3300032002 Ga0307416_100079708 Ga0307416_1000797083 211
67 3300032002 Ga0307416_100093504 Ga0307416_1000935043 211
68 3300032004 Ga0307414_10172174 Ga0307414_101721741 211
69 3300032126 Ga0307415_100051096 Ga0307415_1000510962 211
70 3300049823 Ga0501044_0389567 Ga0501044_0389567_324_1007 211
71 3300005548 Ga0070665_100018140 Ga0070665_1000181404 212
72 3300031911 Ga0307412_10151272 Ga0307412_101512722 212
73 3300005335 Ga0070666_10335537 Ga0070666_103355372 213
74 3300025903 Ga0207680_10447164 Ga0207680_104471642 213
75 3300031852 Ga0307410_10000261 Ga0307410_1000026114 213
76 3300031995 Ga0307409_100006234 Ga0307409_1000062346 213
77 3300032005 Ga0307411_10000435 Ga0307411_100004356 213
78 3300042006 Ga0439432_015801 Ga0439432_015801_1354_2052 213
79 3300031824 Ga0307413_10163160 Ga0307413_101631602 214
80 3300046537 Ga0495598_0016388 Ga0495598_0016388_182_889 214
81 3300009177 Ga0105248_10687413 Ga0105248_106874132 215
82 3300013102 Ga0157371_10014100 Ga0157371_100141005 215
83 3300025941 Ga0207711_10473918 Ga0207711_104739182 215
84 3300046616 Ga0495668_0225755 Ga0495668_0225755_345_1001 215
85 3300005333 Ga0070677_10014371 Ga0070677_100143713 216
86 3300005336 Ga0070680_100033649 Ga0070680_1000336492 216
87 3300005366 Ga0070659_100215587 Ga0070659_1002155872 216
88 3300005457 Ga0070662_100010614 Ga0070662_1000106144 216
89 3300005530 Ga0070679_100229411 Ga0070679_1002294113 216
90 3300013100 Ga0157373_10014215 Ga0157373_100142156 216
91 3300025893 Ga0207682_10062117 Ga0207682_100621172 216
92 3300025921 Ga0207652_10141837 Ga0207652_101418373 216
93 3300025932 Ga0207690_10220590 Ga0207690_102205902 216
94 3300025933 Ga0207706_10001639 Ga0207706_100016394 216
95 3300037312 Ga0395899_0277352 Ga0395899_0277352_143_847 217
96 3300038443 Ga0395901_0075249 Ga0395901_0075249_143_847 217
97 3300031901 Ga0307406_10058770 Ga0307406_100587705 218
98 3300032002 Ga0307416_100078026 Ga0307416_1000780263 218
99 3300032126 Ga0307415_100070061 Ga0307415_1000700613 218
100 3300037471 Ga0395905_0588252 Ga0395905_0588252_283_948 218
101 3300031548 Ga0307408_100827649 Ga0307408_1008276491 219
102 3300044694 Ga0466963_0268955 Ga0466963_0268955_498_1163 219
103 3300005339 Ga0070660_100294495 Ga0070660_1002944952 220
104 3300005547 Ga0070693_100066300 Ga0070693_1000663002 220
105 3300013100 Ga0157373_10115569 Ga0157373_101155693 220
106 3300025909 Ga0207705_10038735 Ga0207705_100387352 220
107 3300025919 Ga0207657_10075695 Ga0207657_100756954 220
108 3300025920 Ga0207649_10025249 Ga0207649_100252493 220
109 3300026041 Ga0207639_10438045 Ga0207639_104380452 220
110 3300031824 Ga0307413_10074132 Ga0307413_100741323 220
111 3300031901 Ga0307406_10291410 Ga0307406_102914102 220
112 3300048913 Ga0496110_0192550 Ga0496110_0192550_587_1273 220
113 iso_pu_bacteria 2739367664 2739649483 220
114 iso_pu_bacteria 2739367865 2740027956 220
115 3300003781 Ga0055536_1007529 Ga0055536_10075294 221
116 3300003791 Ga0055530_10000174 Ga0055530_1000017421 221
117 3300003791 Ga0055530_10000411 Ga0055530_1000041129 221
118 3300003794 Ga0055531_10001746 Ga0055531_1000174610 221
119 3300005331 Ga0070670_100352222 Ga0070670_1003522221 221
120 3300005355 Ga0070671_100331139 Ga0070671_1003311392 221
121 3300005543 Ga0070672_100035416 Ga0070672_1000354164 221
122 3300005564 Ga0070664_100259314 Ga0070664_1002593142 221
123 3300025292 Ga0209676_1000259 Ga0209676_100025984 221
124 3300025294 Ga0209025_1010159 Ga0209025_10101597 221
125 3300025298 Ga0209050_1000104 Ga0209050_1000104110 221
126 3300025304 Ga0209257_1000120 Ga0209257_100012090 221
127 3300025925 Ga0207650_10113594 Ga0207650_101135943 221
128 3300025931 Ga0207644_10061996 Ga0207644_100619962 221
129 3300025940 Ga0207691_10043465 Ga0207691_100434654 221
130 3300025945 Ga0207679_10229674 Ga0207679_102296742 221
131 3300026121 Ga0207683_10311648 Ga0207683_103116482 221
132 3300013307 Ga0157372_10417075 Ga0157372_104170752 222
133 3300014326 Ga0157380_10294745 Ga0157380_102947452 222
134 3300032002 Ga0307416_100890323 Ga0307416_1008903232 222
135 3300046460 Ga0495638_0116240 Ga0495638_0116240_560_1264 222
136 3300048911 Ga0496108_0019346 Ga0496108_0019346_354_1034 222
137 iso_pu_bacteria 2582581279 2585147418 222
138 3300005290 Ga0065712_10069709 Ga0065712_100697092 223
139 3300005293 Ga0065715_10140770 Ga0065715_101407702 223
140 3300005327 Ga0070658_10072962 Ga0070658_100729622 223
141 3300005331 Ga0070670_100003822 Ga0070670_1000038224 223
142 3300005335 Ga0070666_10065096 Ga0070666_100650963 223
143 3300005344 Ga0070661_100003998 Ga0070661_10000399810 223
144 3300005354 Ga0070675_100002760 Ga0070675_1000027606 223
145 3300005356 Ga0070674_100006704 Ga0070674_1000067044 223
146 3300005366 Ga0070659_100039337 Ga0070659_1000393373 223
147 3300005457 Ga0070662_100052774 Ga0070662_1000527742 223
148 3300005543 Ga0070672_100011897 Ga0070672_1000118973 223
149 3300005564 Ga0070664_100015867 Ga0070664_1000158674 223
150 3300005618 Ga0068864_100149531 Ga0068864_1001495313 223
151 3300009177 Ga0105248_10050891 Ga0105248_100508913 223
152 3300013306 Ga0163162_10191390 Ga0163162_101913902 223
153 3300013308 Ga0157375_10040145 Ga0157375_100401454 223
154 3300017792 Ga0163161_10076026 Ga0163161_100760262 223
155 3300025903 Ga0207680_10055809 Ga0207680_100558092 223
156 3300025920 Ga0207649_10003864 Ga0207649_100038646 223
157 3300025925 Ga0207650_10006332 Ga0207650_100063324 223
158 3300025926 Ga0207659_10003942 Ga0207659_100039427 223
159 3300025933 Ga0207706_10076256 Ga0207706_100762562 223
160 3300025937 Ga0207669_10011088 Ga0207669_100110882 223
161 3300025940 Ga0207691_10018829 Ga0207691_100188296 223
162 3300025941 Ga0207711_10062006 Ga0207711_100620063 223
163 3300025960 Ga0207651_10003619 Ga0207651_100036195 223
164 3300025986 Ga0207658_10021745 Ga0207658_100217453 223
165 3300026095 Ga0207676_10132224 Ga0207676_101322243 223
166 3300032004 Ga0307414_10024201 Ga0307414_100242013 223
167 3300046475 Ga0495639_0022368 Ga0495639_0022368_1727_2437 223
168 3300046684 Ga0495669_0001747 Ga0495669_0001747_2508_3206 223
169 3300048911 Ga0496108_0190811 Ga0496108_0190811_895_1593 223
170 3300048912 Ga0496109_0029185 Ga0496109_0029185_2965_3663 223
171 3300048913 Ga0496110_0002728 Ga0496110_0002728_595_1296 223
172 3300048914 Ga0496111_0019022 Ga0496111_0019022_1546_2244 223
173 3300053122 Ga0500608_000516 Ga0500608_000516_7944_8654 223
174 3300053723 Ga0500567_001181 Ga0500567_001181_2218_2928 223
175 3300053729 Ga0500625_000039 Ga0500625_000039_21268_21978 223
176 3300059639 Ga0587062_005260 Ga0587062_005260_662_1369 223
177 3300059643 Ga0587072_012509 Ga0587072_012509_615_1322 223
178 iso_pu_bacteria 2643221560 2643822854 223
179 3300005290 Ga0065712_10026688 Ga0065712_100266882 224
180 3300005293 Ga0065715_10096862 Ga0065715_100968623 224
181 3300005331 Ga0070670_100002488 Ga0070670_1000024883 224
182 3300005333 Ga0070677_10000856 Ga0070677_100008567 224
183 3300005333 Ga0070677_10172307 Ga0070677_101723071 224
184 3300005347 Ga0070668_100043084 Ga0070668_1000430842 224
185 3300005353 Ga0070669_100526128 Ga0070669_1005261282 224
186 3300005354 Ga0070675_100001558 Ga0070675_1000015589 224
187 3300005364 Ga0070673_100280595 Ga0070673_1002805952 224
188 3300005457 Ga0070662_100410576 Ga0070662_1004105762 224
189 3300005543 Ga0070672_100357355 Ga0070672_1003573552 224
190 3300005563 Ga0068855_100487748 Ga0068855_1004877482 224
191 3300014326 Ga0157380_10036892 Ga0157380_100368922 224
192 3300025893 Ga0207682_10042150 Ga0207682_100421503 224
193 3300025901 Ga0207688_10074169 Ga0207688_100741693 224
194 3300025923 Ga0207681_10030658 Ga0207681_100306582 224
195 3300025925 Ga0207650_10014197 Ga0207650_100141973 224
196 3300025926 Ga0207659_10002790 Ga0207659_100027907 224
197 3300025931 Ga0207644_10136879 Ga0207644_101368792 224
198 3300025931 Ga0207644_10144151 Ga0207644_101441513 224
199 3300025933 Ga0207706_10443529 Ga0207706_104435292 224
200 3300025940 Ga0207691_10266424 Ga0207691_102664242 224
201 3300025949 Ga0207667_10688336 Ga0207667_106883362 224
202 3300025960 Ga0207651_10229555 Ga0207651_102295552 224
203 3300025972 Ga0207668_10034653 Ga0207668_100346533 224
204 3300026089 Ga0207648_10185202 Ga0207648_101852023 224
205 3300026116 Ga0207674_10037187 Ga0207674_100371872 224
206 3300027364 Ga0209967_1009632 Ga0209967_10096322 224
207 3300027876 Ga0209974_10026721 Ga0209974_100267213 224
208 3300031548 Ga0307408_100047464 Ga0307408_1000474642 224
209 3300031548 Ga0307408_100073112 Ga0307408_1000731123 224
210 3300031852 Ga0307410_10178997 Ga0307410_101789972 224
211 3300031901 Ga0307406_10040283 Ga0307406_100402833 224
212 3300031901 Ga0307406_10203358 Ga0307406_102033582 224
213 3300031903 Ga0307407_10061262 Ga0307407_100612622 224
214 3300031903 Ga0307407_10134860 Ga0307407_101348603 224
215 3300031911 Ga0307412_10279922 Ga0307412_102799222 224
216 3300031995 Ga0307409_100099925 Ga0307409_1000999253 224
217 3300031995 Ga0307409_100314768 Ga0307409_1003147682 224
218 3300032002 Ga0307416_100024506 Ga0307416_1000245064 224
219 3300032002 Ga0307416_100043416 Ga0307416_1000434163 224
220 3300032002 Ga0307416_100907445 Ga0307416_1009074452 224
221 3300032126 Ga0307415_100393024 Ga0307415_1003930241 224
222 3300044842 Ga0466957_0226773 Ga0466957_0226773_131_847 224
223 3300045976 Ga0466967_0033123 Ga0466967_0033123_1375_2091 224
224 3300053091 Ga0500647_0094470 Ga0500647_0094470_550_1260 224
225 iso_pu_bacteria 2643221563 2643832524 224
226 iso_pu_bacteria 2643221608 2644053681 224
227 iso_pu_bacteria 2852653556 2852654879 224
228 3300005327 Ga0070658_10059348 Ga0070658_100593482 225
229 3300005335 Ga0070666_10000385 Ga0070666_1000038522 225
230 3300005353 Ga0070669_100000110 Ga0070669_10000011070 225
231 3300005353 Ga0070669_100379190 Ga0070669_1003791901 225
232 3300005355 Ga0070671_100000004 Ga0070671_10000000421 225
233 3300005367 Ga0070667_100236690 Ga0070667_1002366902 225
234 3300005440 Ga0070705_100096057 Ga0070705_1000960572 225
235 3300005445 Ga0070708_100260947 Ga0070708_1002609472 225
236 3300005616 Ga0068852_100621536 Ga0068852_1006215361 225
237 3300005617 Ga0068859_100003489 Ga0068859_10000348916 225
238 3300005618 Ga0068864_100002725 Ga0068864_1000027252 225
239 3300005719 Ga0068861_100082375 Ga0068861_1000823752 225
240 3300005841 Ga0068863_100003546 Ga0068863_1000035465 225
241 3300005843 Ga0068860_100131997 Ga0068860_1001319972 225
242 3300005844 Ga0068862_100000137 Ga0068862_10000013717 225
243 3300006186 Ga0075369_10104765 Ga0075369_101047652 225
244 3300006931 Ga0097620_100003489 Ga0097620_10000348916 225
245 3300009011 Ga0105251_10034221 Ga0105251_100342213 225
246 3300014968 Ga0157379_10102917 Ga0157379_101029172 225
247 3300025315 Ga0207697_10000451 Ga0207697_1000045110 225
248 3300025900 Ga0207710_10003852 Ga0207710_100038524 225
249 3300025903 Ga0207680_10000161 Ga0207680_1000016110 225
250 3300025920 Ga0207649_10214724 Ga0207649_102147242 225
251 3300025923 Ga0207681_10000010 Ga0207681_1000001027 225
252 3300025923 Ga0207681_10368761 Ga0207681_103687612 225
253 3300025925 Ga0207650_10046670 Ga0207650_100466702 225
254 3300025931 Ga0207644_10000007 Ga0207644_1000000727 225
255 3300025949 Ga0207667_10562165 Ga0207667_105621652 225
256 3300025961 Ga0207712_10010049 Ga0207712_100100494 225
257 3300025972 Ga0207668_10000833 Ga0207668_1000083317 225
258 3300025986 Ga0207658_10043215 Ga0207658_100432151 225
259 3300026035 Ga0207703_10003236 Ga0207703_100032364 225
260 3300026088 Ga0207641_10013557 Ga0207641_100135574 225
261 3300026095 Ga0207676_10015134 Ga0207676_100151344 225
262 3300026118 Ga0207675_100000263 Ga0207675_10000026337 225
263 3300026142 Ga0207698_10280607 Ga0207698_102806072 225
264 3300028380 Ga0268265_10000058 Ga0268265_10000058159 225
265 3300028381 Ga0268264_10000551 Ga0268264_1000055114 225
266 3300037471 Ga0395905_0133096 Ga0395905_0133096_1193_1900 225
267 3300044694 Ga0466963_0014150 Ga0466963_0014150_275_970 225
268 3300046524 Ga0495648_0000184 Ga0495648_0000184_66348_67070 225
269 3300046558 Ga0495633_0169494 Ga0495633_0169494_23_742 225
270 3300046616 Ga0495668_0026836 Ga0495668_0026836_2268_2993 225
271 3300047469 Ga0495673_0000209 Ga0495673_0000209_5055_5777 225
272 3300047472 Ga0495686_0002251 Ga0495686_0002251_15647_16342 225
273 3300053087 Ga0500643_040626 Ga0500643_040626_619_1338 225
274 3300053088 Ga0500644_0000116 Ga0500644_0000116_6032_6754 225
275 3300053122 Ga0500608_048483 Ga0500608_048483_1330_2025 225
276 3300053125 Ga0500618_014785 Ga0500618_014785_876_1595 225
277 3300053138 Ga0500564_000005 Ga0500564_000005_89804_90526 225
278 3300053153 Ga0500616_0002764 Ga0500616_0002764_9493_10188 225
279 3300053177 Ga0500636_0018800 Ga0500636_0018800_3041_3760 225
280 3300005327 Ga0070658_10000891 Ga0070658_100008913 226
281 3300005327 Ga0070658_10009153 Ga0070658_100091535 226
282 3300005327 Ga0070658_10022228 Ga0070658_100222281 226
283 3300005327 Ga0070658_10131772 Ga0070658_101317721 226
284 3300005327 Ga0070658_10161080 Ga0070658_101610801 226
285 3300005339 Ga0070660_100001447 Ga0070660_1000014477 226
286 3300005339 Ga0070660_100009003 Ga0070660_1000090036 226
287 3300005339 Ga0070660_100015642 Ga0070660_1000156425 226
288 3300005339 Ga0070660_100050051 Ga0070660_1000500513 226
289 3300005344 Ga0070661_100184699 Ga0070661_1001846992 226
290 3300005345 Ga0070692_10009601 Ga0070692_100096012 226
291 3300005345 Ga0070692_10060806 Ga0070692_100608063 226
292 3300005366 Ga0070659_100098108 Ga0070659_1000981081 226
293 3300005455 Ga0070663_100008255 Ga0070663_1000082554 226
294 3300005548 Ga0070665_100276521 Ga0070665_1002765212 226
295 3300005563 Ga0068855_100005300 Ga0068855_1000053006 226
296 3300005563 Ga0068855_100275469 Ga0068855_1002754692 226
297 3300006880 Ga0075429_100369150 Ga0075429_1003691502 226
298 3300013102 Ga0157371_10000672 Ga0157371_100006723 226
299 3300013102 Ga0157371_10048881 Ga0157371_100488812 226
300 3300013104 Ga0157370_10006105 Ga0157370_1000610511 226
301 3300013104 Ga0157370_10075562 Ga0157370_100755623 226
302 3300013306 Ga0163162_10010318 Ga0163162_100103186 226
303 3300025901 Ga0207688_10083783 Ga0207688_100837832 226
304 3300025904 Ga0207647_10049924 Ga0207647_100499243 226
305 3300025904 Ga0207647_10091412 Ga0207647_100914122 226
306 3300025909 Ga0207705_10000169 Ga0207705_1000016946 226
307 3300025909 Ga0207705_10007396 Ga0207705_100073962 226
308 3300025909 Ga0207705_10012849 Ga0207705_100128495 226
309 3300025909 Ga0207705_10043520 Ga0207705_100435203 226
310 3300025909 Ga0207705_10061940 Ga0207705_100619403 226
311 3300025909 Ga0207705_10114906 Ga0207705_101149062 226
312 3300025919 Ga0207657_10000143 Ga0207657_1000014324 226
313 3300025919 Ga0207657_10000339 Ga0207657_1000033934 226
314 3300025919 Ga0207657_10001497 Ga0207657_100014973 226
315 3300025919 Ga0207657_10022921 Ga0207657_100229216 226
316 3300025920 Ga0207649_10193481 Ga0207649_101934812 226
317 3300025932 Ga0207690_10285454 Ga0207690_102854542 226
318 3300025949 Ga0207667_10007254 Ga0207667_100072549 226
319 3300025949 Ga0207667_10209199 Ga0207667_102091992 226
320 3300025972 Ga0207668_10265396 Ga0207668_102653962 226
321 3300026067 Ga0207678_10004994 Ga0207678_100049942 226
322 3300037312 Ga0395899_0000627 Ga0395899_0000627_31599_32300 226
323 3300037418 Ga0395900_0000031 Ga0395900_0000031_87747_88448 226
324 3300037418 Ga0395900_0252134 Ga0395900_0252134_953_1660 226
325 3300037466 Ga0395898_0007893 Ga0395898_0007893_7703_8404 226
326 3300037471 Ga0395905_0017857 Ga0395905_0017857_3696_4397 226
327 3300038443 Ga0395901_0000035 Ga0395901_0000035_197464_198165 226
328 3300044694 Ga0466963_0234558 Ga0466963_0234558_340_1050 226
329 3300046460 Ga0495638_0000012 Ga0495638_0000012_151816_152538 226
330 3300046506 Ga0495583_0000411 Ga0495583_0000411_25303_26025 226
331 3300046519 Ga0495632_0000832 Ga0495632_0000832_10138_10860 226
332 3300046523 Ga0495644_0055732 Ga0495644_0055732_71_793 226
333 3300046524 Ga0495648_0000038 Ga0495648_0000038_39075_39797 226
334 3300046525 Ga0495663_0001490 Ga0495663_0001490_107_829 226
335 3300046537 Ga0495598_0000380 Ga0495598_0000380_6275_6997 226
336 3300046539 Ga0495621_0005448 Ga0495621_0005448_1100_1822 226
337 3300046558 Ga0495633_0004956 Ga0495633_0004956_2327_3049 226
338 3300046684 Ga0495669_0001484 Ga0495669_0001484_4861_5583 226
339 3300046691 Ga0495670_0006811 Ga0495670_0006811_2277_2999 226
340 3300046692 Ga0495671_0000034 Ga0495671_0000034_38995_39717 226
341 3300047445 Ga0495677_0003525 Ga0495677_0003525_835_1557 226
342 3300047469 Ga0495673_0000013 Ga0495673_0000013_111696_112418 226
343 3300003781 Ga0055536_1004420 Ga0055536_10044203 227
344 3300003781 Ga0055536_1041416 Ga0055536_10414162 227
345 3300003794 Ga0055531_10014294 Ga0055531_100142945 227
346 3300005327 Ga0070658_10229267 Ga0070658_102292671 227
347 3300005328 Ga0070676_10069234 Ga0070676_100692342 227
348 3300005329 Ga0070683_100809647 Ga0070683_1008096471 227
349 3300005334 Ga0068869_100416478 Ga0068869_1004164782 227
350 3300005335 Ga0070666_10122415 Ga0070666_101224153 227
351 3300005338 Ga0068868_100329085 Ga0068868_1003290851 227
352 3300005339 Ga0070660_100018047 Ga0070660_1000180473 227
353 3300005344 Ga0070661_100093937 Ga0070661_1000939372 227
354 3300005344 Ga0070661_100170285 Ga0070661_1001702852 227
355 3300005345 Ga0070692_10005301 Ga0070692_100053014 227
356 3300005353 Ga0070669_100435099 Ga0070669_1004350992 227
357 3300005366 Ga0070659_100037728 Ga0070659_1000377283 227
358 3300005366 Ga0070659_100135269 Ga0070659_1001352691 227
359 3300005367 Ga0070667_100003776 Ga0070667_10000377612 227
360 3300005367 Ga0070667_100720688 Ga0070667_1007206881 227
361 3300005455 Ga0070663_100207552 Ga0070663_1002075522 227
362 3300005457 Ga0070662_100370102 Ga0070662_1003701022 227
363 3300005458 Ga0070681_10086088 Ga0070681_100860882 227
364 3300005459 Ga0068867_100063594 Ga0068867_1000635943 227
365 3300005530 Ga0070679_100255097 Ga0070679_1002550971 227
366 3300005530 Ga0070679_100438485 Ga0070679_1004384852 227
367 3300005539 Ga0068853_100008550 Ga0068853_1000085507 227
368 3300005564 Ga0070664_100009261 Ga0070664_1000092617 227
369 3300005564 Ga0070664_100177385 Ga0070664_1001773853 227
370 3300005577 Ga0068857_100074968 Ga0068857_1000749683 227
371 3300005578 Ga0068854_100005024 Ga0068854_1000050247 227
372 3300005578 Ga0068854_100161568 Ga0068854_1001615683 227
373 3300005614 Ga0068856_100145935 Ga0068856_1001459353 227
374 3300005616 Ga0068852_100090579 Ga0068852_1000905793 227
375 3300005616 Ga0068852_100111711 Ga0068852_1001117112 227
376 3300005841 Ga0068863_100782081 Ga0068863_1007820812 227
377 3300009174 Ga0105241_10495843 Ga0105241_104958432 227
378 3300009177 Ga0105248_10060179 Ga0105248_100601793 227
379 3300009177 Ga0105248_10085823 Ga0105248_100858233 227
380 3300009979 Ga0105032_102250 Ga0105032_1022503 227
381 3300013100 Ga0157373_10034144 Ga0157373_100341443 227
382 3300013296 Ga0157374_10307682 Ga0157374_103076822 227
383 3300013306 Ga0163162_10064370 Ga0163162_100643703 227
384 3300014968 Ga0157379_10379977 Ga0157379_103799772 227
385 3300020081 Ga0206354_10674928 Ga0206354_106749286 227
386 3300020082 Ga0206353_10506404 Ga0206353_105064045 227
387 3300025292 Ga0209676_1000084 Ga0209676_1000084268 227
388 3300025292 Ga0209676_1000678 Ga0209676_10006789 227
389 3300025298 Ga0209050_1007666 Ga0209050_10076662 227
390 3300025298 Ga0209050_1019516 Ga0209050_10195164 227
391 3300025304 Ga0209257_1000174 Ga0209257_1000174149 227
392 3300025304 Ga0209257_1005689 Ga0209257_10056894 227
393 3300025321 Ga0207656_10007328 Ga0207656_100073283 227
394 3300025904 Ga0207647_10036516 Ga0207647_100365163 227
395 3300025907 Ga0207645_10011848 Ga0207645_100118485 227
396 3300025909 Ga0207705_10003282 Ga0207705_100032823 227
397 3300025911 Ga0207654_10402296 Ga0207654_104022961 227
398 3300025912 Ga0207707_10286356 Ga0207707_102863562 227
399 3300025917 Ga0207660_10177722 Ga0207660_101777222 227
400 3300025919 Ga0207657_10013464 Ga0207657_100134647 227
401 3300025919 Ga0207657_10051586 Ga0207657_100515863 227
402 3300025919 Ga0207657_10184906 Ga0207657_101849062 227
403 3300025920 Ga0207649_10275508 Ga0207649_102755082 227
404 3300025921 Ga0207652_10423876 Ga0207652_104238762 227
405 3300025932 Ga0207690_10048003 Ga0207690_100480033 227
406 3300025933 Ga0207706_10024453 Ga0207706_100244533 227
407 3300025941 Ga0207711_10035421 Ga0207711_100354214 227
408 3300025949 Ga0207667_10548717 Ga0207667_105487172 227
409 3300025981 Ga0207640_10100046 Ga0207640_101000463 227
410 3300025986 Ga0207658_10020002 Ga0207658_100200023 227
411 3300025986 Ga0207658_10868635 Ga0207658_108686351 227
412 3300026023 Ga0207677_10339731 Ga0207677_103397312 227
413 3300026041 Ga0207639_10026732 Ga0207639_100267324 227
414 3300026041 Ga0207639_10614507 Ga0207639_106145072 227
415 3300026067 Ga0207678_10001094 Ga0207678_1000109418 227
416 3300026067 Ga0207678_10002439 Ga0207678_100024395 227
417 3300026078 Ga0207702_10375271 Ga0207702_103752712 227
418 3300026089 Ga0207648_10128530 Ga0207648_101285303 227
419 3300026142 Ga0207698_10018296 Ga0207698_100182962 227
420 3300026142 Ga0207698_10489882 Ga0207698_104898822 227
421 3300031911 Ga0307412_10274042 Ga0307412_102740422 227
422 3300032002 Ga0307416_100816971 Ga0307416_1008169712 227
423 3300046616 Ga0495668_0000001 Ga0495668_0000001_67429_68145 227
424 3300046660 Ga0495625_0001920 Ga0495625_0001920_16687_17403 227
425 3300048909 Ga0496106_0234506 Ga0496106_0234506_357_1049 227
426 3300048910 Ga0496107_0012723 Ga0496107_0012723_1679_2371 227
427 3300048913 Ga0496110_0212205 Ga0496110_0212205_426_1118 227
428 3300053139 Ga0500568_0016977 Ga0500568_0016977_1885_2601 227
429 3300003320 rootH2_10242183 rootH2_102421833 228
430 3300005327 Ga0070658_10083456 Ga0070658_100834563 228
431 3300005333 Ga0070677_10096094 Ga0070677_100960941 228
432 3300005337 Ga0070682_100223535 Ga0070682_1002235352 228
433 3300005339 Ga0070660_100171776 Ga0070660_1001717762 228
434 3300005344 Ga0070661_100000272 Ga0070661_10000027234 228
435 3300005344 Ga0070661_100625755 Ga0070661_1006257551 228
436 3300005364 Ga0070673_100325450 Ga0070673_1003254502 228
437 3300005466 Ga0070685_10506620 Ga0070685_105066201 228
438 3300005616 Ga0068852_100761845 Ga0068852_1007618452 228
439 3300005843 Ga0068860_100761851 Ga0068860_1007618511 228
440 3300013102 Ga0157371_10035809 Ga0157371_100358093 228
441 3300025917 Ga0207660_10000781 Ga0207660_100007814 228
442 3300025920 Ga0207649_10002551 Ga0207649_100025513 228
443 3300025921 Ga0207652_10000001 Ga0207652_10000001643 228
444 3300025921 Ga0207652_10000002 Ga0207652_1000000284 228
445 3300025960 Ga0207651_10283163 Ga0207651_102831632 228
446 3300028380 Ga0268265_10385394 Ga0268265_103853942 228
447 3300044694 Ga0466963_0040285 Ga0466963_0040285_1117_1818 228
448 3300044694 Ga0466963_0072538 Ga0466963_0072538_956_1654 228
449 3300044719 Ga0466971_0126550 Ga0466971_0126550_20_718 228
450 3300044842 Ga0466957_0004719 Ga0466957_0004719_6725_7423 228
451 3300045836 Ga0466958_0008138 Ga0466958_0008138_597_1295 228
452 3300045836 Ga0466958_0165580 Ga0466958_0165580_485_1186 228
453 3300045976 Ga0466967_0006738 Ga0466967_0006738_3419_4117 228
454 3300046684 Ga0495669_0001528 Ga0495669_0001528_3233_3931 228
455 3300047445 Ga0495677_0064025 Ga0495677_0064025_240_938 228
456 3300048911 Ga0496108_0005745 Ga0496108_0005745_3875_4573 228
457 3300061719 Ga0466962_0046581 Ga0466962_0046581_1169_1870 228
458 3300005458 Ga0070681_10396576 Ga0070681_103965762 229
459 3300005548 Ga0070665_100005659 Ga0070665_1000056593 229
460 3300005841 Ga0068863_100080154 Ga0068863_1000801543 229
461 3300006177 Ga0075362_10083482 Ga0075362_100834822 229
462 3300026088 Ga0207641_10054968 Ga0207641_100549683 229
463 3300028379 Ga0268266_10004883 Ga0268266_100048833 229
464 3300028381 Ga0268264_10588568 Ga0268264_105885682 229
465 3300031901 Ga0307406_10099297 Ga0307406_100992973 229
466 3300032126 Ga0307415_100416483 Ga0307415_1004164832 229
467 3300045976 Ga0466967_0118704 Ga0466967_0118704_1052_1756 229
468 3300047472 Ga0495686_0011425 Ga0495686_0011425_3249_3959 229
469 3300050489 nmdc:mga03683_20042_c1 nmdc:mga03683_20042_c1_94_801 229
470 3300061719 Ga0466962_0080265 Ga0466962_0080265_354_1058 229
471 3300005327 Ga0070658_10121389 Ga0070658_101213893 230
472 3300005331 Ga0070670_100018791 Ga0070670_1000187913 230
473 3300005333 Ga0070677_10265619 Ga0070677_102656191 230
474 3300005344 Ga0070661_100494099 Ga0070661_1004940992 230
475 3300005364 Ga0070673_100143721 Ga0070673_1001437212 230
476 3300005366 Ga0070659_100026112 Ga0070659_1000261124 230
477 3300005366 Ga0070659_100200954 Ga0070659_1002009542 230
478 3300005616 Ga0068852_100291754 Ga0068852_1002917543 230
479 3300005842 Ga0068858_100087372 Ga0068858_1000873722 230
480 3300013100 Ga0157373_10062477 Ga0157373_100624772 230
481 3300013102 Ga0157371_10172413 Ga0157371_101724132 230
482 3300013102 Ga0157371_10234269 Ga0157371_102342692 230
483 3300013307 Ga0157372_10819941 Ga0157372_108199412 230
484 3300013308 Ga0157375_10461669 Ga0157375_104616692 230
485 3300025909 Ga0207705_10049349 Ga0207705_100493493 230
486 3300025920 Ga0207649_10286639 Ga0207649_102866392 230
487 3300025925 Ga0207650_10347600 Ga0207650_103476002 230
488 3300025932 Ga0207690_10051667 Ga0207690_100516673 230
489 3300025932 Ga0207690_10076511 Ga0207690_100765112 230
490 3300026035 Ga0207703_10081551 Ga0207703_100815513 230
491 3300026142 Ga0207698_10278117 Ga0207698_102781173 230
492 3300031731 Ga0307405_10151949 Ga0307405_101519493 230
493 3300031824 Ga0307413_10275322 Ga0307413_102753221 230
494 3300031852 Ga0307410_10090751 Ga0307410_100907512 230
495 3300031901 Ga0307406_10044209 Ga0307406_100442093 230
496 3300031903 Ga0307407_10045989 Ga0307407_100459892 230
497 3300031903 Ga0307407_10109132 Ga0307407_101091322 230
498 3300031995 Ga0307409_100019633 Ga0307409_1000196334 230
499 3300031995 Ga0307409_100403773 Ga0307409_1004037732 230
500 3300032002 Ga0307416_100049063 Ga0307416_1000490632 230
501 3300032004 Ga0307414_10026432 Ga0307414_100264323 230
502 3300032005 Ga0307411_10121216 Ga0307411_101212163 230
503 3300032005 Ga0307411_10139206 Ga0307411_101392062 230
504 3300032126 Ga0307415_100017743 Ga0307415_1000177434 230
505 3300032126 Ga0307415_100065900 Ga0307415_1000659002 230
506 3300032126 Ga0307415_100235118 Ga0307415_1002351182 230
507 3300032126 Ga0307415_100585481 Ga0307415_1005854811 230
508 3300037418 Ga0395900_0065765 Ga0395900_0065765_360_1061 230
509 3300037418 Ga0395900_0094359 Ga0395900_0094359_1825_2529 230
510 3300037418 Ga0395900_0631238 Ga0395900_0631238_67_771 230
511 3300037466 Ga0395898_0094103 Ga0395898_0094103_1690_2394 230
512 3300037466 Ga0395898_0606956 Ga0395898_0606956_316_1017 230
513 3300037466 Ga0395898_0803226 Ga0395898_0803226_155_859 230
514 3300037471 Ga0395905_0075140 Ga0395905_0075140_1318_2022 230
515 3300037471 Ga0395905_0315035 Ga0395905_0315035_597_1301 230
516 3300038443 Ga0395901_0157213 Ga0395901_0157213_440_1144 230
517 3300038443 Ga0395901_0373059 Ga0395901_0373059_232_936 230
518 3300044694 Ga0466963_0277621 Ga0466963_0277621_264_980 230
519 3300045049 Ga0466959_0055897 Ga0466959_0055897_1298_1999 230
520 3300045836 Ga0466958_0084393 Ga0466958_0084393_349_1050 230
521 3300044694 Ga0466963_0089475 Ga0466963_0089475_586_1290 231
522 3300045976 Ga0466967_0189016 Ga0466967_0189016_782_1486 231
523 3300001915 JGI24741J21665_1001923 JGI24741J21665_10019235 232
524 3300001979 JGI24740J21852_10000589 JGI24740J21852_1000058914 232
525 3300001979 JGI24740J21852_10012508 JGI24740J21852_100125082 232
526 3300001989 JGI24739J22299_10006394 JGI24739J22299_100063945 232
527 3300001989 JGI24739J22299_10036502 JGI24739J22299_100365022 232
528 3300001990 JGI24737J22298_10000717 JGI24737J22298_100007177 232
529 3300002067 JGI24735J21928_10005017 JGI24735J21928_100050173 232
530 3300002075 JGI24738J21930_10003360 JGI24738J21930_100033603 232
531 3300005327 Ga0070658_10000205 Ga0070658_1000020525 232
532 3300005327 Ga0070658_10034793 Ga0070658_100347934 232
533 3300005329 Ga0070683_100002492 Ga0070683_1000024925 232
534 3300005329 Ga0070683_100066511 Ga0070683_1000665113 232
535 3300005330 Ga0070690_100037433 Ga0070690_1000374331 232
536 3300005331 Ga0070670_100288311 Ga0070670_1002883112 232
537 3300005335 Ga0070666_10000168 Ga0070666_100001686 232
538 3300005336 Ga0070680_100033201 Ga0070680_1000332013 232
539 3300005337 Ga0070682_100011208 Ga0070682_1000112083 232
540 3300005339 Ga0070660_100000009 Ga0070660_10000000942 232
541 3300005344 Ga0070661_100000100 Ga0070661_10000010042 232
542 3300005344 Ga0070661_100004554 Ga0070661_1000045545 232
543 3300005344 Ga0070661_100133218 Ga0070661_1001332182 232
544 3300005345 Ga0070692_10062491 Ga0070692_100624912 232
545 3300005355 Ga0070671_100003268 Ga0070671_1000032685 232
546 3300005355 Ga0070671_100027694 Ga0070671_1000276943 232
547 3300005364 Ga0070673_100033005 Ga0070673_1000330054 232
548 3300005364 Ga0070673_100075351 Ga0070673_1000753513 232
549 3300005366 Ga0070659_100000048 Ga0070659_10000004812 232
550 3300005367 Ga0070667_100003299 Ga0070667_10000329913 232
551 3300005455 Ga0070663_100003985 Ga0070663_1000039855 232
552 3300005455 Ga0070663_100046589 Ga0070663_1000465893 232
553 3300005457 Ga0070662_100000035 Ga0070662_10000003533 232
554 3300005457 Ga0070662_100006246 Ga0070662_1000062464 232
555 3300005458 Ga0070681_10032307 Ga0070681_100323073 232
556 3300005458 Ga0070681_10174003 Ga0070681_101740033 232
557 3300005530 Ga0070679_100000007 Ga0070679_10000000758 232
558 3300005530 Ga0070679_100123415 Ga0070679_1001234152 232
559 3300005535 Ga0070684_100034504 Ga0070684_1000345043 232
560 3300005535 Ga0070684_100235931 Ga0070684_1002359312 232
561 3300005539 Ga0068853_100001248 Ga0068853_1000012488 232
562 3300005547 Ga0070693_100003192 Ga0070693_1000031924 232
563 3300005548 Ga0070665_100008493 Ga0070665_1000084936 232
564 3300005563 Ga0068855_100001487 Ga0068855_10000148712 232
565 3300005563 Ga0068855_100022719 Ga0068855_1000227194 232
566 3300005564 Ga0070664_100000025 Ga0070664_10000002561 232
567 3300005577 Ga0068857_100044888 Ga0068857_1000448884 232
568 3300005578 Ga0068854_100009160 Ga0068854_1000091603 232
569 3300005614 Ga0068856_100000124 Ga0068856_10000012473 232
570 3300005616 Ga0068852_100025719 Ga0068852_1000257191 232
571 3300005618 Ga0068864_100015927 Ga0068864_1000159273 232
572 3300005618 Ga0068864_100037788 Ga0068864_1000377884 232
573 3300005842 Ga0068858_100020174 Ga0068858_1000201743 232
574 3300006237 Ga0097621_100135322 Ga0097621_1001353221 232
575 3300009174 Ga0105241_10007654 Ga0105241_100076543 232
576 3300009177 Ga0105248_10000163 Ga0105248_1000016342 232
577 3300009177 Ga0105248_10065042 Ga0105248_100650424 232
578 3300013100 Ga0157373_10097653 Ga0157373_100976533 232
579 3300013102 Ga0157371_10002007 Ga0157371_100020075 232
580 3300013105 Ga0157369_11302964 Ga0157369_113029641 232
581 3300013296 Ga0157374_10009045 Ga0157374_100090453 232
582 3300013307 Ga0157372_10016123 Ga0157372_100161235 232
583 3300014325 Ga0163163_10000173 Ga0163163_1000017340 232
584 3300014968 Ga0157379_10027263 Ga0157379_100272633 232
585 3300014969 Ga0157376_10462108 Ga0157376_104621081 232
586 3300025903 Ga0207680_10006032 Ga0207680_100060322 232
587 3300025904 Ga0207647_10070577 Ga0207647_100705773 232
588 3300025909 Ga0207705_10000114 Ga0207705_1000011430 232
589 3300025909 Ga0207705_10003511 Ga0207705_100035113 232
590 3300025911 Ga0207654_10093294 Ga0207654_100932942 232
591 3300025912 Ga0207707_10020600 Ga0207707_100206004 232
592 3300025912 Ga0207707_10048025 Ga0207707_100480251 232
593 3300025917 Ga0207660_10008547 Ga0207660_100085474 232
594 3300025919 Ga0207657_10000071 Ga0207657_1000007160 232
595 3300025919 Ga0207657_10013044 Ga0207657_100130445 232
596 3300025920 Ga0207649_10000301 Ga0207649_1000030133 232
597 3300025920 Ga0207649_10006077 Ga0207649_100060774 232
598 3300025921 Ga0207652_10002862 Ga0207652_1000286212 232
599 3300025925 Ga0207650_10298081 Ga0207650_102980812 232
600 3300025931 Ga0207644_10004781 Ga0207644_100047817 232
601 3300025931 Ga0207644_10020504 Ga0207644_100205043 232
602 3300025932 Ga0207690_10000045 Ga0207690_1000004511 232
603 3300025932 Ga0207690_10001260 Ga0207690_1000126015 232
604 3300025933 Ga0207706_10000086 Ga0207706_1000008642 232
605 3300025933 Ga0207706_10000655 Ga0207706_100006557 232
606 3300025933 Ga0207706_10072223 Ga0207706_100722233 232
607 3300025941 Ga0207711_10003283 Ga0207711_1000328312 232
608 3300025941 Ga0207711_10102504 Ga0207711_101025043 232
609 3300025944 Ga0207661_10001017 Ga0207661_100010174 232
610 3300025944 Ga0207661_10052798 Ga0207661_100527983 232
611 3300025945 Ga0207679_10000315 Ga0207679_1000031512 232
612 3300025945 Ga0207679_10022222 Ga0207679_100222224 232
613 3300025945 Ga0207679_10267409 Ga0207679_102674092 232
614 3300025949 Ga0207667_10001152 Ga0207667_1000115212 232
615 3300025949 Ga0207667_10063862 Ga0207667_100638624 232
616 3300025960 Ga0207651_10027613 Ga0207651_100276133 232
617 3300025960 Ga0207651_10127095 Ga0207651_101270952 232
618 3300025981 Ga0207640_10046418 Ga0207640_100464182 232
619 3300025981 Ga0207640_10082219 Ga0207640_100822192 232
620 3300025986 Ga0207658_10075063 Ga0207658_100750632 232
621 3300026041 Ga0207639_10000330 Ga0207639_1000033014 232
622 3300026041 Ga0207639_10005870 Ga0207639_100058705 232
623 3300026067 Ga0207678_10000311 Ga0207678_1000031122 232
624 3300026067 Ga0207678_10000860 Ga0207678_1000086023 232
625 3300026078 Ga0207702_10000254 Ga0207702_1000025457 232
626 3300026095 Ga0207676_10014324 Ga0207676_100143242 232
627 3300026116 Ga0207674_10003121 Ga0207674_1000312117 232
628 3300026142 Ga0207698_10000709 Ga0207698_100007099 232
629 3300026142 Ga0207698_10047293 Ga0207698_100472933 232
630 3300028379 Ga0268266_10009531 Ga0268266_100095317 232
631 3300032004 Ga0307414_10003389 Ga0307414_100033893 232
632 3300035691 Ga0373931_0000615 Ga0373931_0000615_4453_5160 232
633 3300045976 Ga0466967_0029374 Ga0466967_0029374_3106_3813 232
634 3300048909 Ga0496106_0564936 Ga0496106_0564936_171_878 232
635 3300048911 Ga0496108_0062013 Ga0496108_0062013_219_926 232
636 3300048912 Ga0496109_0532693 Ga0496109_0532693_364_1071 232
637 3300048913 Ga0496110_0153254 Ga0496110_0153254_348_1055 232
638 3300048914 Ga0496111_0200044 Ga0496111_0200044_301_1008 232
639 3300048915 Ga0496112_0006500 Ga0496112_0006500_3474_4181 232
640 3300048916 Ga0496113_0260113 Ga0496113_0260113_20_727 232

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jcr-assembly1.cif.gz_E clpp1 n165d mutant from listeria monocytogenes 0.7403 55 231
7uvn-assembly1.cif.gz_C-2 crystal structure of human clpp protease in complex with tr-57 0.7226 55 231
3zwb-assembly2.cif.gz_B crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa 0.7199 43 141
4ryf-assembly1.cif.gz_A clpp1/2 heterocomplex from listeria monocytogenes 0.7135 55 231
6iun-assembly2.cif.gz_A crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with nad 0.6925 44 141
ID Description Score Start End Superfamily
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7097 46 105 3.30.750.24
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7093 43 139 3.90.226.10
5dtwA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.699 45 141 3.90.226.10
af_Q4CWB6_74_389_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.6926 45 141 3.90.226.10
af_Q8IJM7_69_466_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.6898 44 140 3.90.226.10
ID Description Score Start End GO Terms
AF-W7W8U1-F1-model_v4 Uncharacterized protein 0.936 43 135
AF-A0A3D4DVI8-F1-model_v4 Uncharacterized protein 0.9327 45 139
AF-A0A7G6A982-F1-model_v4 Uncharacterized protein 0.8863 41 149 GO:0016020
AF-A0A4P7RXC4-F1-model_v4 Clp protease ClpP 0.8792 24 231
AF-A0A0Q8BIM3-F1-model_v4 deleted 0.8763 43 228

Feature Viewer

pLDDT pTM Quality
79.09 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map