F471538
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 638 | 284 | 639 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0041545|Ga0466963_0041545_1437_2282 |
| Length | 281 |
| Sequence | MGAEAPALPAPGADLSNLVNRVLVAVVGLPIVLGAVWGGGWWLFALVAVAGAVAVHEFVVMARPLAPLAPAAYVGVFLALLGAQRGGLLWMLAGFLATLVVAFALNTLAKTRPPATAAIGATVLAAAWIGFGLGHIVLLRRMDAHPQLIAFTVLLVVFAADTFAYFGGRLFGRRKLAPTLSPGKTWEGFVVGSLVGIFVAFVALYQNRDTYLNVWEALVLGVVVVLVAVAGDLFESMLKRDMQVKDTGNLLGGHGGVLDRVDALLFAAPATYYLVRAFGYL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 74 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 75 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 118 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 129 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 130 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 134 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 136 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 148 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 151 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 160 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 161 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 162 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 163 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 164 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 167 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 168 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 169 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 170 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 171 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 174 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 284 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 7.84 |
| Rhizosphere | 91.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10096223 | 3300003316 | Bacteria | 1606 |
| 2 | rootH1_10096223 | 3300003323 | Bacteria | 1926 |
| 3 | Ga0070658_10014188 | 3300005327 | Bacteria | 6395 |
| 4 | Ga0070658_10039243 | 3300005327 | Bacteria | 3819 |
| 5 | Ga0070683_100003014 | 3300005329 | Bacteria | 13523 |
| 6 | Ga0070683_100007546 | 3300005329 | Bacteria | 9191 |
| 7 | Ga0070683_100155595 | 3300005329 | Bacteria | 2168 |
| 8 | Ga0070690_100100853 | 3300005330 | Bacteria | 1914 |
| 9 | Ga0068869_100036551 | 3300005334 | Bacteria | 3488 |
| 10 | Ga0070680_100092377 | 3300005336 | Bacteria | 2506 |
| 11 | Ga0070680_100246477 | 3300005336 | Bacteria | 1510 |
| 12 | Ga0070682_100279765 | 3300005337 | Bacteria | 1216 |
| 13 | Ga0068868_100406575 | 3300005338 | Bacteria | 1176 |
| 14 | Ga0070660_100036788 | 3300005339 | Bacteria | 3709 |
| 15 | Ga0070691_10027363 | 3300005341 | Bacteria | 2660 |
| 16 | Ga0070691_10098492 | 3300005341 | Bacteria | 1449 |
| 17 | Ga0070661_100013123 | 3300005344 | Bacteria | 5813 |
| 18 | Ga0070667_100033005 | 3300005367 | Bacteria | 4322 |
| 19 | Ga0070709_10009642 | 3300005434 | Bacteria | 5332 |
| 20 | Ga0070714_100007459 | 3300005435 | Bacteria | 8515 |
| 21 | Ga0070714_100114075 | 3300005435 | Bacteria | 2397 |
| 22 | Ga0070714_100117692 | 3300005435 | Bacteria | 2360 |
| 23 | Ga0070714_100207512 | 3300005435 | Bacteria | 1795 |
| 24 | Ga0070714_100584308 | 3300005435 | Bacteria | 1072 |
| 25 | Ga0070713_100018306 | 3300005436 | Bacteria | 5325 |
| 26 | Ga0070713_100307065 | 3300005436 | Bacteria | 1462 |
| 27 | Ga0070710_10000589 | 3300005437 | Bacteria | 17269 |
| 28 | Ga0070710_10006973 | 3300005437 | Bacteria | 5450 |
| 29 | Ga0070711_100006227 | 3300005439 | Bacteria | 7182 |
| 30 | Ga0070705_100184259 | 3300005440 | Bacteria | 1417 |
| 31 | Ga0070700_100022193 | 3300005441 | Bacteria | 3699 |
| 32 | Ga0070708_100650847 | 3300005445 | Bacteria | 993 |
| 33 | Ga0070681_10011454 | 3300005458 | Bacteria | 8777 |
| 34 | Ga0070681_10020004 | 3300005458 | Bacteria | 6707 |
| 35 | Ga0070681_10034201 | 3300005458 | Bacteria | 5104 |
| 36 | Ga0070681_10223319 | 3300005458 | Bacteria | 1799 |
| 37 | Ga0070681_10240090 | 3300005458 | Bacteria | 1726 |
| 38 | Ga0068867_100239083 | 3300005459 | Bacteria | 1472 |
| 39 | Ga0068867_100521232 | 3300005459 | Bacteria | 1025 |
| 40 | Ga0070706_100382290 | 3300005467 | Bacteria | 1311 |
| 41 | Ga0070707_100001400 | 3300005468 | Bacteria | 23671 |
| 42 | Ga0070707_100111218 | 3300005468 | Bacteria | 2657 |
| 43 | Ga0070707_100153336 | 3300005468 | Bacteria | 2243 |
| 44 | Ga0070698_100056389 | 3300005471 | Bacteria | 3982 |
| 45 | Ga0070698_100383323 | 3300005471 | Bacteria | 1338 |
| 46 | Ga0070679_100019792 | 3300005530 | Bacteria | 6553 |
| 47 | Ga0070679_100089465 | 3300005530 | Bacteria | 3066 |
| 48 | Ga0070679_100125102 | 3300005530 | Bacteria | 2554 |
| 49 | Ga0070684_100004862 | 3300005535 | Bacteria | 10270 |
| 50 | Ga0070684_100036287 | 3300005535 | Bacteria | 4224 |
| 51 | Ga0070684_100051060 | 3300005535 | Bacteria | 3593 |
| 52 | Ga0070684_100280526 | 3300005535 | Bacteria | 1526 |
| 53 | Ga0070684_100373638 | 3300005535 | Bacteria | 1313 |
| 54 | Ga0070695_100000062 | 3300005545 | Bacteria | 43594 |
| 55 | Ga0070695_100273728 | 3300005545 | Bacteria | 1238 |
| 56 | Ga0070693_100378826 | 3300005547 | Bacteria | 975 |
| 57 | Ga0070665_100070154 | 3300005548 | Bacteria | 3511 |
| 58 | Ga0068855_100010562 | 3300005563 | Bacteria | 11133 |
| 59 | Ga0068855_100199484 | 3300005563 | Bacteria | 2253 |
| 60 | Ga0070664_100063384 | 3300005564 | Bacteria | 3152 |
| 61 | Ga0068857_100004499 | 3300005577 | Bacteria | 11782 |
| 62 | Ga0068854_100333152 | 3300005578 | Bacteria | 1237 |
| 63 | Ga0068856_100344313 | 3300005614 | Bacteria | 1509 |
| 64 | Ga0068856_100493987 | 3300005614 | Bacteria | 1245 |
| 65 | Ga0068864_100303387 | 3300005618 | Bacteria | 1496 |
| 66 | Ga0068864_100792099 | 3300005618 | Bacteria | 931 |
| 67 | Ga0068861_100102859 | 3300005719 | Bacteria | 2275 |
| 68 | Ga0068862_100241990 | 3300005844 | Bacteria | 1641 |
| 69 | Ga0081455_10031319 | 3300005937 | Bacteria | 4814 |
| 70 | Ga0081455_10109859 | 3300005937 | Bacteria | 2194 |
| 71 | Ga0081538_10007438 | 3300005981 | Bacteria | 9480 |
| 72 | Ga0081538_10021172 | 3300005981 | Bacteria | 4760 |
| 73 | Ga0081538_10035380 | 3300005981 | Bacteria | 3282 |
| 74 | Ga0081539_10000041 | 3300005985 | Bacteria | 292660 |
| 75 | Ga0070717_10011348 | 3300006028 | Bacteria | 6763 |
| 76 | Ga0070717_10013735 | 3300006028 | Bacteria | 6213 |
| 77 | Ga0070717_10020225 | 3300006028 | Bacteria | 5231 |
| 78 | Ga0070717_10203831 | 3300006028 | Bacteria | 1733 |
| 79 | Ga0070717_10217102 | 3300006028 | Bacteria | 1680 |
| 80 | Ga0070715_10038666 | 3300006163 | Bacteria | 1982 |
| 81 | Ga0070716_100007254 | 3300006173 | Bacteria | 5450 |
| 82 | Ga0070716_100511198 | 3300006173 | Bacteria | 888 |
| 83 | Ga0075366_10184611 | 3300006195 | Bacteria | 1267 |
| 84 | Ga0075434_100026447 | 3300006871 | Bacteria | 5684 |
| 85 | Ga0075434_100266280 | 3300006871 | Bacteria | 1733 |
| 86 | Ga0068865_100133230 | 3300006881 | Bacteria | 1864 |
| 87 | Ga0075436_100238901 | 3300006914 | Bacteria | 1292 |
| 88 | Ga0105240_10009653 | 3300009093 | Bacteria | 13646 |
| 89 | Ga0105240_10084757 | 3300009093 | Bacteria | 3884 |
| 90 | Ga0105240_10292326 | 3300009093 | Bacteria | 1867 |
| 91 | Ga0105240_10703432 | 3300009093 | Bacteria | 1103 |
| 92 | Ga0111539_10004030 | 3300009094 | Bacteria | 19288 |
| 93 | Ga0111539_10006384 | 3300009094 | Bacteria | 15204 |
| 94 | Ga0111539_10068910 | 3300009094 | Bacteria | 4177 |
| 95 | Ga0105245_10029132 | 3300009098 | Bacteria | 4875 |
| 96 | Ga0105245_10463867 | 3300009098 | Bacteria | 1277 |
| 97 | Ga0105247_10196567 | 3300009101 | Bacteria | 1353 |
| 98 | Ga0114129_10062927 | 3300009147 | Bacteria | 5183 |
| 99 | Ga0114129_10128447 | 3300009147 | Bacteria | 3483 |
| 100 | Ga0105241_10239060 | 3300009174 | Bacteria | 1534 |
| 101 | Ga0105242_10064870 | 3300009176 | Bacteria | 3011 |
| 102 | Ga0105248_10274395 | 3300009177 | Bacteria | 1899 |
| 103 | Ga0105238_10056734 | 3300009551 | Bacteria | 3928 |
| 104 | Ga0105238_10572521 | 3300009551 | Bacteria | 1135 |
| 105 | Ga0105249_10220639 | 3300009553 | Bacteria | 1865 |
| 106 | Ga0105239_10157109 | 3300010375 | Bacteria | 2540 |
| 107 | Ga0105239_10920759 | 3300010375 | Bacteria | 1004 |
| 108 | Ga0157373_10290288 | 3300013100 | Bacteria | 1160 |
| 109 | Ga0157370_10012187 | 3300013104 | Bacteria | 8938 |
| 110 | Ga0157370_10017960 | 3300013104 | Bacteria | 7121 |
| 111 | Ga0157369_10001204 | 3300013105 | Bacteria | 32229 |
| 112 | Ga0157369_10004504 | 3300013105 | Bacteria | 16412 |
| 113 | Ga0157369_10048846 | 3300013105 | Bacteria | 4590 |
| 114 | Ga0157369_10065952 | 3300013105 | Bacteria | 3895 |
| 115 | Ga0157369_10205378 | 3300013105 | Bacteria | 2066 |
| 116 | Ga0157374_10011973 | 3300013296 | Bacteria | 7531 |
| 117 | Ga0163162_10625241 | 3300013306 | Bacteria | 1202 |
| 118 | Ga0157372_10181793 | 3300013307 | Bacteria | 2434 |
| 119 | Ga0157372_10237668 | 3300013307 | Bacteria | 2113 |
| 120 | Ga0157372_10518430 | 3300013307 | Bacteria | 1390 |
| 121 | Ga0157372_10888891 | 3300013307 | Unclassified | 1034 |
| 122 | Ga0157375_10310775 | 3300013308 | Bacteria | 1740 |
| 123 | Ga0182008_10003715 | 3300014497 | Bacteria | 9104 |
| 124 | Ga0182008_10050772 | 3300014497 | Bacteria | 2058 |
| 125 | Ga0157379_10108207 | 3300014968 | Bacteria | 2496 |
| 126 | Ga0157376_10123649 | 3300014969 | Bacteria | 2297 |
| 127 | Ga0182006_1012613 | 3300015261 | Bacteria | 3695 |
| 128 | Ga0182007_10033923 | 3300015262 | Bacteria | 1727 |
| 129 | Ga0206353_11182390 | 3300020082 | Bacteria | 6192 |
| 130 | Ga0206353_12036014 | 3300020082 | Bacteria | 3148 |
| 131 | Ga0213873_10039324 | 3300021358 | Bacteria | 1212 |
| 132 | Ga0213871_10061727 | 3300021441 | Bacteria | 1045 |
| 133 | Ga0207692_10001763 | 3300025898 | Bacteria | 8214 |
| 134 | Ga0207642_10055436 | 3300025899 | Bacteria | 1813 |
| 135 | Ga0207710_10115827 | 3300025900 | Bacteria | 1276 |
| 136 | Ga0207688_10139234 | 3300025901 | Bacteria | 1427 |
| 137 | Ga0207685_10007005 | 3300025905 | Bacteria | 3112 |
| 138 | Ga0207699_10007743 | 3300025906 | Bacteria | 5260 |
| 139 | Ga0207699_10025505 | 3300025906 | Bacteria | 3246 |
| 140 | Ga0207699_10220737 | 3300025906 | Bacteria | 1294 |
| 141 | Ga0207705_10001180 | 3300025909 | Bacteria | 21214 |
| 142 | Ga0207705_10056857 | 3300025909 | Bacteria | 2822 |
| 143 | Ga0207654_10218272 | 3300025911 | Bacteria | 1263 |
| 144 | Ga0207707_10050785 | 3300025912 | Bacteria | 3612 |
| 145 | Ga0207707_10155620 | 3300025912 | Bacteria | 1999 |
| 146 | Ga0207707_10295655 | 3300025912 | Bacteria | 1401 |
| 147 | Ga0207695_10016356 | 3300025913 | Bacteria | 8682 |
| 148 | Ga0207695_10291866 | 3300025913 | Unclassified | 1523 |
| 149 | Ga0207693_10000662 | 3300025915 | Bacteria | 30935 |
| 150 | Ga0207693_10194909 | 3300025915 | Bacteria | 1594 |
| 151 | Ga0207663_10000565 | 3300025916 | Bacteria | 16340 |
| 152 | Ga0207660_10077639 | 3300025917 | Bacteria | 2432 |
| 153 | Ga0207660_10156435 | 3300025917 | Bacteria | 1755 |
| 154 | Ga0207657_10000739 | 3300025919 | Bacteria | 34678 |
| 155 | Ga0207657_10006735 | 3300025919 | Bacteria | 11862 |
| 156 | Ga0207657_10048812 | 3300025919 | Bacteria | 3694 |
| 157 | Ga0207657_10340144 | 3300025919 | Bacteria | 1184 |
| 158 | Ga0207649_10049404 | 3300025920 | Bacteria | 2598 |
| 159 | Ga0207649_10414348 | 3300025920 | Bacteria | 1011 |
| 160 | Ga0207652_10059252 | 3300025921 | Bacteria | 3300 |
| 161 | Ga0207652_10197161 | 3300025921 | Bacteria | 1812 |
| 162 | Ga0207652_10480204 | 3300025921 | Bacteria | 1119 |
| 163 | Ga0207646_10002734 | 3300025922 | Bacteria | 20624 |
| 164 | Ga0207646_10202568 | 3300025922 | Bacteria | 1793 |
| 165 | Ga0207646_10365937 | 3300025922 | Bacteria | 1303 |
| 166 | Ga0207687_10055410 | 3300025927 | Bacteria | 2778 |
| 167 | Ga0207700_10003047 | 3300025928 | Bacteria | 9669 |
| 168 | Ga0207700_10033252 | 3300025928 | Bacteria | 3688 |
| 169 | Ga0207664_10012742 | 3300025929 | Bacteria | 6019 |
| 170 | Ga0207664_10033209 | 3300025929 | Bacteria | 3962 |
| 171 | Ga0207664_10151520 | 3300025929 | Bacteria | 1970 |
| 172 | Ga0207664_10337774 | 3300025929 | Bacteria | 1331 |
| 173 | Ga0207644_10582684 | 3300025931 | Unclassified | 928 |
| 174 | Ga0207690_10306303 | 3300025932 | Bacteria | 1245 |
| 175 | Ga0207706_10013802 | 3300025933 | Bacteria | 7332 |
| 176 | Ga0207706_10183969 | 3300025933 | Bacteria | 1835 |
| 177 | Ga0207669_10194565 | 3300025937 | Bacteria | 1466 |
| 178 | Ga0207665_10000060 | 3300025939 | Bacteria | 70443 |
| 179 | Ga0207689_10102116 | 3300025942 | Bacteria | 2356 |
| 180 | Ga0207661_10019738 | 3300025944 | Bacteria | 5031 |
| 181 | Ga0207661_10031672 | 3300025944 | Bacteria | 4088 |
| 182 | Ga0207661_10347762 | 3300025944 | Bacteria | 1337 |
| 183 | Ga0207667_10334725 | 3300025949 | Bacteria | 1545 |
| 184 | Ga0207640_10328518 | 3300025981 | Bacteria | 1220 |
| 185 | Ga0207640_10428243 | 3300025981 | Bacteria | 1085 |
| 186 | Ga0207658_10014892 | 3300025986 | Bacteria | 5330 |
| 187 | Ga0207677_10224757 | 3300026023 | Bacteria | 1508 |
| 188 | Ga0207708_10007293 | 3300026075 | Bacteria | 8177 |
| 189 | Ga0207702_10311792 | 3300026078 | Bacteria | 1496 |
| 190 | Ga0207641_10467420 | 3300026088 | Bacteria | 1221 |
| 191 | Ga0207648_10058467 | 3300026089 | Bacteria | 3362 |
| 192 | Ga0207676_10098654 | 3300026095 | Bacteria | 2416 |
| 193 | Ga0207674_10002093 | 3300026116 | Bacteria | 25273 |
| 194 | Ga0207674_10056193 | 3300026116 | Bacteria | 3998 |
| 195 | Ga0207675_100104032 | 3300026118 | Bacteria | 2676 |
| 196 | Ga0207698_10275655 | 3300026142 | Bacteria | 1553 |
| 197 | Ga0209966_1031889 | 3300027695 | Bacteria | 1071 |
| 198 | Ga0207428_10321087 | 3300027907 | Bacteria | 1144 |
| 199 | Ga0268266_10087708 | 3300028379 | Bacteria | 2723 |
| 200 | Ga0265319_1037147 | 3300028563 | Unclassified | 1662 |
| 201 | Ga0265334_10008192 | 3300028573 | Bacteria | 4451 |
| 202 | Ga0265318_10003094 | 3300028577 | Bacteria | 8544 |
| 203 | Ga0265322_10064228 | 3300028654 | Bacteria | 1041 |
| 204 | Ga0265336_10005714 | 3300028666 | Bacteria | 4559 |
| 205 | Ga0265336_10057009 | 3300028666 | Bacteria | 1173 |
| 206 | Ga0265338_10002058 | 3300028800 | Bacteria | 31087 |
| 207 | Ga0265338_10010584 | 3300028800 | Bacteria | 10787 |
| 208 | Ga0265338_10038539 | 3300028800 | Bacteria | 4526 |
| 209 | Ga0265338_10054250 | 3300028800 | Bacteria | 3576 |
| 210 | Ga0265338_10075399 | 3300028800 | Bacteria | 2862 |
| 211 | Ga0265338_10100177 | 3300028800 | Bacteria | 2364 |
| 212 | Ga0265324_10011016 | 3300029957 | Bacteria | 3461 |
| 213 | Ga0265330_10009834 | 3300031235 | Bacteria | 4526 |
| 214 | Ga0265332_10018123 | 3300031238 | Bacteria | 3104 |
| 215 | Ga0265328_10005742 | 3300031239 | Bacteria | 5299 |
| 216 | Ga0265320_10010065 | 3300031240 | Bacteria | 5654 |
| 217 | Ga0265325_10018526 | 3300031241 | Bacteria | 3861 |
| 218 | Ga0265329_10040737 | 3300031242 | Bacteria | 1490 |
| 219 | Ga0265340_10013271 | 3300031247 | Bacteria | 4333 |
| 220 | Ga0265339_10005030 | 3300031249 | Bacteria | 8892 |
| 221 | Ga0265339_10050781 | 3300031249 | Bacteria | 2266 |
| 222 | Ga0265331_10029102 | 3300031250 | Bacteria | 2759 |
| 223 | Ga0265327_10010760 | 3300031251 | Bacteria | 6383 |
| 224 | Ga0265327_10073748 | 3300031251 | Bacteria | 1702 |
| 225 | Ga0265316_10056900 | 3300031344 | Bacteria | 3051 |
| 226 | Ga0265316_10231805 | 3300031344 | Bacteria | 1359 |
| 227 | Ga0307408_100046396 | 3300031548 | Bacteria | 3108 |
| 228 | Ga0307408_100264188 | 3300031548 | Bacteria | 1426 |
| 229 | Ga0265313_10007875 | 3300031595 | Bacteria | 7181 |
| 230 | Ga0265314_10057907 | 3300031711 | Bacteria | 2657 |
| 231 | Ga0265342_10043364 | 3300031712 | Bacteria | 2715 |
| 232 | Ga0307405_10064978 | 3300031731 | Bacteria | 2321 |
| 233 | Ga0307413_10009249 | 3300031824 | Bacteria | 4707 |
| 234 | Ga0307406_10036628 | 3300031901 | Bacteria | 3024 |
| 235 | Ga0307406_10172265 | 3300031901 | Bacteria | 1567 |
| 236 | Ga0307412_10426189 | 3300031911 | Bacteria | 1086 |
| 237 | Ga0307409_100014786 | 3300031995 | Bacteria | 5092 |
| 238 | Ga0307409_100061345 | 3300031995 | Bacteria | 2938 |
| 239 | Ga0307416_100006529 | 3300032002 | Bacteria | 7309 |
| 240 | Ga0307416_100028486 | 3300032002 | Bacteria | 4154 |
| 241 | Ga0307415_100000048 | 3300032126 | Bacteria | 51694 |
| 242 | Ga0373945_0028235 | 3300035116 | Bacteria | 1965 |
| 243 | Ga0373954_0231701 | 3300035118 | Bacteria | 909 |
| 244 | Ga0373924_0101734 | 3300035410 | Unclassified | 1237 |
| 245 | Ga0373924_0132437 | 3300035410 | Bacteria | 1085 |
| 246 | Ga0373931_0053043 | 3300035691 | Bacteria | 2163 |
| 247 | Ga0373933_0056907 | 3300035724 | Bacteria | 2349 |
| 248 | Ga0373947_0019368 | 3300035725 | Bacteria | 3923 |
| 249 | Ga0373947_0190801 | 3300035725 | Bacteria | 1337 |
| 250 | Ga0373937_0079431 | 3300036401 | Bacteria | 3032 |
| 251 | Ga0373925_0006971 | 3300037068 | Bacteria | 8263 |
| 252 | Ga0395899_0001267 | 3300037312 | Bacteria | 21969 |
| 253 | Ga0395899_0009229 | 3300037312 | Bacteria | 7574 |
| 254 | Ga0395899_0010571 | 3300037312 | Bacteria | 7072 |
| 255 | Ga0395899_0030617 | 3300037312 | Bacteria | 4046 |
| 256 | Ga0395900_0003489 | 3300037418 | Bacteria | 16973 |
| 257 | Ga0395900_0069134 | 3300037418 | Bacteria | 3629 |
| 258 | Ga0395900_0603820 | 3300037418 | Bacteria | 1038 |
| 259 | Ga0395898_0001276 | 3300037466 | Bacteria | 37111 |
| 260 | Ga0395898_0021663 | 3300037466 | Bacteria | 6515 |
| 261 | Ga0395898_0027338 | 3300037466 | Bacteria | 5729 |
| 262 | Ga0395898_0046859 | 3300037466 | Bacteria | 4245 |
| 263 | Ga0395898_0049132 | 3300037466 | Bacteria | 4134 |
| 264 | Ga0395898_0093913 | 3300037466 | Bacteria | 2882 |
| 265 | Ga0395898_0216660 | 3300037466 | Bacteria | 1826 |
| 266 | Ga0395905_0001281 | 3300037471 | Bacteria | 31019 |
| 267 | Ga0395905_0007609 | 3300037471 | Bacteria | 10755 |
| 268 | Ga0395905_0068364 | 3300037471 | Bacteria | 3327 |
| 269 | Ga0395905_0194406 | 3300037471 | Bacteria | 1902 |
| 270 | Ga0395905_0413997 | 3300037471 | Bacteria | 1243 |
| 271 | Ga0395901_0001957 | 3300038443 | Bacteria | 21190 |
| 272 | Ga0395901_0015037 | 3300038443 | Bacteria | 7869 |
| 273 | Ga0395901_0165042 | 3300038443 | Bacteria | 2325 |
| 274 | Ga0395901_0326565 | 3300038443 | Bacteria | 1587 |
| 275 | Ga0395901_0504816 | 3300038443 | Bacteria | 1231 |
| 276 | Ga0395901_0521359 | 3300038443 | Bacteria | 1207 |
| 277 | Ga0395901_0523228 | 3300038443 | Bacteria | 1205 |
| 278 | Ga0395901_0542643 | 3300038443 | Bacteria | 1179 |
| 279 | Ga0395901_0716263 | 3300038443 | Bacteria | 997 |
| 280 | Ga0436360_0978461 | 3300039438 | Bacteria | 1461 |
| 281 | Ga0436360_0996113 | 3300039438 | Unclassified | 1159 |
| 282 | Ga0436362_1158851 | 3300039453 | Bacteria | 2629 |
| 283 | Ga0439448_0014033 | 3300042005 | Bacteria | 2414 |
| 284 | Ga0466969_0106550 | 3300044656 | Bacteria | 1315 |
| 285 | Ga0466965_0126173 | 3300044683 | Bacteria | 1324 |
| 286 | Ga0466966_0013353 | 3300044684 | Bacteria | 5436 |
| 287 | Ga0466966_0022136 | 3300044684 | Bacteria | 4173 |
| 288 | Ga0466966_0120984 | 3300044684 | Bacteria | 1608 |
| 289 | Ga0466966_0168292 | 3300044684 | Bacteria | 1332 |
| 290 | Ga0466961_0002717 | 3300044693 | Bacteria | 11002 |
| 291 | Ga0466961_0029139 | 3300044693 | Bacteria | 3549 |
| 292 | Ga0466961_0053667 | 3300044693 | Bacteria | 2571 |
| 293 | Ga0466961_0106621 | 3300044693 | Bacteria | 1764 |
| 294 | Ga0466961_0176426 | 3300044693 | Bacteria | 1327 |
| 295 | Ga0466963_0000885 | 3300044694 | Bacteria | 15225 |
| 296 | Ga0466963_0002401 | 3300044694 | Bacteria | 10473 |
| 297 | Ga0466963_0003553 | 3300044694 | Bacteria | 8953 |
| 298 | Ga0466963_0004822 | 3300044694 | Bacteria | 7865 |
| 299 | Ga0466963_0006281 | 3300044694 | Bacteria | 7025 |
| 300 | Ga0466963_0012943 | 3300044694 | Bacteria | 5114 |
| 301 | Ga0466963_0015139 | 3300044694 | Bacteria | 4769 |
| 302 | Ga0466963_0016858 | 3300044694 | Bacteria | 4548 |
| 303 | Ga0466963_0016894 | 3300044694 | Bacteria | 4545 |
| 304 | Ga0466963_0041545 | 3300044694 | Bacteria | 3016 |
| 305 | Ga0466963_0041824 | 3300044694 | Bacteria | 3006 |
| 306 | Ga0466963_0057670 | 3300044694 | Bacteria | 2586 |
| 307 | Ga0466963_0299763 | 3300044694 | Bacteria | 1130 |
| 308 | Ga0466963_0322374 | 3300044694 | Bacteria | 1087 |
| 309 | Ga0466963_0494796 | 3300044694 | Bacteria | 863 |
| 310 | Ga0466964_0000825 | 3300044706 | Bacteria | 10136 |
| 311 | Ga0466964_0002060 | 3300044706 | Bacteria | 7074 |
| 312 | Ga0466964_0005941 | 3300044706 | Bacteria | 4546 |
| 313 | Ga0466964_0008596 | 3300044706 | Bacteria | 3838 |
| 314 | Ga0466964_0010551 | 3300044706 | Bacteria | 3485 |
| 315 | Ga0466964_0051019 | 3300044706 | Bacteria | 1698 |
| 316 | Ga0466964_0053541 | 3300044706 | Bacteria | 1661 |
| 317 | Ga0466964_0079453 | 3300044706 | Bacteria | 1405 |
| 318 | Ga0466971_0003087 | 3300044719 | Bacteria | 7079 |
| 319 | Ga0466971_0003696 | 3300044719 | Bacteria | 6541 |
| 320 | Ga0466971_0020157 | 3300044719 | Bacteria | 2964 |
| 321 | Ga0466971_0023628 | 3300044719 | Bacteria | 2741 |
| 322 | Ga0466971_0039125 | 3300044719 | Bacteria | 2129 |
| 323 | Ga0466971_0052851 | 3300044719 | Bacteria | 1830 |
| 324 | Ga0466971_0096371 | 3300044719 | Bacteria | 1357 |
| 325 | Ga0466968_0007081 | 3300044735 | Bacteria | 4253 |
| 326 | Ga0466968_0018370 | 3300044735 | Bacteria | 2804 |
| 327 | Ga0466968_0039965 | 3300044735 | Bacteria | 1976 |
| 328 | Ga0466957_0007928 | 3300044842 | Bacteria | 6024 |
| 329 | Ga0466957_0008096 | 3300044842 | Bacteria | 5964 |
| 330 | Ga0466957_0011854 | 3300044842 | Bacteria | 5038 |
| 331 | Ga0466957_0012738 | 3300044842 | Bacteria | 4873 |
| 332 | Ga0466957_0079534 | 3300044842 | Bacteria | 2040 |
| 333 | Ga0466957_0330875 | 3300044842 | Unclassified | 1030 |
| 334 | Ga0466957_0367418 | 3300044842 | Unclassified | 979 |
| 335 | Ga0466960_0008413 | 3300044901 | Bacteria | 4225 |
| 336 | Ga0466959_0004417 | 3300045049 | Bacteria | 9414 |
| 337 | Ga0466959_0005574 | 3300045049 | Bacteria | 8647 |
| 338 | Ga0466959_0015076 | 3300045049 | Bacteria | 5630 |
| 339 | Ga0466959_0108779 | 3300045049 | Bacteria | 1980 |
| 340 | Ga0466959_0267947 | 3300045049 | Bacteria | 1174 |
| 341 | Ga0451576_0122609 | 3300045051 | Bacteria | 2706 |
| 342 | Ga0466958_0000921 | 3300045836 | Bacteria | 13229 |
| 343 | Ga0466958_0001307 | 3300045836 | Bacteria | 11730 |
| 344 | Ga0466958_0004001 | 3300045836 | Bacteria | 7727 |
| 345 | Ga0466958_0013947 | 3300045836 | Bacteria | 4582 |
| 346 | Ga0466958_0027857 | 3300045836 | Bacteria | 3345 |
| 347 | Ga0466958_0032616 | 3300045836 | Bacteria | 3099 |
| 348 | Ga0466958_0036282 | 3300045836 | Bacteria | 2950 |
| 349 | Ga0466958_0053833 | 3300045836 | Bacteria | 2440 |
| 350 | Ga0466958_0113817 | 3300045836 | Bacteria | 1690 |
| 351 | Ga0466967_0000305 | 3300045976 | Bacteria | 22092 |
| 352 | Ga0466967_0004124 | 3300045976 | Bacteria | 9710 |
| 353 | Ga0466967_0004340 | 3300045976 | Bacteria | 9538 |
| 354 | Ga0466967_0004811 | 3300045976 | Bacteria | 9203 |
| 355 | Ga0466967_0006003 | 3300045976 | Bacteria | 8532 |
| 356 | Ga0466967_0008963 | 3300045976 | Bacteria | 7388 |
| 357 | Ga0466967_0014089 | 3300045976 | Bacteria | 6212 |
| 358 | Ga0466967_0018327 | 3300045976 | Bacteria | 5591 |
| 359 | Ga0466967_0021073 | 3300045976 | Bacteria | 5282 |
| 360 | Ga0466967_0040972 | 3300045976 | Bacteria | 3989 |
| 361 | Ga0466967_0081776 | 3300045976 | Bacteria | 2918 |
| 362 | Ga0466967_0109183 | 3300045976 | Bacteria | 2540 |
| 363 | Ga0466967_0116726 | 3300045976 | Bacteria | 2459 |
| 364 | Ga0466967_0136807 | 3300045976 | Bacteria | 2279 |
| 365 | Ga0466967_0157099 | 3300045976 | Bacteria | 2131 |
| 366 | Ga0466967_0166704 | 3300045976 | Bacteria | 2070 |
| 367 | Ga0466967_0177617 | 3300045976 | Bacteria | 2006 |
| 368 | Ga0466967_0192283 | 3300045976 | Bacteria | 1929 |
| 369 | Ga0466967_0201341 | 3300045976 | Bacteria | 1886 |
| 370 | Ga0466967_0281269 | 3300045976 | Bacteria | 1596 |
| 371 | Ga0466967_0388324 | 3300045976 | Bacteria | 1356 |
| 372 | Ga0466967_0670408 | 3300045976 | Bacteria | 1026 |
| 373 | Ga0495617_062445 | 3300046452 | Bacteria | 1231 |
| 374 | Ga0495592_0000100 | 3300046454 | Bacteria | 76535 |
| 375 | Ga0495592_0017698 | 3300046454 | Bacteria | 5414 |
| 376 | Ga0495592_0018729 | 3300046454 | Bacteria | 5269 |
| 377 | Ga0495592_0170180 | 3300046454 | Bacteria | 1492 |
| 378 | Ga0495603_0008836 | 3300046455 | Bacteria | 6090 |
| 379 | Ga0495603_0145107 | 3300046455 | Bacteria | 1380 |
| 380 | Ga0495603_0294702 | 3300046455 | Bacteria | 932 |
| 381 | Ga0495629_0005062 | 3300046459 | Bacteria | 9864 |
| 382 | Ga0495629_0029070 | 3300046459 | Bacteria | 3922 |
| 383 | Ga0495629_0055500 | 3300046459 | Bacteria | 2770 |
| 384 | Ga0495629_0126534 | 3300046459 | Bacteria | 1780 |
| 385 | Ga0495641_0005502 | 3300046461 | Bacteria | 8524 |
| 386 | Ga0495641_0027909 | 3300046461 | Bacteria | 2737 |
| 387 | Ga0495641_0030160 | 3300046461 | Bacteria | 2604 |
| 388 | Ga0495641_0069780 | 3300046461 | Bacteria | 1579 |
| 389 | Ga0495641_0077294 | 3300046461 | Bacteria | 1492 |
| 390 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 391 | Ga0495651_0011313 | 3300046462 | Bacteria | 6858 |
| 392 | Ga0495651_0051621 | 3300046462 | Bacteria | 3169 |
| 393 | Ga0495651_0098477 | 3300046462 | Bacteria | 2182 |
| 394 | Ga0495651_0108425 | 3300046462 | Bacteria | 2057 |
| 395 | Ga0495653_0000519 | 3300046463 | Bacteria | 29635 |
| 396 | Ga0495653_0017412 | 3300046463 | Bacteria | 5845 |
| 397 | Ga0495653_0051140 | 3300046463 | Bacteria | 3174 |
| 398 | Ga0495653_0051798 | 3300046463 | Bacteria | 3149 |
| 399 | Ga0495580_0195492 | 3300046472 | Bacteria | 1394 |
| 400 | Ga0495582_0041484 | 3300046473 | Bacteria | 2535 |
| 401 | Ga0495582_0053447 | 3300046473 | Bacteria | 2228 |
| 402 | Ga0495639_0003153 | 3300046475 | Bacteria | 7163 |
| 403 | Ga0495662_0012890 | 3300046476 | Bacteria | 4072 |
| 404 | Ga0495662_0038565 | 3300046476 | Bacteria | 2309 |
| 405 | Ga0495664_0030004 | 3300046477 | Bacteria | 3183 |
| 406 | Ga0495664_0052144 | 3300046477 | Bacteria | 2430 |
| 407 | Ga0495664_0235925 | 3300046477 | Bacteria | 1106 |
| 408 | Ga0495594_0149967 | 3300046499 | Bacteria | 1324 |
| 409 | Ga0495594_0256619 | 3300046499 | Bacteria | 996 |
| 410 | Ga0495607_0043367 | 3300046501 | Bacteria | 2660 |
| 411 | Ga0495608_0002853 | 3300046511 | Bacteria | 12379 |
| 412 | Ga0495608_0025390 | 3300046511 | Bacteria | 4045 |
| 413 | Ga0495608_0077922 | 3300046511 | Bacteria | 2157 |
| 414 | Ga0495616_0066386 | 3300046513 | Bacteria | 1755 |
| 415 | Ga0495618_0008107 | 3300046514 | Bacteria | 6362 |
| 416 | Ga0495618_0136278 | 3300046514 | Bacteria | 1570 |
| 417 | Ga0495628_0001255 | 3300046516 | Bacteria | 23210 |
| 418 | Ga0495628_0037095 | 3300046516 | Bacteria | 3908 |
| 419 | Ga0495628_0061568 | 3300046516 | Bacteria | 2943 |
| 420 | Ga0495628_0112492 | 3300046516 | Bacteria | 2093 |
| 421 | Ga0495630_0004222 | 3300046517 | Bacteria | 10066 |
| 422 | Ga0495630_0106281 | 3300046517 | Bacteria | 2125 |
| 423 | Ga0495630_0242954 | 3300046517 | Bacteria | 1375 |
| 424 | Ga0495630_0267466 | 3300046517 | Bacteria | 1306 |
| 425 | Ga0495637_0100543 | 3300046520 | Bacteria | 1130 |
| 426 | Ga0495666_0008985 | 3300046526 | Bacteria | 4998 |
| 427 | Ga0495666_0048603 | 3300046526 | Bacteria | 2043 |
| 428 | Ga0495652_0000888 | 3300046529 | Bacteria | 34393 |
| 429 | Ga0495652_0023777 | 3300046529 | Bacteria | 5430 |
| 430 | Ga0495652_0077879 | 3300046529 | Bacteria | 2746 |
| 431 | Ga0495652_0145473 | 3300046529 | Bacteria | 1858 |
| 432 | Ga0495652_0228700 | 3300046529 | Bacteria | 1393 |
| 433 | Ga0495652_0390283 | 3300046529 | Bacteria | 988 |
| 434 | Ga0495665_0024266 | 3300046531 | Bacteria | 3257 |
| 435 | Ga0495640_0023163 | 3300046533 | Bacteria | 4532 |
| 436 | Ga0495640_0049832 | 3300046533 | Bacteria | 2886 |
| 437 | Ga0495640_0180425 | 3300046533 | Bacteria | 1346 |
| 438 | Ga0495640_0206417 | 3300046533 | Bacteria | 1243 |
| 439 | Ga0495640_0466177 | 3300046533 | Bacteria | 770 |
| 440 | Ga0495586_0029182 | 3300046535 | Bacteria | 2952 |
| 441 | Ga0495586_0083485 | 3300046535 | Bacteria | 1758 |
| 442 | Ga0495587_0000048 | 3300046536 | Bacteria | 105358 |
| 443 | Ga0495587_0015646 | 3300046536 | Bacteria | 4732 |
| 444 | Ga0495587_0073265 | 3300046536 | Bacteria | 1990 |
| 445 | Ga0495621_0010505 | 3300046539 | Bacteria | 2835 |
| 446 | Ga0495645_0000029 | 3300046543 | Bacteria | 113119 |
| 447 | Ga0495667_0045237 | 3300046559 | Bacteria | 2915 |
| 448 | Ga0495667_0199571 | 3300046559 | Bacteria | 1281 |
| 449 | Ga0495656_0196317 | 3300046615 | Bacteria | 999 |
| 450 | Ga0495634_0038422 | 3300046642 | Bacteria | 3264 |
| 451 | Ga0495634_0052476 | 3300046642 | Bacteria | 2733 |
| 452 | Ga0495634_0070558 | 3300046642 | Bacteria | 2302 |
| 453 | Ga0495635_0085222 | 3300046663 | Bacteria | 2161 |
| 454 | Ga0495635_0227649 | 3300046663 | Bacteria | 1260 |
| 455 | Ga0495635_0368112 | 3300046663 | Unclassified | 957 |
| 456 | Ga0495659_0051673 | 3300046664 | Bacteria | 1497 |
| 457 | Ga0495661_0199409 | 3300046665 | Bacteria | 1049 |
| 458 | Ga0495657_0021277 | 3300046675 | Bacteria | 4655 |
| 459 | Ga0495657_0030470 | 3300046675 | Bacteria | 3778 |
| 460 | Ga0495599_0000181 | 3300046678 | Bacteria | 41303 |
| 461 | Ga0495599_0067613 | 3300046678 | Bacteria | 2231 |
| 462 | Ga0495599_0248550 | 3300046678 | Bacteria | 1083 |
| 463 | Ga0495623_0000093 | 3300046679 | Bacteria | 53441 |
| 464 | Ga0495646_0000416 | 3300046680 | Bacteria | 22540 |
| 465 | Ga0495646_0028309 | 3300046680 | Bacteria | 3510 |
| 466 | Ga0495647_0001300 | 3300046681 | Bacteria | 7679 |
| 467 | Ga0495647_0020209 | 3300046681 | Bacteria | 2388 |
| 468 | Ga0495647_0033737 | 3300046681 | Bacteria | 1914 |
| 469 | Ga0495658_0001970 | 3300046683 | Bacteria | 10482 |
| 470 | Ga0495658_0201661 | 3300046683 | Bacteria | 1240 |
| 471 | Ga0495658_0206876 | 3300046683 | Bacteria | 1225 |
| 472 | Ga0495613_0014418 | 3300046689 | Bacteria | 5867 |
| 473 | Ga0495613_0047036 | 3300046689 | Bacteria | 3187 |
| 474 | Ga0495613_0085226 | 3300046689 | Bacteria | 2293 |
| 475 | Ga0495613_0171918 | 3300046689 | Bacteria | 1537 |
| 476 | Ga0495613_0264661 | 3300046689 | Bacteria | 1197 |
| 477 | Ga0495624_0014510 | 3300046690 | Bacteria | 5345 |
| 478 | Ga0495671_0053023 | 3300046692 | Bacteria | 2014 |
| 479 | Ga0495649_0187671 | 3300046694 | Bacteria | 1077 |
| 480 | Ga0495600_0015460 | 3300046809 | Bacteria | 4824 |
| 481 | Ga0495600_0105289 | 3300046809 | Bacteria | 1838 |
| 482 | Ga0495600_0214565 | 3300046809 | Bacteria | 1232 |
| 483 | Ga0495600_0398322 | 3300046809 | Bacteria | 857 |
| 484 | Ga0495581_0019626 | 3300047315 | Bacteria | 3923 |
| 485 | Ga0495604_0000111 | 3300047317 | Bacteria | 68576 |
| 486 | Ga0495604_0048288 | 3300047317 | Bacteria | 3311 |
| 487 | Ga0495674_0001135 | 3300047319 | Bacteria | 25640 |
| 488 | Ga0495674_0038310 | 3300047319 | Bacteria | 4304 |
| 489 | Ga0495674_0054134 | 3300047319 | Bacteria | 3525 |
| 490 | Ga0495674_0346472 | 3300047319 | Bacteria | 1206 |
| 491 | Ga0495676_0145078 | 3300047321 | Bacteria | 1696 |
| 492 | Ga0495676_0423062 | 3300047321 | Bacteria | 881 |
| 493 | Ga0495680_0004067 | 3300047322 | Bacteria | 14091 |
| 494 | Ga0495680_0013832 | 3300047322 | Bacteria | 7021 |
| 495 | Ga0495680_0014786 | 3300047322 | Bacteria | 6747 |
| 496 | Ga0495680_0035276 | 3300047322 | Bacteria | 4030 |
| 497 | Ga0495680_0102533 | 3300047322 | Bacteria | 2130 |
| 498 | Ga0495680_0323500 | 3300047322 | Unclassified | 1079 |
| 499 | Ga0495675_0000376 | 3300047444 | Bacteria | 30923 |
| 500 | Ga0495675_0218968 | 3300047444 | Bacteria | 1153 |
| 501 | Ga0495677_0082603 | 3300047445 | Unclassified | 1205 |
| 502 | Ga0495679_028633 | 3300047446 | Bacteria | 1826 |
| 503 | Ga0495681_0089023 | 3300047470 | Bacteria | 1366 |
| 504 | Ga0495684_0074669 | 3300047471 | Bacteria | 2576 |
| 505 | Ga0495684_0079530 | 3300047471 | Bacteria | 2489 |
| 506 | Ga0495684_0100983 | 3300047471 | Bacteria | 2181 |
| 507 | Ga0495684_0165161 | 3300047471 | Bacteria | 1649 |
| 508 | Ga0495684_0224606 | 3300047471 | Bacteria | 1375 |
| 509 | Ga0495593_0017423 | 3300047673 | Bacteria | 4043 |
| 510 | Ga0495602_0000141 | 3300048088 | Bacteria | 67940 |
| 511 | Ga0495602_0006548 | 3300048088 | Bacteria | 12215 |
| 512 | Ga0495602_0163369 | 3300048088 | Bacteria | 1736 |
| 513 | Ga0495602_0234079 | 3300048088 | Bacteria | 1378 |
| 514 | Ga0495602_0330272 | 3300048088 | Bacteria | 1106 |
| 515 | Ga0495614_0006610 | 3300048089 | Bacteria | 5191 |
| 516 | Ga0496100_0011703 | 3300048903 | Bacteria | 5001 |
| 517 | Ga0496101_0009494 | 3300048904 | Bacteria | 6395 |
| 518 | Ga0496101_0209701 | 3300048904 | Bacteria | 1509 |
| 519 | Ga0496102_0010283 | 3300048905 | Bacteria | 8045 |
| 520 | Ga0496102_0052433 | 3300048905 | Bacteria | 3717 |
| 521 | Ga0496102_0098707 | 3300048905 | Bacteria | 2710 |
| 522 | Ga0496103_0242629 | 3300048906 | Unclassified | 1159 |
| 523 | Ga0496104_0033091 | 3300048907 | Bacteria | 4812 |
| 524 | Ga0496104_0169746 | 3300048907 | Bacteria | 2092 |
| 525 | Ga0496104_0194645 | 3300048907 | Bacteria | 1939 |
| 526 | Ga0496104_0423891 | 3300048907 | Bacteria | 1242 |
| 527 | Ga0496104_0657728 | 3300048907 | Bacteria | 957 |
| 528 | Ga0496104_0918498 | 3300048907 | Bacteria | 780 |
| 529 | Ga0496105_0003059 | 3300048908 | Bacteria | 12294 |
| 530 | Ga0496105_0101922 | 3300048908 | Bacteria | 2370 |
| 531 | Ga0496105_0215519 | 3300048908 | Bacteria | 1564 |
| 532 | Ga0496106_0011036 | 3300048909 | Bacteria | 6678 |
| 533 | Ga0496107_0007244 | 3300048910 | Bacteria | 7640 |
| 534 | Ga0496107_0009675 | 3300048910 | Bacteria | 6684 |
| 535 | Ga0496107_0067729 | 3300048910 | Bacteria | 2591 |
| 536 | Ga0496107_0200107 | 3300048910 | Unclassified | 1485 |
| 537 | Ga0496107_0396066 | 3300048910 | Bacteria | 1027 |
| 538 | Ga0496108_0010155 | 3300048911 | Bacteria | 7641 |
| 539 | Ga0496108_0014451 | 3300048911 | Bacteria | 6447 |
| 540 | Ga0496108_0016271 | 3300048911 | Bacteria | 6064 |
| 541 | Ga0496108_0084587 | 3300048911 | Bacteria | 2692 |
| 542 | Ga0496108_0090972 | 3300048911 | Bacteria | 2594 |
| 543 | Ga0496108_0549935 | 3300048911 | Unclassified | 1007 |
| 544 | Ga0496109_0000991 | 3300048912 | Bacteria | 23430 |
| 545 | Ga0496109_0023115 | 3300048912 | Bacteria | 5515 |
| 546 | Ga0496109_0186223 | 3300048912 | Bacteria | 1950 |
| 547 | Ga0496110_0001407 | 3300048913 | Bacteria | 17382 |
| 548 | Ga0496110_0067762 | 3300048913 | Bacteria | 3158 |
| 549 | Ga0496110_0092761 | 3300048913 | Bacteria | 2702 |
| 550 | Ga0496110_0150439 | 3300048913 | Bacteria | 2107 |
| 551 | Ga0496110_0274830 | 3300048913 | Unclassified | 1534 |
| 552 | Ga0496111_0000429 | 3300048914 | Bacteria | 21251 |
| 553 | Ga0496111_0066912 | 3300048914 | Bacteria | 2610 |
| 554 | Ga0496112_0031945 | 3300048915 | Bacteria | 5110 |
| 555 | Ga0496112_0036861 | 3300048915 | Bacteria | 4770 |
| 556 | Ga0496112_0051056 | 3300048915 | Bacteria | 4056 |
| 557 | Ga0496113_0038669 | 3300048916 | Bacteria | 3508 |
| 558 | Ga0496114_0001144 | 3300048917 | Bacteria | 20053 |
| 559 | Ga0496114_0014134 | 3300048917 | Bacteria | 6402 |
| 560 | Ga0496114_0014487 | 3300048917 | Bacteria | 6333 |
| 561 | Ga0496114_0120943 | 3300048917 | Bacteria | 2252 |
| 562 | Ga0496114_0216492 | 3300048917 | Bacteria | 1681 |
| 563 | Ga0496115_0007850 | 3300048918 | Bacteria | 7869 |
| 564 | Ga0496115_0036527 | 3300048918 | Bacteria | 3891 |
| 565 | Ga0496115_0112564 | 3300048918 | Bacteria | 2236 |
| 566 | Ga0501031_0264377 | 3300049568 | Bacteria | 1118 |
| 567 | Ga0501033_0266425 | 3300049570 | Bacteria | 1212 |
| 568 | Ga0501034_0045663 | 3300049571 | Bacteria | 4426 |
| 569 | Ga0501036_0007319 | 3300049572 | Bacteria | 8990 |
| 570 | Ga0501036_0138452 | 3300049572 | Bacteria | 2054 |
| 571 | Ga0501039_0411487 | 3300049575 | Bacteria | 1062 |
| 572 | Ga0501040_0050379 | 3300049576 | Bacteria | 2848 |
| 573 | Ga0501040_0175425 | 3300049576 | Bacteria | 1519 |
| 574 | Ga0501042_0003743 | 3300049578 | Bacteria | 9613 |
| 575 | Ga0501048_0004195 | 3300049582 | Bacteria | 10986 |
| 576 | Ga0501048_0071535 | 3300049582 | Bacteria | 2449 |
| 577 | Ga0501067_0007338 | 3300049583 | Bacteria | 6124 |
| 578 | Ga0501067_0039357 | 3300049583 | Bacteria | 2625 |
| 579 | Ga0501067_0194885 | 3300049583 | Bacteria | 1129 |
| 580 | Ga0501068_0007032 | 3300049584 | Bacteria | 6227 |
| 581 | Ga0501069_0034203 | 3300049585 | Bacteria | 2799 |
| 582 | Ga0501069_0041023 | 3300049585 | Bacteria | 2557 |
| 583 | Ga0501069_0118502 | 3300049585 | Bacteria | 1511 |
| 584 | Ga0501070_0008618 | 3300049586 | Bacteria | 8623 |
| 585 | Ga0501070_0022041 | 3300049586 | Bacteria | 5336 |
| 586 | Ga0501070_0334836 | 3300049586 | Bacteria | 1230 |
| 587 | Ga0501071_0015826 | 3300049587 | Bacteria | 5182 |
| 588 | Ga0501071_0114557 | 3300049587 | Bacteria | 1994 |
| 589 | Ga0501071_0130527 | 3300049587 | Bacteria | 1866 |
| 590 | Ga0501072_0036462 | 3300049588 | Bacteria | 3855 |
| 591 | Ga0501072_0112317 | 3300049588 | Bacteria | 2169 |
| 592 | Ga0501074_0081053 | 3300049590 | Bacteria | 2327 |
| 593 | Ga0501075_0019960 | 3300049591 | Bacteria | 4867 |
| 594 | Ga0501075_0273321 | 3300049591 | Bacteria | 1288 |
| 595 | Ga0501076_0005282 | 3300049592 | Bacteria | 9259 |
| 596 | Ga0501077_0141612 | 3300049593 | Bacteria | 1525 |
| 597 | Ga0501079_0105989 | 3300049741 | Bacteria | 2181 |
| 598 | Ga0501079_0213822 | 3300049741 | Bacteria | 1506 |
| 599 | Ga0501080_0013880 | 3300049742 | Bacteria | 7415 |
| 600 | Ga0501081_0005311 | 3300049743 | Bacteria | 8308 |
| 601 | Ga0501081_0041666 | 3300049743 | Bacteria | 3145 |
| 602 | Ga0501081_0173027 | 3300049743 | Bacteria | 1560 |
| 603 | Ga0501081_0236950 | 3300049743 | Bacteria | 1330 |
| 604 | Ga0501083_0000131 | 3300049744 | Bacteria | 51265 |
| 605 | Ga0501045_0002356 | 3300049824 | Bacteria | 12832 |
| 606 | Ga0501045_0028746 | 3300049824 | Bacteria | 4012 |
| 607 | Ga0501045_0310890 | 3300049824 | Bacteria | 1173 |
| 608 | nmdc:mga05p37_422341_c1 | 3300050507 | Bacteria | 1551 |
| 609 | nmdc:mga08y16_239391_c1 | 3300050511 | Bacteria | 1876 |
| 610 | nmdc:mga0n895_158846_c1 | 3300050512 | Bacteria | 2292 |
| 611 | nmdc:mga0n895_261218_c1 | 3300050512 | Bacteria | 1757 |
| 612 | nmdc:mga08x19_161148_c1 | 3300050514 | Bacteria | 1523 |
| 613 | nmdc:mga0a205_154640_c1 | 3300050515 | Bacteria | 2192 |
| 614 | Ga0495601_0000206 | 3300053077 | Bacteria | 31438 |
| 615 | Ga0495601_0032201 | 3300053077 | Bacteria | 3263 |
| 616 | Ga0495601_0127526 | 3300053077 | Bacteria | 1656 |
| 617 | Ga0495601_0281390 | 3300053077 | Bacteria | 1084 |
| 618 | Ga0495612_0018875 | 3300053078 | Bacteria | 2760 |
| 619 | Ga0495612_0060199 | 3300053078 | Bacteria | 1571 |
| 620 | Ga0495595_0005617 | 3300053084 | Bacteria | 5076 |
| 621 | Ga0495595_0101287 | 3300053084 | Bacteria | 1390 |
| 622 | Ga0495595_0143483 | 3300053084 | Unclassified | 1172 |
| 623 | Ga0495595_0274427 | 3300053084 | Bacteria | 846 |
| 624 | Ga0495619_0000291 | 3300053085 | Bacteria | 35704 |
| 625 | Ga0495619_0039474 | 3300053085 | Bacteria | 3082 |
| 626 | Ga0495619_0055761 | 3300053085 | Bacteria | 2618 |
| 627 | Ga0495619_0126975 | 3300053085 | Bacteria | 1751 |
| 628 | Ga0501084_0030386 | 3300054114 | Bacteria | 4518 |
| 629 | Ga0501084_0587171 | 3300054114 | Bacteria | 941 |
| 630 | Ga0466962_0010625 | 3300061719 | Bacteria | 4429 |
| 631 | Ga0466962_0018368 | 3300061719 | Bacteria | 3363 |
| 632 | Ga0466962_0100401 | 3300061719 | Bacteria | 1389 |
| 633 | Ga0466962_0112165 | 3300061719 | Bacteria | 1313 |
| 634 | Ga0466962_0139429 | 3300061719 | Unclassified | 1174 |
| 635 | Ga0530510_0004716 | 3300061734 | Bacteria | 9432 |
| 636 | Ga0530510_0085011 | 3300061734 | Bacteria | 2305 |
| 637 | Ga0530510_0098832 | 3300061734 | Bacteria | 2134 |
| 638 | Ga0530510_0105334 | 3300061734 | Bacteria | 2064 |
| 639 | Ga0530510_0194938 | 3300061734 | Bacteria | 1504 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053084 | Ga0495595_0274427 | Ga0495595_0274427_37_651 | 171 |
| 2 | 3300048088 | Ga0495602_0234079 | Ga0495602_0234079_449_1285 | 186 |
| 3 | 3300053077 | Ga0495601_0032201 | Ga0495601_0032201_1657_2493 | 186 |
| 4 | 3300028666 | Ga0265336_10005714 | Ga0265336_100057146 | 188 |
| 5 | 3300044684 | Ga0466966_0120984 | Ga0466966_0120984_304_1098 | 190 |
| 6 | 3300028800 | Ga0265338_10054250 | Ga0265338_100542501 | 193 |
| 7 | 3300044694 | Ga0466963_0494796 | Ga0466963_0494796_147_839 | 194 |
| 8 | 3300048918 | Ga0496115_0036527 | Ga0496115_0036527_2236_2922 | 195 |
| 9 | 3300028563 | Ga0265319_1037147 | Ga0265319_10371472 | 196 |
| 10 | 3300045049 | Ga0466959_0267947 | Ga0466959_0267947_217_1011 | 197 |
| 11 | 3300045836 | Ga0466958_0013947 | Ga0466958_0013947_2734_3528 | 197 |
| 12 | 3300038443 | Ga0395901_0504816 | Ga0395901_0504816_82_873 | 198 |
| 13 | 3300046455 | Ga0495603_0008836 | Ga0495603_0008836_2866_3669 | 198 |
| 14 | 3300046461 | Ga0495641_0030160 | Ga0495641_0030160_1339_2142 | 198 |
| 15 | 3300005435 | Ga0070714_100007459 | Ga0070714_1000074595 | 200 |
| 16 | 3300005436 | Ga0070713_100307065 | Ga0070713_1003070652 | 200 |
| 17 | 3300005337 | Ga0070682_100279765 | Ga0070682_1002797652 | 201 |
| 18 | 3300005434 | Ga0070709_10009642 | Ga0070709_100096426 | 201 |
| 19 | 3300005435 | Ga0070714_100117692 | Ga0070714_1001176922 | 201 |
| 20 | 3300005436 | Ga0070713_100018306 | Ga0070713_1000183065 | 201 |
| 21 | 3300005437 | Ga0070710_10000589 | Ga0070710_1000058922 | 201 |
| 22 | 3300005439 | Ga0070711_100006227 | Ga0070711_1000062272 | 201 |
| 23 | 3300005440 | Ga0070705_100184259 | Ga0070705_1001842592 | 201 |
| 24 | 3300006028 | Ga0070717_10013735 | Ga0070717_100137353 | 201 |
| 25 | 3300006163 | Ga0070715_10038666 | Ga0070715_100386662 | 201 |
| 26 | 3300006173 | Ga0070716_100007254 | Ga0070716_1000072546 | 201 |
| 27 | 3300009101 | Ga0105247_10196567 | Ga0105247_101965672 | 201 |
| 28 | 3300009174 | Ga0105241_10239060 | Ga0105241_102390602 | 201 |
| 29 | 3300013296 | Ga0157374_10011973 | Ga0157374_100119733 | 201 |
| 30 | 3300025898 | Ga0207692_10001763 | Ga0207692_100017631 | 201 |
| 31 | 3300025900 | Ga0207710_10115827 | Ga0207710_101158272 | 201 |
| 32 | 3300025905 | Ga0207685_10007005 | Ga0207685_100070053 | 201 |
| 33 | 3300025906 | Ga0207699_10007743 | Ga0207699_100077431 | 201 |
| 34 | 3300025911 | Ga0207654_10218272 | Ga0207654_102182722 | 201 |
| 35 | 3300025915 | Ga0207693_10000662 | Ga0207693_100006628 | 201 |
| 36 | 3300025916 | Ga0207663_10000565 | Ga0207663_1000056521 | 201 |
| 37 | 3300025928 | Ga0207700_10003047 | Ga0207700_1000304712 | 201 |
| 38 | 3300025929 | Ga0207664_10012742 | Ga0207664_100127422 | 201 |
| 39 | 3300025931 | Ga0207644_10582684 | Ga0207644_105826842 | 201 |
| 40 | 3300025939 | Ga0207665_10000060 | Ga0207665_1000006076 | 201 |
| 41 | 3300035691 | Ga0373931_0053043 | Ga0373931_0053043_1200_2003 | 201 |
| 42 | 3300044693 | Ga0466961_0029139 | Ga0466961_0029139_539_1342 | 201 |
| 43 | 3300044694 | Ga0466963_0012943 | Ga0466963_0012943_2944_3747 | 201 |
| 44 | 3300044719 | Ga0466971_0003087 | Ga0466971_0003087_1172_1975 | 201 |
| 45 | 3300044735 | Ga0466968_0018370 | Ga0466968_0018370_1642_2478 | 201 |
| 46 | 3300044842 | Ga0466957_0012738 | Ga0466957_0012738_2603_3406 | 201 |
| 47 | 3300045049 | Ga0466959_0108779 | Ga0466959_0108779_799_1602 | 201 |
| 48 | 3300048903 | Ga0496100_0011703 | Ga0496100_0011703_837_1640 | 201 |
| 49 | 3300048904 | Ga0496101_0009494 | Ga0496101_0009494_689_1492 | 201 |
| 50 | 3300048905 | Ga0496102_0010283 | Ga0496102_0010283_6113_6916 | 201 |
| 51 | 3300048907 | Ga0496104_0194645 | Ga0496104_0194645_864_1667 | 201 |
| 52 | 3300048907 | Ga0496104_0918498 | Ga0496104_0918498_48_761 | 201 |
| 53 | 3300048908 | Ga0496105_0101922 | Ga0496105_0101922_468_1271 | 201 |
| 54 | 3300048910 | Ga0496107_0007244 | Ga0496107_0007244_4553_5356 | 201 |
| 55 | 3300048911 | Ga0496108_0010155 | Ga0496108_0010155_6023_6826 | 201 |
| 56 | 3300048913 | Ga0496110_0092761 | Ga0496110_0092761_837_1640 | 201 |
| 57 | 3300048914 | Ga0496111_0066912 | Ga0496111_0066912_1458_2261 | 201 |
| 58 | 3300048915 | Ga0496112_0036861 | Ga0496112_0036861_3279_4082 | 201 |
| 59 | 3300048916 | Ga0496113_0038669 | Ga0496113_0038669_2433_3236 | 201 |
| 60 | 3300048917 | Ga0496114_0001144 | Ga0496114_0001144_6596_7399 | 201 |
| 61 | 3300048918 | Ga0496115_0007850 | Ga0496115_0007850_5704_6507 | 201 |
| 62 | 3300061719 | Ga0466962_0018368 | Ga0466962_0018368_199_1002 | 201 |
| 63 | 3300047321 | Ga0495676_0423062 | Ga0495676_0423062_24_731 | 202 |
| 64 | 3300013105 | Ga0157369_10004504 | Ga0157369_1000450420 | 204 |
| 65 | 3300025906 | Ga0207699_10220737 | Ga0207699_102207372 | 204 |
| 66 | 3300044656 | Ga0466969_0106550 | Ga0466969_0106550_116_919 | 204 |
| 67 | 3300044684 | Ga0466966_0013353 | Ga0466966_0013353_1942_2745 | 204 |
| 68 | 3300044693 | Ga0466961_0002717 | Ga0466961_0002717_8481_9284 | 204 |
| 69 | 3300045049 | Ga0466959_0015076 | Ga0466959_0015076_1972_2775 | 204 |
| 70 | 3300048915 | Ga0496112_0051056 | Ga0496112_0051056_881_1684 | 204 |
| 71 | 3300037312 | Ga0395899_0009229 | Ga0395899_0009229_4279_5118 | 205 |
| 72 | 3300037312 | Ga0395899_0010571 | Ga0395899_0010571_4579_5379 | 205 |
| 73 | 3300037418 | Ga0395900_0069134 | Ga0395900_0069134_2795_3595 | 205 |
| 74 | 3300037466 | Ga0395898_0027338 | Ga0395898_0027338_901_1701 | 205 |
| 75 | 3300037466 | Ga0395898_0049132 | Ga0395898_0049132_3027_3866 | 205 |
| 76 | 3300037471 | Ga0395905_0007609 | Ga0395905_0007609_8208_9047 | 205 |
| 77 | 3300037471 | Ga0395905_0068364 | Ga0395905_0068364_1206_2006 | 205 |
| 78 | 3300038443 | Ga0395901_0015037 | Ga0395901_0015037_962_1801 | 205 |
| 79 | 3300038443 | Ga0395901_0165042 | Ga0395901_0165042_320_1120 | 205 |
| 80 | 3300005329 | Ga0070683_100155595 | Ga0070683_1001555952 | 207 |
| 81 | 3300061734 | Ga0530510_0098832 | Ga0530510_0098832_567_1313 | 207 |
| 82 | 3300013105 | Ga0157369_10048846 | Ga0157369_100488463 | 208 |
| 83 | 3300049585 | Ga0501069_0034203 | Ga0501069_0034203_1865_2668 | 210 |
| 84 | 3300005985 | Ga0081539_10000041 | Ga0081539_1000004196 | 211 |
| 85 | 3300031548 | Ga0307408_100264188 | Ga0307408_1002641882 | 211 |
| 86 | 3300031824 | Ga0307413_10009249 | Ga0307413_100092495 | 211 |
| 87 | 3300031911 | Ga0307412_10426189 | Ga0307412_104261892 | 211 |
| 88 | 3300031995 | Ga0307409_100014786 | Ga0307409_1000147865 | 211 |
| 89 | 3300045049 | Ga0466959_0005574 | Ga0466959_0005574_4758_5582 | 211 |
| 90 | 3300046477 | Ga0495664_0235925 | Ga0495664_0235925_344_1087 | 211 |
| 91 | 3300046533 | Ga0495640_0466177 | Ga0495640_0466177_10_753 | 211 |
| 92 | 3300028573 | Ga0265334_10008192 | Ga0265334_100081924 | 212 |
| 93 | 3300028800 | Ga0265338_10002058 | Ga0265338_1000205833 | 212 |
| 94 | 3300031595 | Ga0265313_10007875 | Ga0265313_100078757 | 212 |
| 95 | 3300038443 | Ga0395901_0542643 | Ga0395901_0542643_65_865 | 212 |
| 96 | 3300044842 | Ga0466957_0011854 | Ga0466957_0011854_2018_2770 | 214 |
| 97 | 3300045976 | Ga0466967_0021073 | Ga0466967_0021073_3177_3929 | 214 |
| 98 | 3300048908 | Ga0496105_0215519 | Ga0496105_0215519_267_1070 | 215 |
| 99 | 3300048911 | Ga0496108_0084587 | Ga0496108_0084587_527_1330 | 215 |
| 100 | 3300048912 | Ga0496109_0186223 | Ga0496109_0186223_132_935 | 215 |
| 101 | 3300048913 | Ga0496110_0067762 | Ga0496110_0067762_1752_2555 | 215 |
| 102 | 3300048915 | Ga0496112_0031945 | Ga0496112_0031945_442_1245 | 215 |
| 103 | 3300048917 | Ga0496114_0120943 | Ga0496114_0120943_1248_2051 | 215 |
| 104 | 3300005459 | Ga0068867_100521232 | Ga0068867_1005212321 | 219 |
| 105 | 3300009098 | Ga0105245_10463867 | Ga0105245_104638671 | 219 |
| 106 | 3300010375 | Ga0105239_10920759 | Ga0105239_109207591 | 219 |
| 107 | 3300049583 | Ga0501067_0039357 | Ga0501067_0039357_807_1607 | 219 |
| 108 | 3300049584 | Ga0501068_0007032 | Ga0501068_0007032_5003_5803 | 219 |
| 109 | 3300049585 | Ga0501069_0041023 | Ga0501069_0041023_1070_1870 | 219 |
| 110 | 3300049586 | Ga0501070_0334836 | Ga0501070_0334836_203_1003 | 219 |
| 111 | 3300061734 | Ga0530510_0194938 | Ga0530510_0194938_130_930 | 219 |
| 112 | 3300047319 | Ga0495674_0054134 | Ga0495674_0054134_2733_3503 | 220 |
| 113 | 3300048905 | Ga0496102_0052433 | Ga0496102_0052433_59_862 | 220 |
| 114 | 3300048910 | Ga0496107_0009675 | Ga0496107_0009675_2930_3733 | 220 |
| 115 | 3300005458 | Ga0070681_10240090 | Ga0070681_102400902 | 221 |
| 116 | 3300005548 | Ga0070665_100070154 | Ga0070665_1000701542 | 221 |
| 117 | 3300009094 | Ga0111539_10068910 | Ga0111539_100689103 | 221 |
| 118 | 3300009147 | Ga0114129_10128447 | Ga0114129_101284472 | 221 |
| 119 | 3300028379 | Ga0268266_10087708 | Ga0268266_100877083 | 221 |
| 120 | 3300028800 | Ga0265338_10100177 | Ga0265338_101001772 | 221 |
| 121 | 3300048909 | Ga0496106_0011036 | Ga0496106_0011036_4707_5510 | 221 |
| 122 | 3300048913 | Ga0496110_0150439 | Ga0496110_0150439_355_1152 | 221 |
| 123 | 3300049572 | Ga0501036_0007319 | Ga0501036_0007319_7236_8036 | 221 |
| 124 | 3300049576 | Ga0501040_0050379 | Ga0501040_0050379_1405_2205 | 221 |
| 125 | 3300049578 | Ga0501042_0003743 | Ga0501042_0003743_1600_2400 | 221 |
| 126 | 3300049582 | Ga0501048_0004195 | Ga0501048_0004195_9606_10406 | 221 |
| 127 | 3300049587 | Ga0501071_0015826 | Ga0501071_0015826_4033_4833 | 221 |
| 128 | 3300049587 | Ga0501071_0130527 | Ga0501071_0130527_743_1543 | 221 |
| 129 | 3300049588 | Ga0501072_0112317 | Ga0501072_0112317_1337_2137 | 221 |
| 130 | 3300049590 | Ga0501074_0081053 | Ga0501074_0081053_1134_1934 | 221 |
| 131 | 3300049591 | Ga0501075_0019960 | Ga0501075_0019960_3478_4278 | 221 |
| 132 | 3300049592 | Ga0501076_0005282 | Ga0501076_0005282_103_903 | 221 |
| 133 | 3300049593 | Ga0501077_0141612 | Ga0501077_0141612_631_1431 | 221 |
| 134 | 3300049741 | Ga0501079_0105989 | Ga0501079_0105989_1282_2082 | 221 |
| 135 | 3300049743 | Ga0501081_0005311 | Ga0501081_0005311_241_1041 | 221 |
| 136 | 3300049743 | Ga0501081_0173027 | Ga0501081_0173027_549_1349 | 221 |
| 137 | 3300049824 | Ga0501045_0002356 | Ga0501045_0002356_3833_4633 | 221 |
| 138 | 3300054114 | Ga0501084_0030386 | Ga0501084_0030386_1936_2736 | 221 |
| 139 | 3300061734 | Ga0530510_0004716 | Ga0530510_0004716_1185_1985 | 221 |
| 140 | 3300045976 | Ga0466967_0136807 | Ga0466967_0136807_20_796 | 222 |
| 141 | 3300005330 | Ga0070690_100100853 | Ga0070690_1001008532 | 223 |
| 142 | 3300009093 | Ga0105240_10009653 | Ga0105240_100096532 | 223 |
| 143 | 3300048905 | Ga0496102_0098707 | Ga0496102_0098707_810_1589 | 223 |
| 144 | 3300048906 | Ga0496103_0242629 | Ga0496103_0242629_55_834 | 223 |
| 145 | 3300005468 | Ga0070707_100153336 | Ga0070707_1001533362 | 224 |
| 146 | 3300025922 | Ga0207646_10202568 | Ga0207646_102025682 | 224 |
| 147 | 3300044684 | Ga0466966_0168292 | Ga0466966_0168292_449_1252 | 224 |
| 148 | 3300044693 | Ga0466961_0176426 | Ga0466961_0176426_368_1171 | 224 |
| 149 | 3300044694 | Ga0466963_0299763 | Ga0466963_0299763_131_934 | 224 |
| 150 | 3300044719 | Ga0466971_0003696 | Ga0466971_0003696_4606_5409 | 224 |
| 151 | 3300044842 | Ga0466957_0079534 | Ga0466957_0079534_652_1455 | 224 |
| 152 | 3300045836 | Ga0466958_0004001 | Ga0466958_0004001_1826_2629 | 224 |
| 153 | 3300045836 | Ga0466958_0113817 | Ga0466958_0113817_212_994 | 224 |
| 154 | 3300046809 | Ga0495600_0214565 | Ga0495600_0214565_435_1217 | 224 |
| 155 | 3300061719 | Ga0466962_0100401 | Ga0466962_0100401_174_977 | 224 |
| 156 | 3300005327 | Ga0070658_10039243 | Ga0070658_100392432 | 225 |
| 157 | 3300009093 | Ga0105240_10703432 | Ga0105240_107034321 | 225 |
| 158 | 3300009551 | Ga0105238_10572521 | Ga0105238_105725212 | 225 |
| 159 | 3300013307 | Ga0157372_10181793 | Ga0157372_101817933 | 225 |
| 160 | 3300025909 | Ga0207705_10001180 | Ga0207705_100011802 | 225 |
| 161 | 3300025919 | Ga0207657_10048812 | Ga0207657_100488125 | 225 |
| 162 | 3300025944 | Ga0207661_10019738 | Ga0207661_100197386 | 225 |
| 163 | 3300028577 | Ga0265318_10003094 | Ga0265318_100030946 | 225 |
| 164 | 3300028654 | Ga0265322_10064228 | Ga0265322_100642282 | 225 |
| 165 | 3300031235 | Ga0265330_10009834 | Ga0265330_100098342 | 225 |
| 166 | 3300031238 | Ga0265332_10018123 | Ga0265332_100181232 | 225 |
| 167 | 3300031239 | Ga0265328_10005742 | Ga0265328_100057422 | 225 |
| 168 | 3300031240 | Ga0265320_10010065 | Ga0265320_100100656 | 225 |
| 169 | 3300031242 | Ga0265329_10040737 | Ga0265329_100407372 | 225 |
| 170 | 3300031247 | Ga0265340_10013271 | Ga0265340_100132713 | 225 |
| 171 | 3300031249 | Ga0265339_10050781 | Ga0265339_100507812 | 225 |
| 172 | 3300031251 | Ga0265327_10010760 | Ga0265327_100107606 | 225 |
| 173 | 3300031344 | Ga0265316_10231805 | Ga0265316_102318051 | 225 |
| 174 | 3300037312 | Ga0395899_0030617 | Ga0395899_0030617_1768_2571 | 225 |
| 175 | 3300037466 | Ga0395898_0093913 | Ga0395898_0093913_1226_2029 | 225 |
| 176 | 3300037471 | Ga0395905_0413997 | Ga0395905_0413997_354_1157 | 225 |
| 177 | 3300038443 | Ga0395901_0716263 | Ga0395901_0716263_61_864 | 225 |
| 178 | 3300049571 | Ga0501034_0045663 | Ga0501034_0045663_3509_4312 | 225 |
| 179 | 3300049586 | Ga0501070_0008618 | Ga0501070_0008618_1599_2402 | 225 |
| 180 | 3300049741 | Ga0501079_0213822 | Ga0501079_0213822_276_1079 | 225 |
| 181 | 3300049742 | Ga0501080_0013880 | Ga0501080_0013880_2485_3288 | 225 |
| 182 | 3300005467 | Ga0070706_100382290 | Ga0070706_1003822902 | 226 |
| 183 | 3300005471 | Ga0070698_100383323 | Ga0070698_1003833232 | 226 |
| 184 | 3300006871 | Ga0075434_100266280 | Ga0075434_1002662802 | 226 |
| 185 | 3300025909 | Ga0207705_10056857 | Ga0207705_100568571 | 226 |
| 186 | 3300049583 | Ga0501067_0194885 | Ga0501067_0194885_148_951 | 226 |
| 187 | 3300049586 | Ga0501070_0022041 | Ga0501070_0022041_2167_2970 | 226 |
| 188 | 3300049588 | Ga0501072_0036462 | Ga0501072_0036462_1984_2787 | 226 |
| 189 | 3300049744 | Ga0501083_0000131 | Ga0501083_0000131_13947_14750 | 226 |
| 190 | 3300050512 | nmdc:mga0n895_261218_c1 | nmdc:mga0n895_261218_c1_403_1242 | 226 |
| 191 | 3300054114 | Ga0501084_0587171 | Ga0501084_0587171_12_815 | 226 |
| 192 | 3300009551 | Ga0105238_10056734 | Ga0105238_100567344 | 227 |
| 193 | 3300013307 | Ga0157372_10888891 | Ga0157372_108888912 | 227 |
| 194 | 3300025919 | Ga0207657_10000739 | Ga0207657_1000073912 | 227 |
| 195 | 3300025932 | Ga0207690_10306303 | Ga0207690_103063032 | 227 |
| 196 | 3300045051 | Ga0451576_0122609 | Ga0451576_0122609_1293_2093 | 227 |
| 197 | 3300046501 | Ga0495607_0043367 | Ga0495607_0043367_166_966 | 227 |
| 198 | 3300046664 | Ga0495659_0051673 | Ga0495659_0051673_616_1416 | 227 |
| 199 | 3300049568 | Ga0501031_0264377 | Ga0501031_0264377_254_1042 | 227 |
| 200 | 3300049570 | Ga0501033_0266425 | Ga0501033_0266425_203_991 | 227 |
| 201 | 3300049572 | Ga0501036_0138452 | Ga0501036_0138452_49_837 | 227 |
| 202 | 3300049575 | Ga0501039_0411487 | Ga0501039_0411487_138_926 | 227 |
| 203 | 3300049576 | Ga0501040_0175425 | Ga0501040_0175425_145_933 | 227 |
| 204 | 3300049582 | Ga0501048_0071535 | Ga0501048_0071535_1348_2136 | 227 |
| 205 | 3300049587 | Ga0501071_0114557 | Ga0501071_0114557_352_1140 | 227 |
| 206 | 3300049743 | Ga0501081_0041666 | Ga0501081_0041666_638_1426 | 227 |
| 207 | 3300049824 | Ga0501045_0028746 | Ga0501045_0028746_230_1018 | 227 |
| 208 | 3300050507 | nmdc:mga05p37_422341_c1 | nmdc:mga05p37_422341_c1_610_1410 | 227 |
| 209 | 3300005937 | Ga0081455_10031319 | Ga0081455_100313194 | 228 |
| 210 | 3300042005 | Ga0439448_0014033 | Ga0439448_0014033_1413_2213 | 228 |
| 211 | 3300046452 | Ga0495617_062445 | Ga0495617_062445_271_1071 | 228 |
| 212 | 3300046513 | Ga0495616_0066386 | Ga0495616_0066386_67_867 | 228 |
| 213 | 3300046520 | Ga0495637_0100543 | Ga0495637_0100543_128_928 | 228 |
| 214 | 3300046539 | Ga0495621_0010505 | Ga0495621_0010505_1029_1829 | 228 |
| 215 | 3300046692 | Ga0495671_0053023 | Ga0495671_0053023_752_1552 | 228 |
| 216 | 3300046694 | Ga0495649_0187671 | Ga0495649_0187671_250_1050 | 228 |
| 217 | 3300047445 | Ga0495677_0082603 | Ga0495677_0082603_163_963 | 228 |
| 218 | 3300047446 | Ga0495679_028633 | Ga0495679_028633_86_886 | 228 |
| 219 | 3300047470 | Ga0495681_0089023 | Ga0495681_0089023_55_855 | 228 |
| 220 | 3300005981 | Ga0081538_10007438 | Ga0081538_100074389 | 229 |
| 221 | 3300005981 | Ga0081538_10035380 | Ga0081538_100353802 | 229 |
| 222 | 3300009094 | Ga0111539_10004030 | Ga0111539_100040308 | 229 |
| 223 | 3300009147 | Ga0114129_10062927 | Ga0114129_100629273 | 229 |
| 224 | 3300046689 | Ga0495613_0264661 | Ga0495613_0264661_310_1104 | 229 |
| 225 | 3300005329 | Ga0070683_100007546 | Ga0070683_10000754614 | 230 |
| 226 | 3300005336 | Ga0070680_100246477 | Ga0070680_1002464772 | 230 |
| 227 | 3300005338 | Ga0068868_100406575 | Ga0068868_1004065752 | 230 |
| 228 | 3300005341 | Ga0070691_10098492 | Ga0070691_100984922 | 230 |
| 229 | 3300005367 | Ga0070667_100033005 | Ga0070667_1000330052 | 230 |
| 230 | 3300005459 | Ga0068867_100239083 | Ga0068867_1002390832 | 230 |
| 231 | 3300005535 | Ga0070684_100036287 | Ga0070684_1000362874 | 230 |
| 232 | 3300005535 | Ga0070684_100280526 | Ga0070684_1002805262 | 230 |
| 233 | 3300005563 | Ga0068855_100199484 | Ga0068855_1001994842 | 230 |
| 234 | 3300005564 | Ga0070664_100063384 | Ga0070664_1000633842 | 230 |
| 235 | 3300005578 | Ga0068854_100333152 | Ga0068854_1003331522 | 230 |
| 236 | 3300005614 | Ga0068856_100493987 | Ga0068856_1004939871 | 230 |
| 237 | 3300005618 | Ga0068864_100792099 | Ga0068864_1007920991 | 230 |
| 238 | 3300010375 | Ga0105239_10157109 | Ga0105239_101571092 | 230 |
| 239 | 3300013105 | Ga0157369_10205378 | Ga0157369_102053782 | 230 |
| 240 | 3300013308 | Ga0157375_10310775 | Ga0157375_103107752 | 230 |
| 241 | 3300014968 | Ga0157379_10108207 | Ga0157379_101082073 | 230 |
| 242 | 3300021358 | Ga0213873_10039324 | Ga0213873_100393241 | 230 |
| 243 | 3300021441 | Ga0213871_10061727 | Ga0213871_100617272 | 230 |
| 244 | 3300025901 | Ga0207688_10139234 | Ga0207688_101392342 | 230 |
| 245 | 3300025919 | Ga0207657_10340144 | Ga0207657_103401442 | 230 |
| 246 | 3300025921 | Ga0207652_10480204 | Ga0207652_104802041 | 230 |
| 247 | 3300025933 | Ga0207706_10183969 | Ga0207706_101839691 | 230 |
| 248 | 3300025937 | Ga0207669_10194565 | Ga0207669_101945652 | 230 |
| 249 | 3300025942 | Ga0207689_10102116 | Ga0207689_101021163 | 230 |
| 250 | 3300025981 | Ga0207640_10428243 | Ga0207640_104282432 | 230 |
| 251 | 3300025986 | Ga0207658_10014892 | Ga0207658_100148923 | 230 |
| 252 | 3300026023 | Ga0207677_10224757 | Ga0207677_102247572 | 230 |
| 253 | 3300026116 | Ga0207674_10056193 | Ga0207674_100561934 | 230 |
| 254 | 3300028800 | Ga0265338_10075399 | Ga0265338_100753993 | 230 |
| 255 | 3300031731 | Ga0307405_10064978 | Ga0307405_100649782 | 230 |
| 256 | 3300037312 | Ga0395899_0001267 | Ga0395899_0001267_8120_8920 | 230 |
| 257 | 3300037418 | Ga0395900_0003489 | Ga0395900_0003489_13131_13931 | 230 |
| 258 | 3300037466 | Ga0395898_0001276 | Ga0395898_0001276_11449_12249 | 230 |
| 259 | 3300037471 | Ga0395905_0001281 | Ga0395905_0001281_13788_14588 | 230 |
| 260 | 3300038443 | Ga0395901_0001957 | Ga0395901_0001957_7960_8760 | 230 |
| 261 | 3300039438 | Ga0436360_0996113 | Ga0436360_0996113_292_1083 | 230 |
| 262 | 3300039453 | Ga0436362_1158851 | Ga0436362_1158851_1296_2087 | 230 |
| 263 | 3300044693 | Ga0466961_0106621 | Ga0466961_0106621_471_1265 | 230 |
| 264 | 3300044706 | Ga0466964_0002060 | Ga0466964_0002060_278_1081 | 230 |
| 265 | 3300044706 | Ga0466964_0053541 | Ga0466964_0053541_193_984 | 230 |
| 266 | 3300045976 | Ga0466967_0006003 | Ga0466967_0006003_5029_5832 | 230 |
| 267 | 3300045976 | Ga0466967_0192283 | Ga0466967_0192283_190_981 | 230 |
| 268 | 3300045976 | Ga0466967_0388324 | Ga0466967_0388324_133_930 | 230 |
| 269 | 3300046454 | Ga0495592_0170180 | Ga0495592_0170180_102_893 | 230 |
| 270 | 3300046459 | Ga0495629_0055500 | Ga0495629_0055500_1229_2020 | 230 |
| 271 | 3300046461 | Ga0495641_0077294 | Ga0495641_0077294_148_939 | 230 |
| 272 | 3300046462 | Ga0495651_0011313 | Ga0495651_0011313_1140_1931 | 230 |
| 273 | 3300046477 | Ga0495664_0052144 | Ga0495664_0052144_790_1581 | 230 |
| 274 | 3300046511 | Ga0495608_0077922 | Ga0495608_0077922_264_1055 | 230 |
| 275 | 3300046516 | Ga0495628_0061568 | Ga0495628_0061568_2020_2811 | 230 |
| 276 | 3300046517 | Ga0495630_0004222 | Ga0495630_0004222_3967_4758 | 230 |
| 277 | 3300046526 | Ga0495666_0048603 | Ga0495666_0048603_876_1667 | 230 |
| 278 | 3300046533 | Ga0495640_0023163 | Ga0495640_0023163_1032_1823 | 230 |
| 279 | 3300046642 | Ga0495634_0052476 | Ga0495634_0052476_532_1323 | 230 |
| 280 | 3300046678 | Ga0495599_0248550 | Ga0495599_0248550_193_984 | 230 |
| 281 | 3300046689 | Ga0495613_0014418 | Ga0495613_0014418_1542_2333 | 230 |
| 282 | 3300046809 | Ga0495600_0105289 | Ga0495600_0105289_894_1685 | 230 |
| 283 | 3300047319 | Ga0495674_0001135 | Ga0495674_0001135_19410_20201 | 230 |
| 284 | 3300047322 | Ga0495680_0004067 | Ga0495680_0004067_13222_14013 | 230 |
| 285 | 3300047471 | Ga0495684_0165161 | Ga0495684_0165161_672_1463 | 230 |
| 286 | 3300048088 | Ga0495602_0330272 | Ga0495602_0330272_173_964 | 230 |
| 287 | 3300048904 | Ga0496101_0209701 | Ga0496101_0209701_673_1476 | 230 |
| 288 | 3300048907 | Ga0496104_0169746 | Ga0496104_0169746_352_1149 | 230 |
| 289 | 3300048910 | Ga0496107_0067729 | Ga0496107_0067729_1062_1862 | 230 |
| 290 | 3300048911 | Ga0496108_0014451 | Ga0496108_0014451_245_1045 | 230 |
| 291 | 3300048911 | Ga0496108_0549935 | Ga0496108_0549935_129_932 | 230 |
| 292 | 3300048912 | Ga0496109_0000991 | Ga0496109_0000991_18289_19089 | 230 |
| 293 | 3300048913 | Ga0496110_0001407 | Ga0496110_0001407_6777_7577 | 230 |
| 294 | 3300048914 | Ga0496111_0000429 | Ga0496111_0000429_13468_14268 | 230 |
| 295 | 3300048918 | Ga0496115_0112564 | Ga0496115_0112564_473_1270 | 230 |
| 296 | 3300049591 | Ga0501075_0273321 | Ga0501075_0273321_179_976 | 230 |
| 297 | 3300053085 | Ga0495619_0126975 | Ga0495619_0126975_331_1122 | 230 |
| 298 | 3300061734 | Ga0530510_0105334 | Ga0530510_0105334_545_1384 | 230 |
| 299 | 3300005327 | Ga0070658_10014188 | Ga0070658_100141885 | 231 |
| 300 | 3300005329 | Ga0070683_100003014 | Ga0070683_10000301417 | 231 |
| 301 | 3300005334 | Ga0068869_100036551 | Ga0068869_1000365512 | 231 |
| 302 | 3300005336 | Ga0070680_100092377 | Ga0070680_1000923773 | 231 |
| 303 | 3300005339 | Ga0070660_100036788 | Ga0070660_1000367885 | 231 |
| 304 | 3300005344 | Ga0070661_100013123 | Ga0070661_1000131232 | 231 |
| 305 | 3300005435 | Ga0070714_100114075 | Ga0070714_1001140753 | 231 |
| 306 | 3300005435 | Ga0070714_100207512 | Ga0070714_1002075122 | 231 |
| 307 | 3300005435 | Ga0070714_100584308 | Ga0070714_1005843081 | 231 |
| 308 | 3300005437 | Ga0070710_10006973 | Ga0070710_100069736 | 231 |
| 309 | 3300005445 | Ga0070708_100650847 | Ga0070708_1006508472 | 231 |
| 310 | 3300005458 | Ga0070681_10011454 | Ga0070681_100114541 | 231 |
| 311 | 3300005458 | Ga0070681_10020004 | Ga0070681_100200044 | 231 |
| 312 | 3300005458 | Ga0070681_10034201 | Ga0070681_100342014 | 231 |
| 313 | 3300005468 | Ga0070707_100001400 | Ga0070707_10000140018 | 231 |
| 314 | 3300005468 | Ga0070707_100111218 | Ga0070707_1001112184 | 231 |
| 315 | 3300005471 | Ga0070698_100056389 | Ga0070698_1000563892 | 231 |
| 316 | 3300005530 | Ga0070679_100019792 | Ga0070679_1000197926 | 231 |
| 317 | 3300005530 | Ga0070679_100089465 | Ga0070679_1000894653 | 231 |
| 318 | 3300005530 | Ga0070679_100125102 | Ga0070679_1001251023 | 231 |
| 319 | 3300005535 | Ga0070684_100004862 | Ga0070684_1000048624 | 231 |
| 320 | 3300005535 | Ga0070684_100373638 | Ga0070684_1003736382 | 231 |
| 321 | 3300005545 | Ga0070695_100000062 | Ga0070695_10000006211 | 231 |
| 322 | 3300005563 | Ga0068855_100010562 | Ga0068855_10001056215 | 231 |
| 323 | 3300005614 | Ga0068856_100344313 | Ga0068856_1003443132 | 231 |
| 324 | 3300005618 | Ga0068864_100303387 | Ga0068864_1003033872 | 231 |
| 325 | 3300006028 | Ga0070717_10011348 | Ga0070717_100113485 | 231 |
| 326 | 3300006028 | Ga0070717_10020225 | Ga0070717_100202252 | 231 |
| 327 | 3300006028 | Ga0070717_10203831 | Ga0070717_102038312 | 231 |
| 328 | 3300006028 | Ga0070717_10217102 | Ga0070717_102171022 | 231 |
| 329 | 3300006173 | Ga0070716_100511198 | Ga0070716_1005111981 | 231 |
| 330 | 3300006871 | Ga0075434_100026447 | Ga0075434_1000264476 | 231 |
| 331 | 3300006881 | Ga0068865_100133230 | Ga0068865_1001332301 | 231 |
| 332 | 3300006914 | Ga0075436_100238901 | Ga0075436_1002389012 | 231 |
| 333 | 3300009093 | Ga0105240_10084757 | Ga0105240_100847572 | 231 |
| 334 | 3300009093 | Ga0105240_10292326 | Ga0105240_102923262 | 231 |
| 335 | 3300009176 | Ga0105242_10064870 | Ga0105242_100648704 | 231 |
| 336 | 3300009177 | Ga0105248_10274395 | Ga0105248_102743952 | 231 |
| 337 | 3300013100 | Ga0157373_10290288 | Ga0157373_102902882 | 231 |
| 338 | 3300013104 | Ga0157370_10012187 | Ga0157370_100121872 | 231 |
| 339 | 3300013104 | Ga0157370_10017960 | Ga0157370_100179606 | 231 |
| 340 | 3300013105 | Ga0157369_10001204 | Ga0157369_1000120436 | 231 |
| 341 | 3300013105 | Ga0157369_10065952 | Ga0157369_100659522 | 231 |
| 342 | 3300013306 | Ga0163162_10625241 | Ga0163162_106252412 | 231 |
| 343 | 3300013307 | Ga0157372_10237668 | Ga0157372_102376683 | 231 |
| 344 | 3300013307 | Ga0157372_10518430 | Ga0157372_105184302 | 231 |
| 345 | 3300014497 | Ga0182008_10003715 | Ga0182008_1000371510 | 231 |
| 346 | 3300014497 | Ga0182008_10050772 | Ga0182008_100507722 | 231 |
| 347 | 3300014969 | Ga0157376_10123649 | Ga0157376_101236493 | 231 |
| 348 | 3300015261 | Ga0182006_1012613 | Ga0182006_10126135 | 231 |
| 349 | 3300015262 | Ga0182007_10033923 | Ga0182007_100339232 | 231 |
| 350 | 3300020082 | Ga0206353_11182390 | Ga0206353_111823907 | 231 |
| 351 | 3300020082 | Ga0206353_12036014 | Ga0206353_120360142 | 231 |
| 352 | 3300025906 | Ga0207699_10025505 | Ga0207699_100255052 | 231 |
| 353 | 3300025912 | Ga0207707_10050785 | Ga0207707_100507854 | 231 |
| 354 | 3300025912 | Ga0207707_10155620 | Ga0207707_101556202 | 231 |
| 355 | 3300025912 | Ga0207707_10295655 | Ga0207707_102956552 | 231 |
| 356 | 3300025913 | Ga0207695_10016356 | Ga0207695_100163568 | 231 |
| 357 | 3300025913 | Ga0207695_10291866 | Ga0207695_102918661 | 231 |
| 358 | 3300025915 | Ga0207693_10194909 | Ga0207693_101949093 | 231 |
| 359 | 3300025917 | Ga0207660_10077639 | Ga0207660_100776392 | 231 |
| 360 | 3300025917 | Ga0207660_10156435 | Ga0207660_101564352 | 231 |
| 361 | 3300025919 | Ga0207657_10006735 | Ga0207657_100067356 | 231 |
| 362 | 3300025920 | Ga0207649_10049404 | Ga0207649_100494043 | 231 |
| 363 | 3300025920 | Ga0207649_10414348 | Ga0207649_104143482 | 231 |
| 364 | 3300025921 | Ga0207652_10059252 | Ga0207652_100592525 | 231 |
| 365 | 3300025921 | Ga0207652_10197161 | Ga0207652_101971612 | 231 |
| 366 | 3300025922 | Ga0207646_10002734 | Ga0207646_1000273425 | 231 |
| 367 | 3300025922 | Ga0207646_10365937 | Ga0207646_103659372 | 231 |
| 368 | 3300025928 | Ga0207700_10033252 | Ga0207700_100332523 | 231 |
| 369 | 3300025929 | Ga0207664_10033209 | Ga0207664_100332095 | 231 |
| 370 | 3300025929 | Ga0207664_10151520 | Ga0207664_101515203 | 231 |
| 371 | 3300025929 | Ga0207664_10337774 | Ga0207664_103377741 | 231 |
| 372 | 3300025944 | Ga0207661_10031672 | Ga0207661_100316727 | 231 |
| 373 | 3300025949 | Ga0207667_10334725 | Ga0207667_103347252 | 231 |
| 374 | 3300025981 | Ga0207640_10328518 | Ga0207640_103285182 | 231 |
| 375 | 3300026078 | Ga0207702_10311792 | Ga0207702_103117922 | 231 |
| 376 | 3300026088 | Ga0207641_10467420 | Ga0207641_104674202 | 231 |
| 377 | 3300026095 | Ga0207676_10098654 | Ga0207676_100986542 | 231 |
| 378 | 3300026142 | Ga0207698_10275655 | Ga0207698_102756552 | 231 |
| 379 | 3300027695 | Ga0209966_1031889 | Ga0209966_10318892 | 231 |
| 380 | 3300027907 | Ga0207428_10321087 | Ga0207428_103210872 | 231 |
| 381 | 3300028800 | Ga0265338_10010584 | Ga0265338_1001058411 | 231 |
| 382 | 3300028800 | Ga0265338_10038539 | Ga0265338_100385395 | 231 |
| 383 | 3300029957 | Ga0265324_10011016 | Ga0265324_100110162 | 231 |
| 384 | 3300031901 | Ga0307406_10172265 | Ga0307406_101722652 | 231 |
| 385 | 3300032002 | Ga0307416_100028486 | Ga0307416_1000284865 | 231 |
| 386 | 3300035116 | Ga0373945_0028235 | Ga0373945_0028235_1007_1810 | 231 |
| 387 | 3300035118 | Ga0373954_0231701 | Ga0373954_0231701_95_898 | 231 |
| 388 | 3300035410 | Ga0373924_0101734 | Ga0373924_0101734_334_1137 | 231 |
| 389 | 3300035410 | Ga0373924_0132437 | Ga0373924_0132437_177_980 | 231 |
| 390 | 3300035724 | Ga0373933_0056907 | Ga0373933_0056907_242_1045 | 231 |
| 391 | 3300035725 | Ga0373947_0019368 | Ga0373947_0019368_870_1673 | 231 |
| 392 | 3300035725 | Ga0373947_0190801 | Ga0373947_0190801_250_1053 | 231 |
| 393 | 3300036401 | Ga0373937_0079431 | Ga0373937_0079431_1166_1969 | 231 |
| 394 | 3300037068 | Ga0373925_0006971 | Ga0373925_0006971_4851_5654 | 231 |
| 395 | 3300037418 | Ga0395900_0603820 | Ga0395900_0603820_211_1014 | 231 |
| 396 | 3300037466 | Ga0395898_0021663 | Ga0395898_0021663_1952_2755 | 231 |
| 397 | 3300037466 | Ga0395898_0046859 | Ga0395898_0046859_2074_2877 | 231 |
| 398 | 3300037466 | Ga0395898_0216660 | Ga0395898_0216660_764_1567 | 231 |
| 399 | 3300038443 | Ga0395901_0326565 | Ga0395901_0326565_454_1257 | 231 |
| 400 | 3300038443 | Ga0395901_0521359 | Ga0395901_0521359_380_1183 | 231 |
| 401 | 3300038443 | Ga0395901_0523228 | Ga0395901_0523228_353_1177 | 231 |
| 402 | 3300039438 | Ga0436360_0978461 | Ga0436360_0978461_614_1417 | 231 |
| 403 | 3300044683 | Ga0466965_0126173 | Ga0466965_0126173_322_1125 | 231 |
| 404 | 3300044684 | Ga0466966_0022136 | Ga0466966_0022136_211_1014 | 231 |
| 405 | 3300044693 | Ga0466961_0053667 | Ga0466961_0053667_540_1343 | 231 |
| 406 | 3300044694 | Ga0466963_0000885 | Ga0466963_0000885_9154_9957 | 231 |
| 407 | 3300044694 | Ga0466963_0002401 | Ga0466963_0002401_1784_2587 | 231 |
| 408 | 3300044694 | Ga0466963_0003553 | Ga0466963_0003553_6961_7764 | 231 |
| 409 | 3300044694 | Ga0466963_0004822 | Ga0466963_0004822_2977_3804 | 231 |
| 410 | 3300044694 | Ga0466963_0006281 | Ga0466963_0006281_3464_4267 | 231 |
| 411 | 3300044694 | Ga0466963_0015139 | Ga0466963_0015139_153_956 | 231 |
| 412 | 3300044694 | Ga0466963_0016858 | Ga0466963_0016858_941_1738 | 231 |
| 413 | 3300044694 | Ga0466963_0016894 | Ga0466963_0016894_3125_3928 | 231 |
| 414 | 3300044694 | Ga0466963_0041545 | Ga0466963_0041545_1437_2282 | 231 |
| 415 | 3300044694 | Ga0466963_0041824 | Ga0466963_0041824_1223_2026 | 231 |
| 416 | 3300044694 | Ga0466963_0057670 | Ga0466963_0057670_321_1124 | 231 |
| 417 | 3300044694 | Ga0466963_0322374 | Ga0466963_0322374_125_928 | 231 |
| 418 | 3300044706 | Ga0466964_0000825 | Ga0466964_0000825_6013_6816 | 231 |
| 419 | 3300044706 | Ga0466964_0005941 | Ga0466964_0005941_2628_3431 | 231 |
| 420 | 3300044706 | Ga0466964_0008596 | Ga0466964_0008596_2587_3390 | 231 |
| 421 | 3300044706 | Ga0466964_0010551 | Ga0466964_0010551_1547_2350 | 231 |
| 422 | 3300044706 | Ga0466964_0051019 | Ga0466964_0051019_730_1533 | 231 |
| 423 | 3300044706 | Ga0466964_0079453 | Ga0466964_0079453_142_945 | 231 |
| 424 | 3300044719 | Ga0466971_0020157 | Ga0466971_0020157_1062_1865 | 231 |
| 425 | 3300044719 | Ga0466971_0023628 | Ga0466971_0023628_1061_1864 | 231 |
| 426 | 3300044719 | Ga0466971_0039125 | Ga0466971_0039125_923_1726 | 231 |
| 427 | 3300044719 | Ga0466971_0052851 | Ga0466971_0052851_100_903 | 231 |
| 428 | 3300044719 | Ga0466971_0096371 | Ga0466971_0096371_294_1097 | 231 |
| 429 | 3300044735 | Ga0466968_0007081 | Ga0466968_0007081_1081_1884 | 231 |
| 430 | 3300044735 | Ga0466968_0039965 | Ga0466968_0039965_1092_1895 | 231 |
| 431 | 3300044842 | Ga0466957_0007928 | Ga0466957_0007928_1156_1959 | 231 |
| 432 | 3300044842 | Ga0466957_0008096 | Ga0466957_0008096_2638_3435 | 231 |
| 433 | 3300044842 | Ga0466957_0330875 | Ga0466957_0330875_89_892 | 231 |
| 434 | 3300044842 | Ga0466957_0367418 | Ga0466957_0367418_126_929 | 231 |
| 435 | 3300044901 | Ga0466960_0008413 | Ga0466960_0008413_1083_1886 | 231 |
| 436 | 3300045049 | Ga0466959_0004417 | Ga0466959_0004417_252_1055 | 231 |
| 437 | 3300045836 | Ga0466958_0000921 | Ga0466958_0000921_10999_11802 | 231 |
| 438 | 3300045836 | Ga0466958_0001307 | Ga0466958_0001307_5015_5812 | 231 |
| 439 | 3300045836 | Ga0466958_0027857 | Ga0466958_0027857_1753_2556 | 231 |
| 440 | 3300045836 | Ga0466958_0032616 | Ga0466958_0032616_53_856 | 231 |
| 441 | 3300045836 | Ga0466958_0036282 | Ga0466958_0036282_1562_2365 | 231 |
| 442 | 3300045836 | Ga0466958_0053833 | Ga0466958_0053833_854_1657 | 231 |
| 443 | 3300045976 | Ga0466967_0000305 | Ga0466967_0000305_14473_15276 | 231 |
| 444 | 3300045976 | Ga0466967_0004124 | Ga0466967_0004124_1420_2217 | 231 |
| 445 | 3300045976 | Ga0466967_0004340 | Ga0466967_0004340_754_1557 | 231 |
| 446 | 3300045976 | Ga0466967_0004811 | Ga0466967_0004811_557_1360 | 231 |
| 447 | 3300045976 | Ga0466967_0008963 | Ga0466967_0008963_887_1690 | 231 |
| 448 | 3300045976 | Ga0466967_0014089 | Ga0466967_0014089_5270_6073 | 231 |
| 449 | 3300045976 | Ga0466967_0018327 | Ga0466967_0018327_3940_4785 | 231 |
| 450 | 3300045976 | Ga0466967_0040972 | Ga0466967_0040972_1246_2049 | 231 |
| 451 | 3300045976 | Ga0466967_0081776 | Ga0466967_0081776_1977_2780 | 231 |
| 452 | 3300045976 | Ga0466967_0109183 | Ga0466967_0109183_844_1647 | 231 |
| 453 | 3300045976 | Ga0466967_0116726 | Ga0466967_0116726_1006_1809 | 231 |
| 454 | 3300045976 | Ga0466967_0157099 | Ga0466967_0157099_64_867 | 231 |
| 455 | 3300045976 | Ga0466967_0166704 | Ga0466967_0166704_287_1090 | 231 |
| 456 | 3300045976 | Ga0466967_0177617 | Ga0466967_0177617_48_851 | 231 |
| 457 | 3300045976 | Ga0466967_0201341 | Ga0466967_0201341_809_1612 | 231 |
| 458 | 3300045976 | Ga0466967_0281269 | Ga0466967_0281269_522_1325 | 231 |
| 459 | 3300045976 | Ga0466967_0670408 | Ga0466967_0670408_51_854 | 231 |
| 460 | 3300046454 | Ga0495592_0000100 | Ga0495592_0000100_60591_61388 | 231 |
| 461 | 3300046454 | Ga0495592_0017698 | Ga0495592_0017698_523_1326 | 231 |
| 462 | 3300046454 | Ga0495592_0018729 | Ga0495592_0018729_2078_2875 | 231 |
| 463 | 3300046455 | Ga0495603_0145107 | Ga0495603_0145107_316_1119 | 231 |
| 464 | 3300046455 | Ga0495603_0294702 | Ga0495603_0294702_66_869 | 231 |
| 465 | 3300046459 | Ga0495629_0005062 | Ga0495629_0005062_188_991 | 231 |
| 466 | 3300046459 | Ga0495629_0029070 | Ga0495629_0029070_2780_3583 | 231 |
| 467 | 3300046459 | Ga0495629_0126534 | Ga0495629_0126534_604_1407 | 231 |
| 468 | 3300046461 | Ga0495641_0005502 | Ga0495641_0005502_7095_7898 | 231 |
| 469 | 3300046461 | Ga0495641_0027909 | Ga0495641_0027909_300_1103 | 231 |
| 470 | 3300046461 | Ga0495641_0069780 | Ga0495641_0069780_89_892 | 231 |
| 471 | 3300046462 | Ga0495651_0000008 | Ga0495651_0000008_70261_71058 | 231 |
| 472 | 3300046462 | Ga0495651_0051621 | Ga0495651_0051621_870_1667 | 231 |
| 473 | 3300046462 | Ga0495651_0098477 | Ga0495651_0098477_514_1317 | 231 |
| 474 | 3300046462 | Ga0495651_0108425 | Ga0495651_0108425_1080_1883 | 231 |
| 475 | 3300046463 | Ga0495653_0000519 | Ga0495653_0000519_19410_20207 | 231 |
| 476 | 3300046463 | Ga0495653_0017412 | Ga0495653_0017412_4934_5737 | 231 |
| 477 | 3300046463 | Ga0495653_0051140 | Ga0495653_0051140_1546_2349 | 231 |
| 478 | 3300046463 | Ga0495653_0051798 | Ga0495653_0051798_1892_2695 | 231 |
| 479 | 3300046472 | Ga0495580_0195492 | Ga0495580_0195492_529_1332 | 231 |
| 480 | 3300046473 | Ga0495582_0041484 | Ga0495582_0041484_35_838 | 231 |
| 481 | 3300046473 | Ga0495582_0053447 | Ga0495582_0053447_1356_2159 | 231 |
| 482 | 3300046475 | Ga0495639_0003153 | Ga0495639_0003153_6328_7131 | 231 |
| 483 | 3300046476 | Ga0495662_0012890 | Ga0495662_0012890_3196_3999 | 231 |
| 484 | 3300046476 | Ga0495662_0038565 | Ga0495662_0038565_785_1588 | 231 |
| 485 | 3300046477 | Ga0495664_0030004 | Ga0495664_0030004_2328_3131 | 231 |
| 486 | 3300046499 | Ga0495594_0149967 | Ga0495594_0149967_218_1021 | 231 |
| 487 | 3300046499 | Ga0495594_0256619 | Ga0495594_0256619_29_832 | 231 |
| 488 | 3300046511 | Ga0495608_0002853 | Ga0495608_0002853_10892_11689 | 231 |
| 489 | 3300046511 | Ga0495608_0025390 | Ga0495608_0025390_2866_3669 | 231 |
| 490 | 3300046514 | Ga0495618_0008107 | Ga0495618_0008107_1897_2694 | 231 |
| 491 | 3300046514 | Ga0495618_0136278 | Ga0495618_0136278_203_1006 | 231 |
| 492 | 3300046516 | Ga0495628_0001255 | Ga0495628_0001255_18254_19051 | 231 |
| 493 | 3300046516 | Ga0495628_0037095 | Ga0495628_0037095_403_1200 | 231 |
| 494 | 3300046516 | Ga0495628_0112492 | Ga0495628_0112492_85_888 | 231 |
| 495 | 3300046517 | Ga0495630_0106281 | Ga0495630_0106281_870_1673 | 231 |
| 496 | 3300046517 | Ga0495630_0242954 | Ga0495630_0242954_48_851 | 231 |
| 497 | 3300046517 | Ga0495630_0267466 | Ga0495630_0267466_231_1034 | 231 |
| 498 | 3300046526 | Ga0495666_0008985 | Ga0495666_0008985_353_1156 | 231 |
| 499 | 3300046529 | Ga0495652_0000888 | Ga0495652_0000888_18254_19051 | 231 |
| 500 | 3300046529 | Ga0495652_0023777 | Ga0495652_0023777_4032_4829 | 231 |
| 501 | 3300046529 | Ga0495652_0077879 | Ga0495652_0077879_260_1063 | 231 |
| 502 | 3300046529 | Ga0495652_0145473 | Ga0495652_0145473_872_1675 | 231 |
| 503 | 3300046529 | Ga0495652_0228700 | Ga0495652_0228700_38_841 | 231 |
| 504 | 3300046529 | Ga0495652_0390283 | Ga0495652_0390283_91_894 | 231 |
| 505 | 3300046531 | Ga0495665_0024266 | Ga0495665_0024266_39_842 | 231 |
| 506 | 3300046533 | Ga0495640_0049832 | Ga0495640_0049832_115_918 | 231 |
| 507 | 3300046533 | Ga0495640_0180425 | Ga0495640_0180425_342_1145 | 231 |
| 508 | 3300046533 | Ga0495640_0206417 | Ga0495640_0206417_119_922 | 231 |
| 509 | 3300046535 | Ga0495586_0029182 | Ga0495586_0029182_452_1255 | 231 |
| 510 | 3300046535 | Ga0495586_0083485 | Ga0495586_0083485_487_1290 | 231 |
| 511 | 3300046536 | Ga0495587_0000048 | Ga0495587_0000048_89286_90083 | 231 |
| 512 | 3300046536 | Ga0495587_0015646 | Ga0495587_0015646_983_1780 | 231 |
| 513 | 3300046536 | Ga0495587_0073265 | Ga0495587_0073265_440_1243 | 231 |
| 514 | 3300046543 | Ga0495645_0000029 | Ga0495645_0000029_23037_23834 | 231 |
| 515 | 3300046559 | Ga0495667_0045237 | Ga0495667_0045237_1370_2173 | 231 |
| 516 | 3300046559 | Ga0495667_0199571 | Ga0495667_0199571_277_1074 | 231 |
| 517 | 3300046615 | Ga0495656_0196317 | Ga0495656_0196317_53_853 | 231 |
| 518 | 3300046642 | Ga0495634_0038422 | Ga0495634_0038422_1474_2277 | 231 |
| 519 | 3300046642 | Ga0495634_0070558 | Ga0495634_0070558_284_1087 | 231 |
| 520 | 3300046663 | Ga0495635_0085222 | Ga0495635_0085222_1273_2076 | 231 |
| 521 | 3300046663 | Ga0495635_0227649 | Ga0495635_0227649_187_984 | 231 |
| 522 | 3300046663 | Ga0495635_0368112 | Ga0495635_0368112_103_900 | 231 |
| 523 | 3300046665 | Ga0495661_0199409 | Ga0495661_0199409_151_954 | 231 |
| 524 | 3300046675 | Ga0495657_0021277 | Ga0495657_0021277_658_1455 | 231 |
| 525 | 3300046675 | Ga0495657_0030470 | Ga0495657_0030470_1486_2283 | 231 |
| 526 | 3300046678 | Ga0495599_0000181 | Ga0495599_0000181_3147_3944 | 231 |
| 527 | 3300046678 | Ga0495599_0067613 | Ga0495599_0067613_1151_1948 | 231 |
| 528 | 3300046679 | Ga0495623_0000093 | Ga0495623_0000093_22182_22979 | 231 |
| 529 | 3300046680 | Ga0495646_0000416 | Ga0495646_0000416_4688_5485 | 231 |
| 530 | 3300046680 | Ga0495646_0028309 | Ga0495646_0028309_794_1591 | 231 |
| 531 | 3300046681 | Ga0495647_0001300 | Ga0495647_0001300_2786_3589 | 231 |
| 532 | 3300046681 | Ga0495647_0020209 | Ga0495647_0020209_224_1027 | 231 |
| 533 | 3300046681 | Ga0495647_0033737 | Ga0495647_0033737_565_1368 | 231 |
| 534 | 3300046683 | Ga0495658_0001970 | Ga0495658_0001970_822_1625 | 231 |
| 535 | 3300046683 | Ga0495658_0201661 | Ga0495658_0201661_29_832 | 231 |
| 536 | 3300046683 | Ga0495658_0206876 | Ga0495658_0206876_316_1119 | 231 |
| 537 | 3300046689 | Ga0495613_0047036 | Ga0495613_0047036_1061_1864 | 231 |
| 538 | 3300046689 | Ga0495613_0085226 | Ga0495613_0085226_1294_2097 | 231 |
| 539 | 3300046689 | Ga0495613_0171918 | Ga0495613_0171918_587_1390 | 231 |
| 540 | 3300046690 | Ga0495624_0014510 | Ga0495624_0014510_4093_4896 | 231 |
| 541 | 3300046809 | Ga0495600_0015460 | Ga0495600_0015460_1038_1835 | 231 |
| 542 | 3300046809 | Ga0495600_0398322 | Ga0495600_0398322_35_838 | 231 |
| 543 | 3300047315 | Ga0495581_0019626 | Ga0495581_0019626_2251_3054 | 231 |
| 544 | 3300047317 | Ga0495604_0000111 | Ga0495604_0000111_11414_12211 | 231 |
| 545 | 3300047317 | Ga0495604_0048288 | Ga0495604_0048288_1738_2541 | 231 |
| 546 | 3300047319 | Ga0495674_0038310 | Ga0495674_0038310_1170_1973 | 231 |
| 547 | 3300047319 | Ga0495674_0346472 | Ga0495674_0346472_15_818 | 231 |
| 548 | 3300047321 | Ga0495676_0145078 | Ga0495676_0145078_24_827 | 231 |
| 549 | 3300047322 | Ga0495680_0013832 | Ga0495680_0013832_3523_4326 | 231 |
| 550 | 3300047322 | Ga0495680_0014786 | Ga0495680_0014786_3944_4741 | 231 |
| 551 | 3300047322 | Ga0495680_0035276 | Ga0495680_0035276_350_1153 | 231 |
| 552 | 3300047322 | Ga0495680_0102533 | Ga0495680_0102533_814_1611 | 231 |
| 553 | 3300047322 | Ga0495680_0323500 | Ga0495680_0323500_17_820 | 231 |
| 554 | 3300047444 | Ga0495675_0000376 | Ga0495675_0000376_7947_8744 | 231 |
| 555 | 3300047444 | Ga0495675_0218968 | Ga0495675_0218968_283_1080 | 231 |
| 556 | 3300047471 | Ga0495684_0074669 | Ga0495684_0074669_185_988 | 231 |
| 557 | 3300047471 | Ga0495684_0079530 | Ga0495684_0079530_793_1590 | 231 |
| 558 | 3300047471 | Ga0495684_0100983 | Ga0495684_0100983_101_904 | 231 |
| 559 | 3300047471 | Ga0495684_0224606 | Ga0495684_0224606_511_1314 | 231 |
| 560 | 3300047673 | Ga0495593_0017423 | Ga0495593_0017423_3137_3940 | 231 |
| 561 | 3300048088 | Ga0495602_0000141 | Ga0495602_0000141_20511_21308 | 231 |
| 562 | 3300048088 | Ga0495602_0006548 | Ga0495602_0006548_10417_11214 | 231 |
| 563 | 3300048088 | Ga0495602_0163369 | Ga0495602_0163369_206_1009 | 231 |
| 564 | 3300048089 | Ga0495614_0006610 | Ga0495614_0006610_4221_5024 | 231 |
| 565 | 3300048907 | Ga0496104_0033091 | Ga0496104_0033091_2738_3541 | 231 |
| 566 | 3300048907 | Ga0496104_0423891 | Ga0496104_0423891_290_1093 | 231 |
| 567 | 3300048907 | Ga0496104_0657728 | Ga0496104_0657728_140_943 | 231 |
| 568 | 3300048908 | Ga0496105_0003059 | Ga0496105_0003059_6658_7461 | 231 |
| 569 | 3300048910 | Ga0496107_0200107 | Ga0496107_0200107_167_970 | 231 |
| 570 | 3300048910 | Ga0496107_0396066 | Ga0496107_0396066_125_928 | 231 |
| 571 | 3300048911 | Ga0496108_0016271 | Ga0496108_0016271_5242_6045 | 231 |
| 572 | 3300048911 | Ga0496108_0090972 | Ga0496108_0090972_369_1172 | 231 |
| 573 | 3300048912 | Ga0496109_0023115 | Ga0496109_0023115_32_835 | 231 |
| 574 | 3300048913 | Ga0496110_0274830 | Ga0496110_0274830_190_993 | 231 |
| 575 | 3300048917 | Ga0496114_0014134 | Ga0496114_0014134_5137_5940 | 231 |
| 576 | 3300048917 | Ga0496114_0014487 | Ga0496114_0014487_3225_4028 | 231 |
| 577 | 3300048917 | Ga0496114_0216492 | Ga0496114_0216492_694_1497 | 231 |
| 578 | 3300049583 | Ga0501067_0007338 | Ga0501067_0007338_3656_4480 | 231 |
| 579 | 3300049585 | Ga0501069_0118502 | Ga0501069_0118502_515_1339 | 231 |
| 580 | 3300049824 | Ga0501045_0310890 | Ga0501045_0310890_243_1046 | 231 |
| 581 | 3300050511 | nmdc:mga08y16_239391_c1 | nmdc:mga08y16_239391_c1_758_1561 | 231 |
| 582 | 3300050512 | nmdc:mga0n895_158846_c1 | nmdc:mga0n895_158846_c1_1463_2266 | 231 |
| 583 | 3300050514 | nmdc:mga08x19_161148_c1 | nmdc:mga08x19_161148_c1_245_1048 | 231 |
| 584 | 3300050515 | nmdc:mga0a205_154640_c1 | nmdc:mga0a205_154640_c1_867_1670 | 231 |
| 585 | 3300053077 | Ga0495601_0000206 | Ga0495601_0000206_21477_22274 | 231 |
| 586 | 3300053077 | Ga0495601_0127526 | Ga0495601_0127526_237_1040 | 231 |
| 587 | 3300053077 | Ga0495601_0281390 | Ga0495601_0281390_136_939 | 231 |
| 588 | 3300053078 | Ga0495612_0018875 | Ga0495612_0018875_658_1455 | 231 |
| 589 | 3300053078 | Ga0495612_0060199 | Ga0495612_0060199_235_1038 | 231 |
| 590 | 3300053084 | Ga0495595_0005617 | Ga0495595_0005617_4260_5063 | 231 |
| 591 | 3300053084 | Ga0495595_0101287 | Ga0495595_0101287_550_1347 | 231 |
| 592 | 3300053084 | Ga0495595_0143483 | Ga0495595_0143483_38_835 | 231 |
| 593 | 3300053085 | Ga0495619_0000291 | Ga0495619_0000291_27744_28541 | 231 |
| 594 | 3300053085 | Ga0495619_0039474 | Ga0495619_0039474_51_854 | 231 |
| 595 | 3300053085 | Ga0495619_0055761 | Ga0495619_0055761_66_869 | 231 |
| 596 | 3300061719 | Ga0466962_0010625 | Ga0466962_0010625_2639_3442 | 231 |
| 597 | 3300061719 | Ga0466962_0112165 | Ga0466962_0112165_84_887 | 231 |
| 598 | 3300061719 | Ga0466962_0139429 | Ga0466962_0139429_61_864 | 231 |
| 599 | 3300061734 | Ga0530510_0085011 | Ga0530510_0085011_577_1401 | 231 |
| 600 | 3300025944 | Ga0207661_10347762 | Ga0207661_103477622 | 232 |
| 601 | 3300003316 | rootH1_10096223 | rootH1_100962232 | 233 |
| 602 | 3300005341 | Ga0070691_10027363 | Ga0070691_100273633 | 233 |
| 603 | 3300005441 | Ga0070700_100022193 | Ga0070700_1000221933 | 233 |
| 604 | 3300005458 | Ga0070681_10223319 | Ga0070681_102233192 | 233 |
| 605 | 3300005535 | Ga0070684_100051060 | Ga0070684_1000510603 | 233 |
| 606 | 3300005545 | Ga0070695_100273728 | Ga0070695_1002737282 | 233 |
| 607 | 3300005547 | Ga0070693_100378826 | Ga0070693_1003788261 | 233 |
| 608 | 3300005577 | Ga0068857_100004499 | Ga0068857_10000449910 | 233 |
| 609 | 3300005719 | Ga0068861_100102859 | Ga0068861_1001028593 | 233 |
| 610 | 3300005844 | Ga0068862_100241990 | Ga0068862_1002419902 | 233 |
| 611 | 3300005937 | Ga0081455_10109859 | Ga0081455_101098593 | 233 |
| 612 | 3300005981 | Ga0081538_10021172 | Ga0081538_100211723 | 233 |
| 613 | 3300006195 | Ga0075366_10184611 | Ga0075366_101846112 | 233 |
| 614 | 3300009094 | Ga0111539_10006384 | Ga0111539_100063848 | 233 |
| 615 | 3300009098 | Ga0105245_10029132 | Ga0105245_100291322 | 233 |
| 616 | 3300009553 | Ga0105249_10220639 | Ga0105249_102206392 | 233 |
| 617 | 3300025899 | Ga0207642_10055436 | Ga0207642_100554362 | 233 |
| 618 | 3300025927 | Ga0207687_10055410 | Ga0207687_100554104 | 233 |
| 619 | 3300025933 | Ga0207706_10013802 | Ga0207706_100138029 | 233 |
| 620 | 3300026075 | Ga0207708_10007293 | Ga0207708_100072937 | 233 |
| 621 | 3300026089 | Ga0207648_10058467 | Ga0207648_100584674 | 233 |
| 622 | 3300026116 | Ga0207674_10002093 | Ga0207674_1000209310 | 233 |
| 623 | 3300026118 | Ga0207675_100104032 | Ga0207675_1001040322 | 233 |
| 624 | 3300028666 | Ga0265336_10057009 | Ga0265336_100570091 | 233 |
| 625 | 3300031241 | Ga0265325_10018526 | Ga0265325_100185262 | 233 |
| 626 | 3300031249 | Ga0265339_10005030 | Ga0265339_100050307 | 233 |
| 627 | 3300031250 | Ga0265331_10029102 | Ga0265331_100291024 | 233 |
| 628 | 3300031251 | Ga0265327_10073748 | Ga0265327_100737482 | 233 |
| 629 | 3300031344 | Ga0265316_10056900 | Ga0265316_100569002 | 233 |
| 630 | 3300031548 | Ga0307408_100046396 | Ga0307408_1000463964 | 233 |
| 631 | 3300031711 | Ga0265314_10057907 | Ga0265314_100579073 | 233 |
| 632 | 3300031712 | Ga0265342_10043364 | Ga0265342_100433642 | 233 |
| 633 | 3300031901 | Ga0307406_10036628 | Ga0307406_100366284 | 233 |
| 634 | 3300031995 | Ga0307409_100061345 | Ga0307409_1000613452 | 233 |
| 635 | 3300032002 | Ga0307416_100006529 | Ga0307416_1000065293 | 233 |
| 636 | 3300032126 | Ga0307415_100000048 | Ga0307415_10000004810 | 233 |
| 637 | 3300037471 | Ga0395905_0194406 | Ga0395905_0194406_847_1647 | 233 |
| 638 | 3300049743 | Ga0501081_0236950 | Ga0501081_0236950_434_1240 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4q2e-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) | 0.7005 | 11 | 227 |
| 4q2g-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) | 0.6727 | 8 | 230 |
| 4q2e-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) | 0.6567 | 11 | 227 |
| 4q2g-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) | 0.6456 | 8 | 230 |
| 4mhw-assembly1.cif.gz_A | crystal structure of thit with small molecule bat-25 | 0.374 | 61 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4mhwA00 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.374 | 61 | 191 | 1.10.1760.20 |
| af_O45507_139_348_1.10.565.10 | Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor | 0.3627 | 48 | 232 | 1.10.565.10 |
| af_P77219_8_153_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.3342 | 30 | 226 | 1.20.1080.10 |
| 2lrkA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.2951 | 119 | 230 | 1.20.58.80 |
| 4mhwA00 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.2899 | 61 | 191 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X6NPI0-F1-model_v4 | deleted | 0.8494 | 1 | 171 |
|
| AF-A0A7V9KAV9-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) | 0.8313 | 2 | 174 |
GO:0004605
GO:0005886 GO:0016024 |
| AF-A0A7X1ZIU5-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) | 0.8302 | 4 | 179 |
GO:0004605
GO:0005886 GO:0016024 |
| AF-X1KCA0-F1-model_v4 | Phosphatidate cytidylyltransferase | 0.8281 | 88 | 186 |
GO:0004605
GO:0005886 GO:0016024 |
| AF-A0A2M7JA63-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) | 0.8273 | 6 | 180 |
GO:0004605
GO:0005886 GO:0016024 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar