F471538

General Info

Members Datasets Scaffolds Average Seq Length
638 284 639 258

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0041545|Ga0466963_0041545_1437_2282
Length 281
Sequence MGAEAPALPAPGADLSNLVNRVLVAVVGLPIVLGAVWGGGWWLFALVAVAGAVAVHEFVVMARPLAPLAPAAYVGVFLALLGAQRGGLLWMLAGFLATLVVAFALNTLAKTRPPATAAIGATVLAAAWIGFGLGHIVLLRRMDAHPQLIAFTVLLVVFAADTFAYFGGRLFGRRKLAPTLSPGKTWEGFVVGSLVGIFVAFVALYQNRDTYLNVWEALVLGVVVVLVAVAGDLFESMLKRDMQVKDTGNLLGGHGGVLDRVDALLFAAPATYYLVRAFGYL

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 7.84
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10096223 3300003316 Bacteria 1606
2 rootH1_10096223 3300003323 Bacteria 1926
3 Ga0070658_10014188 3300005327 Bacteria 6395
4 Ga0070658_10039243 3300005327 Bacteria 3819
5 Ga0070683_100003014 3300005329 Bacteria 13523
6 Ga0070683_100007546 3300005329 Bacteria 9191
7 Ga0070683_100155595 3300005329 Bacteria 2168
8 Ga0070690_100100853 3300005330 Bacteria 1914
9 Ga0068869_100036551 3300005334 Bacteria 3488
10 Ga0070680_100092377 3300005336 Bacteria 2506
11 Ga0070680_100246477 3300005336 Bacteria 1510
12 Ga0070682_100279765 3300005337 Bacteria 1216
13 Ga0068868_100406575 3300005338 Bacteria 1176
14 Ga0070660_100036788 3300005339 Bacteria 3709
15 Ga0070691_10027363 3300005341 Bacteria 2660
16 Ga0070691_10098492 3300005341 Bacteria 1449
17 Ga0070661_100013123 3300005344 Bacteria 5813
18 Ga0070667_100033005 3300005367 Bacteria 4322
19 Ga0070709_10009642 3300005434 Bacteria 5332
20 Ga0070714_100007459 3300005435 Bacteria 8515
21 Ga0070714_100114075 3300005435 Bacteria 2397
22 Ga0070714_100117692 3300005435 Bacteria 2360
23 Ga0070714_100207512 3300005435 Bacteria 1795
24 Ga0070714_100584308 3300005435 Bacteria 1072
25 Ga0070713_100018306 3300005436 Bacteria 5325
26 Ga0070713_100307065 3300005436 Bacteria 1462
27 Ga0070710_10000589 3300005437 Bacteria 17269
28 Ga0070710_10006973 3300005437 Bacteria 5450
29 Ga0070711_100006227 3300005439 Bacteria 7182
30 Ga0070705_100184259 3300005440 Bacteria 1417
31 Ga0070700_100022193 3300005441 Bacteria 3699
32 Ga0070708_100650847 3300005445 Bacteria 993
33 Ga0070681_10011454 3300005458 Bacteria 8777
34 Ga0070681_10020004 3300005458 Bacteria 6707
35 Ga0070681_10034201 3300005458 Bacteria 5104
36 Ga0070681_10223319 3300005458 Bacteria 1799
37 Ga0070681_10240090 3300005458 Bacteria 1726
38 Ga0068867_100239083 3300005459 Bacteria 1472
39 Ga0068867_100521232 3300005459 Bacteria 1025
40 Ga0070706_100382290 3300005467 Bacteria 1311
41 Ga0070707_100001400 3300005468 Bacteria 23671
42 Ga0070707_100111218 3300005468 Bacteria 2657
43 Ga0070707_100153336 3300005468 Bacteria 2243
44 Ga0070698_100056389 3300005471 Bacteria 3982
45 Ga0070698_100383323 3300005471 Bacteria 1338
46 Ga0070679_100019792 3300005530 Bacteria 6553
47 Ga0070679_100089465 3300005530 Bacteria 3066
48 Ga0070679_100125102 3300005530 Bacteria 2554
49 Ga0070684_100004862 3300005535 Bacteria 10270
50 Ga0070684_100036287 3300005535 Bacteria 4224
51 Ga0070684_100051060 3300005535 Bacteria 3593
52 Ga0070684_100280526 3300005535 Bacteria 1526
53 Ga0070684_100373638 3300005535 Bacteria 1313
54 Ga0070695_100000062 3300005545 Bacteria 43594
55 Ga0070695_100273728 3300005545 Bacteria 1238
56 Ga0070693_100378826 3300005547 Bacteria 975
57 Ga0070665_100070154 3300005548 Bacteria 3511
58 Ga0068855_100010562 3300005563 Bacteria 11133
59 Ga0068855_100199484 3300005563 Bacteria 2253
60 Ga0070664_100063384 3300005564 Bacteria 3152
61 Ga0068857_100004499 3300005577 Bacteria 11782
62 Ga0068854_100333152 3300005578 Bacteria 1237
63 Ga0068856_100344313 3300005614 Bacteria 1509
64 Ga0068856_100493987 3300005614 Bacteria 1245
65 Ga0068864_100303387 3300005618 Bacteria 1496
66 Ga0068864_100792099 3300005618 Bacteria 931
67 Ga0068861_100102859 3300005719 Bacteria 2275
68 Ga0068862_100241990 3300005844 Bacteria 1641
69 Ga0081455_10031319 3300005937 Bacteria 4814
70 Ga0081455_10109859 3300005937 Bacteria 2194
71 Ga0081538_10007438 3300005981 Bacteria 9480
72 Ga0081538_10021172 3300005981 Bacteria 4760
73 Ga0081538_10035380 3300005981 Bacteria 3282
74 Ga0081539_10000041 3300005985 Bacteria 292660
75 Ga0070717_10011348 3300006028 Bacteria 6763
76 Ga0070717_10013735 3300006028 Bacteria 6213
77 Ga0070717_10020225 3300006028 Bacteria 5231
78 Ga0070717_10203831 3300006028 Bacteria 1733
79 Ga0070717_10217102 3300006028 Bacteria 1680
80 Ga0070715_10038666 3300006163 Bacteria 1982
81 Ga0070716_100007254 3300006173 Bacteria 5450
82 Ga0070716_100511198 3300006173 Bacteria 888
83 Ga0075366_10184611 3300006195 Bacteria 1267
84 Ga0075434_100026447 3300006871 Bacteria 5684
85 Ga0075434_100266280 3300006871 Bacteria 1733
86 Ga0068865_100133230 3300006881 Bacteria 1864
87 Ga0075436_100238901 3300006914 Bacteria 1292
88 Ga0105240_10009653 3300009093 Bacteria 13646
89 Ga0105240_10084757 3300009093 Bacteria 3884
90 Ga0105240_10292326 3300009093 Bacteria 1867
91 Ga0105240_10703432 3300009093 Bacteria 1103
92 Ga0111539_10004030 3300009094 Bacteria 19288
93 Ga0111539_10006384 3300009094 Bacteria 15204
94 Ga0111539_10068910 3300009094 Bacteria 4177
95 Ga0105245_10029132 3300009098 Bacteria 4875
96 Ga0105245_10463867 3300009098 Bacteria 1277
97 Ga0105247_10196567 3300009101 Bacteria 1353
98 Ga0114129_10062927 3300009147 Bacteria 5183
99 Ga0114129_10128447 3300009147 Bacteria 3483
100 Ga0105241_10239060 3300009174 Bacteria 1534
101 Ga0105242_10064870 3300009176 Bacteria 3011
102 Ga0105248_10274395 3300009177 Bacteria 1899
103 Ga0105238_10056734 3300009551 Bacteria 3928
104 Ga0105238_10572521 3300009551 Bacteria 1135
105 Ga0105249_10220639 3300009553 Bacteria 1865
106 Ga0105239_10157109 3300010375 Bacteria 2540
107 Ga0105239_10920759 3300010375 Bacteria 1004
108 Ga0157373_10290288 3300013100 Bacteria 1160
109 Ga0157370_10012187 3300013104 Bacteria 8938
110 Ga0157370_10017960 3300013104 Bacteria 7121
111 Ga0157369_10001204 3300013105 Bacteria 32229
112 Ga0157369_10004504 3300013105 Bacteria 16412
113 Ga0157369_10048846 3300013105 Bacteria 4590
114 Ga0157369_10065952 3300013105 Bacteria 3895
115 Ga0157369_10205378 3300013105 Bacteria 2066
116 Ga0157374_10011973 3300013296 Bacteria 7531
117 Ga0163162_10625241 3300013306 Bacteria 1202
118 Ga0157372_10181793 3300013307 Bacteria 2434
119 Ga0157372_10237668 3300013307 Bacteria 2113
120 Ga0157372_10518430 3300013307 Bacteria 1390
121 Ga0157372_10888891 3300013307 Unclassified 1034
122 Ga0157375_10310775 3300013308 Bacteria 1740
123 Ga0182008_10003715 3300014497 Bacteria 9104
124 Ga0182008_10050772 3300014497 Bacteria 2058
125 Ga0157379_10108207 3300014968 Bacteria 2496
126 Ga0157376_10123649 3300014969 Bacteria 2297
127 Ga0182006_1012613 3300015261 Bacteria 3695
128 Ga0182007_10033923 3300015262 Bacteria 1727
129 Ga0206353_11182390 3300020082 Bacteria 6192
130 Ga0206353_12036014 3300020082 Bacteria 3148
131 Ga0213873_10039324 3300021358 Bacteria 1212
132 Ga0213871_10061727 3300021441 Bacteria 1045
133 Ga0207692_10001763 3300025898 Bacteria 8214
134 Ga0207642_10055436 3300025899 Bacteria 1813
135 Ga0207710_10115827 3300025900 Bacteria 1276
136 Ga0207688_10139234 3300025901 Bacteria 1427
137 Ga0207685_10007005 3300025905 Bacteria 3112
138 Ga0207699_10007743 3300025906 Bacteria 5260
139 Ga0207699_10025505 3300025906 Bacteria 3246
140 Ga0207699_10220737 3300025906 Bacteria 1294
141 Ga0207705_10001180 3300025909 Bacteria 21214
142 Ga0207705_10056857 3300025909 Bacteria 2822
143 Ga0207654_10218272 3300025911 Bacteria 1263
144 Ga0207707_10050785 3300025912 Bacteria 3612
145 Ga0207707_10155620 3300025912 Bacteria 1999
146 Ga0207707_10295655 3300025912 Bacteria 1401
147 Ga0207695_10016356 3300025913 Bacteria 8682
148 Ga0207695_10291866 3300025913 Unclassified 1523
149 Ga0207693_10000662 3300025915 Bacteria 30935
150 Ga0207693_10194909 3300025915 Bacteria 1594
151 Ga0207663_10000565 3300025916 Bacteria 16340
152 Ga0207660_10077639 3300025917 Bacteria 2432
153 Ga0207660_10156435 3300025917 Bacteria 1755
154 Ga0207657_10000739 3300025919 Bacteria 34678
155 Ga0207657_10006735 3300025919 Bacteria 11862
156 Ga0207657_10048812 3300025919 Bacteria 3694
157 Ga0207657_10340144 3300025919 Bacteria 1184
158 Ga0207649_10049404 3300025920 Bacteria 2598
159 Ga0207649_10414348 3300025920 Bacteria 1011
160 Ga0207652_10059252 3300025921 Bacteria 3300
161 Ga0207652_10197161 3300025921 Bacteria 1812
162 Ga0207652_10480204 3300025921 Bacteria 1119
163 Ga0207646_10002734 3300025922 Bacteria 20624
164 Ga0207646_10202568 3300025922 Bacteria 1793
165 Ga0207646_10365937 3300025922 Bacteria 1303
166 Ga0207687_10055410 3300025927 Bacteria 2778
167 Ga0207700_10003047 3300025928 Bacteria 9669
168 Ga0207700_10033252 3300025928 Bacteria 3688
169 Ga0207664_10012742 3300025929 Bacteria 6019
170 Ga0207664_10033209 3300025929 Bacteria 3962
171 Ga0207664_10151520 3300025929 Bacteria 1970
172 Ga0207664_10337774 3300025929 Bacteria 1331
173 Ga0207644_10582684 3300025931 Unclassified 928
174 Ga0207690_10306303 3300025932 Bacteria 1245
175 Ga0207706_10013802 3300025933 Bacteria 7332
176 Ga0207706_10183969 3300025933 Bacteria 1835
177 Ga0207669_10194565 3300025937 Bacteria 1466
178 Ga0207665_10000060 3300025939 Bacteria 70443
179 Ga0207689_10102116 3300025942 Bacteria 2356
180 Ga0207661_10019738 3300025944 Bacteria 5031
181 Ga0207661_10031672 3300025944 Bacteria 4088
182 Ga0207661_10347762 3300025944 Bacteria 1337
183 Ga0207667_10334725 3300025949 Bacteria 1545
184 Ga0207640_10328518 3300025981 Bacteria 1220
185 Ga0207640_10428243 3300025981 Bacteria 1085
186 Ga0207658_10014892 3300025986 Bacteria 5330
187 Ga0207677_10224757 3300026023 Bacteria 1508
188 Ga0207708_10007293 3300026075 Bacteria 8177
189 Ga0207702_10311792 3300026078 Bacteria 1496
190 Ga0207641_10467420 3300026088 Bacteria 1221
191 Ga0207648_10058467 3300026089 Bacteria 3362
192 Ga0207676_10098654 3300026095 Bacteria 2416
193 Ga0207674_10002093 3300026116 Bacteria 25273
194 Ga0207674_10056193 3300026116 Bacteria 3998
195 Ga0207675_100104032 3300026118 Bacteria 2676
196 Ga0207698_10275655 3300026142 Bacteria 1553
197 Ga0209966_1031889 3300027695 Bacteria 1071
198 Ga0207428_10321087 3300027907 Bacteria 1144
199 Ga0268266_10087708 3300028379 Bacteria 2723
200 Ga0265319_1037147 3300028563 Unclassified 1662
201 Ga0265334_10008192 3300028573 Bacteria 4451
202 Ga0265318_10003094 3300028577 Bacteria 8544
203 Ga0265322_10064228 3300028654 Bacteria 1041
204 Ga0265336_10005714 3300028666 Bacteria 4559
205 Ga0265336_10057009 3300028666 Bacteria 1173
206 Ga0265338_10002058 3300028800 Bacteria 31087
207 Ga0265338_10010584 3300028800 Bacteria 10787
208 Ga0265338_10038539 3300028800 Bacteria 4526
209 Ga0265338_10054250 3300028800 Bacteria 3576
210 Ga0265338_10075399 3300028800 Bacteria 2862
211 Ga0265338_10100177 3300028800 Bacteria 2364
212 Ga0265324_10011016 3300029957 Bacteria 3461
213 Ga0265330_10009834 3300031235 Bacteria 4526
214 Ga0265332_10018123 3300031238 Bacteria 3104
215 Ga0265328_10005742 3300031239 Bacteria 5299
216 Ga0265320_10010065 3300031240 Bacteria 5654
217 Ga0265325_10018526 3300031241 Bacteria 3861
218 Ga0265329_10040737 3300031242 Bacteria 1490
219 Ga0265340_10013271 3300031247 Bacteria 4333
220 Ga0265339_10005030 3300031249 Bacteria 8892
221 Ga0265339_10050781 3300031249 Bacteria 2266
222 Ga0265331_10029102 3300031250 Bacteria 2759
223 Ga0265327_10010760 3300031251 Bacteria 6383
224 Ga0265327_10073748 3300031251 Bacteria 1702
225 Ga0265316_10056900 3300031344 Bacteria 3051
226 Ga0265316_10231805 3300031344 Bacteria 1359
227 Ga0307408_100046396 3300031548 Bacteria 3108
228 Ga0307408_100264188 3300031548 Bacteria 1426
229 Ga0265313_10007875 3300031595 Bacteria 7181
230 Ga0265314_10057907 3300031711 Bacteria 2657
231 Ga0265342_10043364 3300031712 Bacteria 2715
232 Ga0307405_10064978 3300031731 Bacteria 2321
233 Ga0307413_10009249 3300031824 Bacteria 4707
234 Ga0307406_10036628 3300031901 Bacteria 3024
235 Ga0307406_10172265 3300031901 Bacteria 1567
236 Ga0307412_10426189 3300031911 Bacteria 1086
237 Ga0307409_100014786 3300031995 Bacteria 5092
238 Ga0307409_100061345 3300031995 Bacteria 2938
239 Ga0307416_100006529 3300032002 Bacteria 7309
240 Ga0307416_100028486 3300032002 Bacteria 4154
241 Ga0307415_100000048 3300032126 Bacteria 51694
242 Ga0373945_0028235 3300035116 Bacteria 1965
243 Ga0373954_0231701 3300035118 Bacteria 909
244 Ga0373924_0101734 3300035410 Unclassified 1237
245 Ga0373924_0132437 3300035410 Bacteria 1085
246 Ga0373931_0053043 3300035691 Bacteria 2163
247 Ga0373933_0056907 3300035724 Bacteria 2349
248 Ga0373947_0019368 3300035725 Bacteria 3923
249 Ga0373947_0190801 3300035725 Bacteria 1337
250 Ga0373937_0079431 3300036401 Bacteria 3032
251 Ga0373925_0006971 3300037068 Bacteria 8263
252 Ga0395899_0001267 3300037312 Bacteria 21969
253 Ga0395899_0009229 3300037312 Bacteria 7574
254 Ga0395899_0010571 3300037312 Bacteria 7072
255 Ga0395899_0030617 3300037312 Bacteria 4046
256 Ga0395900_0003489 3300037418 Bacteria 16973
257 Ga0395900_0069134 3300037418 Bacteria 3629
258 Ga0395900_0603820 3300037418 Bacteria 1038
259 Ga0395898_0001276 3300037466 Bacteria 37111
260 Ga0395898_0021663 3300037466 Bacteria 6515
261 Ga0395898_0027338 3300037466 Bacteria 5729
262 Ga0395898_0046859 3300037466 Bacteria 4245
263 Ga0395898_0049132 3300037466 Bacteria 4134
264 Ga0395898_0093913 3300037466 Bacteria 2882
265 Ga0395898_0216660 3300037466 Bacteria 1826
266 Ga0395905_0001281 3300037471 Bacteria 31019
267 Ga0395905_0007609 3300037471 Bacteria 10755
268 Ga0395905_0068364 3300037471 Bacteria 3327
269 Ga0395905_0194406 3300037471 Bacteria 1902
270 Ga0395905_0413997 3300037471 Bacteria 1243
271 Ga0395901_0001957 3300038443 Bacteria 21190
272 Ga0395901_0015037 3300038443 Bacteria 7869
273 Ga0395901_0165042 3300038443 Bacteria 2325
274 Ga0395901_0326565 3300038443 Bacteria 1587
275 Ga0395901_0504816 3300038443 Bacteria 1231
276 Ga0395901_0521359 3300038443 Bacteria 1207
277 Ga0395901_0523228 3300038443 Bacteria 1205
278 Ga0395901_0542643 3300038443 Bacteria 1179
279 Ga0395901_0716263 3300038443 Bacteria 997
280 Ga0436360_0978461 3300039438 Bacteria 1461
281 Ga0436360_0996113 3300039438 Unclassified 1159
282 Ga0436362_1158851 3300039453 Bacteria 2629
283 Ga0439448_0014033 3300042005 Bacteria 2414
284 Ga0466969_0106550 3300044656 Bacteria 1315
285 Ga0466965_0126173 3300044683 Bacteria 1324
286 Ga0466966_0013353 3300044684 Bacteria 5436
287 Ga0466966_0022136 3300044684 Bacteria 4173
288 Ga0466966_0120984 3300044684 Bacteria 1608
289 Ga0466966_0168292 3300044684 Bacteria 1332
290 Ga0466961_0002717 3300044693 Bacteria 11002
291 Ga0466961_0029139 3300044693 Bacteria 3549
292 Ga0466961_0053667 3300044693 Bacteria 2571
293 Ga0466961_0106621 3300044693 Bacteria 1764
294 Ga0466961_0176426 3300044693 Bacteria 1327
295 Ga0466963_0000885 3300044694 Bacteria 15225
296 Ga0466963_0002401 3300044694 Bacteria 10473
297 Ga0466963_0003553 3300044694 Bacteria 8953
298 Ga0466963_0004822 3300044694 Bacteria 7865
299 Ga0466963_0006281 3300044694 Bacteria 7025
300 Ga0466963_0012943 3300044694 Bacteria 5114
301 Ga0466963_0015139 3300044694 Bacteria 4769
302 Ga0466963_0016858 3300044694 Bacteria 4548
303 Ga0466963_0016894 3300044694 Bacteria 4545
304 Ga0466963_0041545 3300044694 Bacteria 3016
305 Ga0466963_0041824 3300044694 Bacteria 3006
306 Ga0466963_0057670 3300044694 Bacteria 2586
307 Ga0466963_0299763 3300044694 Bacteria 1130
308 Ga0466963_0322374 3300044694 Bacteria 1087
309 Ga0466963_0494796 3300044694 Bacteria 863
310 Ga0466964_0000825 3300044706 Bacteria 10136
311 Ga0466964_0002060 3300044706 Bacteria 7074
312 Ga0466964_0005941 3300044706 Bacteria 4546
313 Ga0466964_0008596 3300044706 Bacteria 3838
314 Ga0466964_0010551 3300044706 Bacteria 3485
315 Ga0466964_0051019 3300044706 Bacteria 1698
316 Ga0466964_0053541 3300044706 Bacteria 1661
317 Ga0466964_0079453 3300044706 Bacteria 1405
318 Ga0466971_0003087 3300044719 Bacteria 7079
319 Ga0466971_0003696 3300044719 Bacteria 6541
320 Ga0466971_0020157 3300044719 Bacteria 2964
321 Ga0466971_0023628 3300044719 Bacteria 2741
322 Ga0466971_0039125 3300044719 Bacteria 2129
323 Ga0466971_0052851 3300044719 Bacteria 1830
324 Ga0466971_0096371 3300044719 Bacteria 1357
325 Ga0466968_0007081 3300044735 Bacteria 4253
326 Ga0466968_0018370 3300044735 Bacteria 2804
327 Ga0466968_0039965 3300044735 Bacteria 1976
328 Ga0466957_0007928 3300044842 Bacteria 6024
329 Ga0466957_0008096 3300044842 Bacteria 5964
330 Ga0466957_0011854 3300044842 Bacteria 5038
331 Ga0466957_0012738 3300044842 Bacteria 4873
332 Ga0466957_0079534 3300044842 Bacteria 2040
333 Ga0466957_0330875 3300044842 Unclassified 1030
334 Ga0466957_0367418 3300044842 Unclassified 979
335 Ga0466960_0008413 3300044901 Bacteria 4225
336 Ga0466959_0004417 3300045049 Bacteria 9414
337 Ga0466959_0005574 3300045049 Bacteria 8647
338 Ga0466959_0015076 3300045049 Bacteria 5630
339 Ga0466959_0108779 3300045049 Bacteria 1980
340 Ga0466959_0267947 3300045049 Bacteria 1174
341 Ga0451576_0122609 3300045051 Bacteria 2706
342 Ga0466958_0000921 3300045836 Bacteria 13229
343 Ga0466958_0001307 3300045836 Bacteria 11730
344 Ga0466958_0004001 3300045836 Bacteria 7727
345 Ga0466958_0013947 3300045836 Bacteria 4582
346 Ga0466958_0027857 3300045836 Bacteria 3345
347 Ga0466958_0032616 3300045836 Bacteria 3099
348 Ga0466958_0036282 3300045836 Bacteria 2950
349 Ga0466958_0053833 3300045836 Bacteria 2440
350 Ga0466958_0113817 3300045836 Bacteria 1690
351 Ga0466967_0000305 3300045976 Bacteria 22092
352 Ga0466967_0004124 3300045976 Bacteria 9710
353 Ga0466967_0004340 3300045976 Bacteria 9538
354 Ga0466967_0004811 3300045976 Bacteria 9203
355 Ga0466967_0006003 3300045976 Bacteria 8532
356 Ga0466967_0008963 3300045976 Bacteria 7388
357 Ga0466967_0014089 3300045976 Bacteria 6212
358 Ga0466967_0018327 3300045976 Bacteria 5591
359 Ga0466967_0021073 3300045976 Bacteria 5282
360 Ga0466967_0040972 3300045976 Bacteria 3989
361 Ga0466967_0081776 3300045976 Bacteria 2918
362 Ga0466967_0109183 3300045976 Bacteria 2540
363 Ga0466967_0116726 3300045976 Bacteria 2459
364 Ga0466967_0136807 3300045976 Bacteria 2279
365 Ga0466967_0157099 3300045976 Bacteria 2131
366 Ga0466967_0166704 3300045976 Bacteria 2070
367 Ga0466967_0177617 3300045976 Bacteria 2006
368 Ga0466967_0192283 3300045976 Bacteria 1929
369 Ga0466967_0201341 3300045976 Bacteria 1886
370 Ga0466967_0281269 3300045976 Bacteria 1596
371 Ga0466967_0388324 3300045976 Bacteria 1356
372 Ga0466967_0670408 3300045976 Bacteria 1026
373 Ga0495617_062445 3300046452 Bacteria 1231
374 Ga0495592_0000100 3300046454 Bacteria 76535
375 Ga0495592_0017698 3300046454 Bacteria 5414
376 Ga0495592_0018729 3300046454 Bacteria 5269
377 Ga0495592_0170180 3300046454 Bacteria 1492
378 Ga0495603_0008836 3300046455 Bacteria 6090
379 Ga0495603_0145107 3300046455 Bacteria 1380
380 Ga0495603_0294702 3300046455 Bacteria 932
381 Ga0495629_0005062 3300046459 Bacteria 9864
382 Ga0495629_0029070 3300046459 Bacteria 3922
383 Ga0495629_0055500 3300046459 Bacteria 2770
384 Ga0495629_0126534 3300046459 Bacteria 1780
385 Ga0495641_0005502 3300046461 Bacteria 8524
386 Ga0495641_0027909 3300046461 Bacteria 2737
387 Ga0495641_0030160 3300046461 Bacteria 2604
388 Ga0495641_0069780 3300046461 Bacteria 1579
389 Ga0495641_0077294 3300046461 Bacteria 1492
390 Ga0495651_0000008 3300046462 Bacteria 156989
391 Ga0495651_0011313 3300046462 Bacteria 6858
392 Ga0495651_0051621 3300046462 Bacteria 3169
393 Ga0495651_0098477 3300046462 Bacteria 2182
394 Ga0495651_0108425 3300046462 Bacteria 2057
395 Ga0495653_0000519 3300046463 Bacteria 29635
396 Ga0495653_0017412 3300046463 Bacteria 5845
397 Ga0495653_0051140 3300046463 Bacteria 3174
398 Ga0495653_0051798 3300046463 Bacteria 3149
399 Ga0495580_0195492 3300046472 Bacteria 1394
400 Ga0495582_0041484 3300046473 Bacteria 2535
401 Ga0495582_0053447 3300046473 Bacteria 2228
402 Ga0495639_0003153 3300046475 Bacteria 7163
403 Ga0495662_0012890 3300046476 Bacteria 4072
404 Ga0495662_0038565 3300046476 Bacteria 2309
405 Ga0495664_0030004 3300046477 Bacteria 3183
406 Ga0495664_0052144 3300046477 Bacteria 2430
407 Ga0495664_0235925 3300046477 Bacteria 1106
408 Ga0495594_0149967 3300046499 Bacteria 1324
409 Ga0495594_0256619 3300046499 Bacteria 996
410 Ga0495607_0043367 3300046501 Bacteria 2660
411 Ga0495608_0002853 3300046511 Bacteria 12379
412 Ga0495608_0025390 3300046511 Bacteria 4045
413 Ga0495608_0077922 3300046511 Bacteria 2157
414 Ga0495616_0066386 3300046513 Bacteria 1755
415 Ga0495618_0008107 3300046514 Bacteria 6362
416 Ga0495618_0136278 3300046514 Bacteria 1570
417 Ga0495628_0001255 3300046516 Bacteria 23210
418 Ga0495628_0037095 3300046516 Bacteria 3908
419 Ga0495628_0061568 3300046516 Bacteria 2943
420 Ga0495628_0112492 3300046516 Bacteria 2093
421 Ga0495630_0004222 3300046517 Bacteria 10066
422 Ga0495630_0106281 3300046517 Bacteria 2125
423 Ga0495630_0242954 3300046517 Bacteria 1375
424 Ga0495630_0267466 3300046517 Bacteria 1306
425 Ga0495637_0100543 3300046520 Bacteria 1130
426 Ga0495666_0008985 3300046526 Bacteria 4998
427 Ga0495666_0048603 3300046526 Bacteria 2043
428 Ga0495652_0000888 3300046529 Bacteria 34393
429 Ga0495652_0023777 3300046529 Bacteria 5430
430 Ga0495652_0077879 3300046529 Bacteria 2746
431 Ga0495652_0145473 3300046529 Bacteria 1858
432 Ga0495652_0228700 3300046529 Bacteria 1393
433 Ga0495652_0390283 3300046529 Bacteria 988
434 Ga0495665_0024266 3300046531 Bacteria 3257
435 Ga0495640_0023163 3300046533 Bacteria 4532
436 Ga0495640_0049832 3300046533 Bacteria 2886
437 Ga0495640_0180425 3300046533 Bacteria 1346
438 Ga0495640_0206417 3300046533 Bacteria 1243
439 Ga0495640_0466177 3300046533 Bacteria 770
440 Ga0495586_0029182 3300046535 Bacteria 2952
441 Ga0495586_0083485 3300046535 Bacteria 1758
442 Ga0495587_0000048 3300046536 Bacteria 105358
443 Ga0495587_0015646 3300046536 Bacteria 4732
444 Ga0495587_0073265 3300046536 Bacteria 1990
445 Ga0495621_0010505 3300046539 Bacteria 2835
446 Ga0495645_0000029 3300046543 Bacteria 113119
447 Ga0495667_0045237 3300046559 Bacteria 2915
448 Ga0495667_0199571 3300046559 Bacteria 1281
449 Ga0495656_0196317 3300046615 Bacteria 999
450 Ga0495634_0038422 3300046642 Bacteria 3264
451 Ga0495634_0052476 3300046642 Bacteria 2733
452 Ga0495634_0070558 3300046642 Bacteria 2302
453 Ga0495635_0085222 3300046663 Bacteria 2161
454 Ga0495635_0227649 3300046663 Bacteria 1260
455 Ga0495635_0368112 3300046663 Unclassified 957
456 Ga0495659_0051673 3300046664 Bacteria 1497
457 Ga0495661_0199409 3300046665 Bacteria 1049
458 Ga0495657_0021277 3300046675 Bacteria 4655
459 Ga0495657_0030470 3300046675 Bacteria 3778
460 Ga0495599_0000181 3300046678 Bacteria 41303
461 Ga0495599_0067613 3300046678 Bacteria 2231
462 Ga0495599_0248550 3300046678 Bacteria 1083
463 Ga0495623_0000093 3300046679 Bacteria 53441
464 Ga0495646_0000416 3300046680 Bacteria 22540
465 Ga0495646_0028309 3300046680 Bacteria 3510
466 Ga0495647_0001300 3300046681 Bacteria 7679
467 Ga0495647_0020209 3300046681 Bacteria 2388
468 Ga0495647_0033737 3300046681 Bacteria 1914
469 Ga0495658_0001970 3300046683 Bacteria 10482
470 Ga0495658_0201661 3300046683 Bacteria 1240
471 Ga0495658_0206876 3300046683 Bacteria 1225
472 Ga0495613_0014418 3300046689 Bacteria 5867
473 Ga0495613_0047036 3300046689 Bacteria 3187
474 Ga0495613_0085226 3300046689 Bacteria 2293
475 Ga0495613_0171918 3300046689 Bacteria 1537
476 Ga0495613_0264661 3300046689 Bacteria 1197
477 Ga0495624_0014510 3300046690 Bacteria 5345
478 Ga0495671_0053023 3300046692 Bacteria 2014
479 Ga0495649_0187671 3300046694 Bacteria 1077
480 Ga0495600_0015460 3300046809 Bacteria 4824
481 Ga0495600_0105289 3300046809 Bacteria 1838
482 Ga0495600_0214565 3300046809 Bacteria 1232
483 Ga0495600_0398322 3300046809 Bacteria 857
484 Ga0495581_0019626 3300047315 Bacteria 3923
485 Ga0495604_0000111 3300047317 Bacteria 68576
486 Ga0495604_0048288 3300047317 Bacteria 3311
487 Ga0495674_0001135 3300047319 Bacteria 25640
488 Ga0495674_0038310 3300047319 Bacteria 4304
489 Ga0495674_0054134 3300047319 Bacteria 3525
490 Ga0495674_0346472 3300047319 Bacteria 1206
491 Ga0495676_0145078 3300047321 Bacteria 1696
492 Ga0495676_0423062 3300047321 Bacteria 881
493 Ga0495680_0004067 3300047322 Bacteria 14091
494 Ga0495680_0013832 3300047322 Bacteria 7021
495 Ga0495680_0014786 3300047322 Bacteria 6747
496 Ga0495680_0035276 3300047322 Bacteria 4030
497 Ga0495680_0102533 3300047322 Bacteria 2130
498 Ga0495680_0323500 3300047322 Unclassified 1079
499 Ga0495675_0000376 3300047444 Bacteria 30923
500 Ga0495675_0218968 3300047444 Bacteria 1153
501 Ga0495677_0082603 3300047445 Unclassified 1205
502 Ga0495679_028633 3300047446 Bacteria 1826
503 Ga0495681_0089023 3300047470 Bacteria 1366
504 Ga0495684_0074669 3300047471 Bacteria 2576
505 Ga0495684_0079530 3300047471 Bacteria 2489
506 Ga0495684_0100983 3300047471 Bacteria 2181
507 Ga0495684_0165161 3300047471 Bacteria 1649
508 Ga0495684_0224606 3300047471 Bacteria 1375
509 Ga0495593_0017423 3300047673 Bacteria 4043
510 Ga0495602_0000141 3300048088 Bacteria 67940
511 Ga0495602_0006548 3300048088 Bacteria 12215
512 Ga0495602_0163369 3300048088 Bacteria 1736
513 Ga0495602_0234079 3300048088 Bacteria 1378
514 Ga0495602_0330272 3300048088 Bacteria 1106
515 Ga0495614_0006610 3300048089 Bacteria 5191
516 Ga0496100_0011703 3300048903 Bacteria 5001
517 Ga0496101_0009494 3300048904 Bacteria 6395
518 Ga0496101_0209701 3300048904 Bacteria 1509
519 Ga0496102_0010283 3300048905 Bacteria 8045
520 Ga0496102_0052433 3300048905 Bacteria 3717
521 Ga0496102_0098707 3300048905 Bacteria 2710
522 Ga0496103_0242629 3300048906 Unclassified 1159
523 Ga0496104_0033091 3300048907 Bacteria 4812
524 Ga0496104_0169746 3300048907 Bacteria 2092
525 Ga0496104_0194645 3300048907 Bacteria 1939
526 Ga0496104_0423891 3300048907 Bacteria 1242
527 Ga0496104_0657728 3300048907 Bacteria 957
528 Ga0496104_0918498 3300048907 Bacteria 780
529 Ga0496105_0003059 3300048908 Bacteria 12294
530 Ga0496105_0101922 3300048908 Bacteria 2370
531 Ga0496105_0215519 3300048908 Bacteria 1564
532 Ga0496106_0011036 3300048909 Bacteria 6678
533 Ga0496107_0007244 3300048910 Bacteria 7640
534 Ga0496107_0009675 3300048910 Bacteria 6684
535 Ga0496107_0067729 3300048910 Bacteria 2591
536 Ga0496107_0200107 3300048910 Unclassified 1485
537 Ga0496107_0396066 3300048910 Bacteria 1027
538 Ga0496108_0010155 3300048911 Bacteria 7641
539 Ga0496108_0014451 3300048911 Bacteria 6447
540 Ga0496108_0016271 3300048911 Bacteria 6064
541 Ga0496108_0084587 3300048911 Bacteria 2692
542 Ga0496108_0090972 3300048911 Bacteria 2594
543 Ga0496108_0549935 3300048911 Unclassified 1007
544 Ga0496109_0000991 3300048912 Bacteria 23430
545 Ga0496109_0023115 3300048912 Bacteria 5515
546 Ga0496109_0186223 3300048912 Bacteria 1950
547 Ga0496110_0001407 3300048913 Bacteria 17382
548 Ga0496110_0067762 3300048913 Bacteria 3158
549 Ga0496110_0092761 3300048913 Bacteria 2702
550 Ga0496110_0150439 3300048913 Bacteria 2107
551 Ga0496110_0274830 3300048913 Unclassified 1534
552 Ga0496111_0000429 3300048914 Bacteria 21251
553 Ga0496111_0066912 3300048914 Bacteria 2610
554 Ga0496112_0031945 3300048915 Bacteria 5110
555 Ga0496112_0036861 3300048915 Bacteria 4770
556 Ga0496112_0051056 3300048915 Bacteria 4056
557 Ga0496113_0038669 3300048916 Bacteria 3508
558 Ga0496114_0001144 3300048917 Bacteria 20053
559 Ga0496114_0014134 3300048917 Bacteria 6402
560 Ga0496114_0014487 3300048917 Bacteria 6333
561 Ga0496114_0120943 3300048917 Bacteria 2252
562 Ga0496114_0216492 3300048917 Bacteria 1681
563 Ga0496115_0007850 3300048918 Bacteria 7869
564 Ga0496115_0036527 3300048918 Bacteria 3891
565 Ga0496115_0112564 3300048918 Bacteria 2236
566 Ga0501031_0264377 3300049568 Bacteria 1118
567 Ga0501033_0266425 3300049570 Bacteria 1212
568 Ga0501034_0045663 3300049571 Bacteria 4426
569 Ga0501036_0007319 3300049572 Bacteria 8990
570 Ga0501036_0138452 3300049572 Bacteria 2054
571 Ga0501039_0411487 3300049575 Bacteria 1062
572 Ga0501040_0050379 3300049576 Bacteria 2848
573 Ga0501040_0175425 3300049576 Bacteria 1519
574 Ga0501042_0003743 3300049578 Bacteria 9613
575 Ga0501048_0004195 3300049582 Bacteria 10986
576 Ga0501048_0071535 3300049582 Bacteria 2449
577 Ga0501067_0007338 3300049583 Bacteria 6124
578 Ga0501067_0039357 3300049583 Bacteria 2625
579 Ga0501067_0194885 3300049583 Bacteria 1129
580 Ga0501068_0007032 3300049584 Bacteria 6227
581 Ga0501069_0034203 3300049585 Bacteria 2799
582 Ga0501069_0041023 3300049585 Bacteria 2557
583 Ga0501069_0118502 3300049585 Bacteria 1511
584 Ga0501070_0008618 3300049586 Bacteria 8623
585 Ga0501070_0022041 3300049586 Bacteria 5336
586 Ga0501070_0334836 3300049586 Bacteria 1230
587 Ga0501071_0015826 3300049587 Bacteria 5182
588 Ga0501071_0114557 3300049587 Bacteria 1994
589 Ga0501071_0130527 3300049587 Bacteria 1866
590 Ga0501072_0036462 3300049588 Bacteria 3855
591 Ga0501072_0112317 3300049588 Bacteria 2169
592 Ga0501074_0081053 3300049590 Bacteria 2327
593 Ga0501075_0019960 3300049591 Bacteria 4867
594 Ga0501075_0273321 3300049591 Bacteria 1288
595 Ga0501076_0005282 3300049592 Bacteria 9259
596 Ga0501077_0141612 3300049593 Bacteria 1525
597 Ga0501079_0105989 3300049741 Bacteria 2181
598 Ga0501079_0213822 3300049741 Bacteria 1506
599 Ga0501080_0013880 3300049742 Bacteria 7415
600 Ga0501081_0005311 3300049743 Bacteria 8308
601 Ga0501081_0041666 3300049743 Bacteria 3145
602 Ga0501081_0173027 3300049743 Bacteria 1560
603 Ga0501081_0236950 3300049743 Bacteria 1330
604 Ga0501083_0000131 3300049744 Bacteria 51265
605 Ga0501045_0002356 3300049824 Bacteria 12832
606 Ga0501045_0028746 3300049824 Bacteria 4012
607 Ga0501045_0310890 3300049824 Bacteria 1173
608 nmdc:mga05p37_422341_c1 3300050507 Bacteria 1551
609 nmdc:mga08y16_239391_c1 3300050511 Bacteria 1876
610 nmdc:mga0n895_158846_c1 3300050512 Bacteria 2292
611 nmdc:mga0n895_261218_c1 3300050512 Bacteria 1757
612 nmdc:mga08x19_161148_c1 3300050514 Bacteria 1523
613 nmdc:mga0a205_154640_c1 3300050515 Bacteria 2192
614 Ga0495601_0000206 3300053077 Bacteria 31438
615 Ga0495601_0032201 3300053077 Bacteria 3263
616 Ga0495601_0127526 3300053077 Bacteria 1656
617 Ga0495601_0281390 3300053077 Bacteria 1084
618 Ga0495612_0018875 3300053078 Bacteria 2760
619 Ga0495612_0060199 3300053078 Bacteria 1571
620 Ga0495595_0005617 3300053084 Bacteria 5076
621 Ga0495595_0101287 3300053084 Bacteria 1390
622 Ga0495595_0143483 3300053084 Unclassified 1172
623 Ga0495595_0274427 3300053084 Bacteria 846
624 Ga0495619_0000291 3300053085 Bacteria 35704
625 Ga0495619_0039474 3300053085 Bacteria 3082
626 Ga0495619_0055761 3300053085 Bacteria 2618
627 Ga0495619_0126975 3300053085 Bacteria 1751
628 Ga0501084_0030386 3300054114 Bacteria 4518
629 Ga0501084_0587171 3300054114 Bacteria 941
630 Ga0466962_0010625 3300061719 Bacteria 4429
631 Ga0466962_0018368 3300061719 Bacteria 3363
632 Ga0466962_0100401 3300061719 Bacteria 1389
633 Ga0466962_0112165 3300061719 Bacteria 1313
634 Ga0466962_0139429 3300061719 Unclassified 1174
635 Ga0530510_0004716 3300061734 Bacteria 9432
636 Ga0530510_0085011 3300061734 Bacteria 2305
637 Ga0530510_0098832 3300061734 Bacteria 2134
638 Ga0530510_0105334 3300061734 Bacteria 2064
639 Ga0530510_0194938 3300061734 Bacteria 1504

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053084 Ga0495595_0274427 Ga0495595_0274427_37_651 171
2 3300048088 Ga0495602_0234079 Ga0495602_0234079_449_1285 186
3 3300053077 Ga0495601_0032201 Ga0495601_0032201_1657_2493 186
4 3300028666 Ga0265336_10005714 Ga0265336_100057146 188
5 3300044684 Ga0466966_0120984 Ga0466966_0120984_304_1098 190
6 3300028800 Ga0265338_10054250 Ga0265338_100542501 193
7 3300044694 Ga0466963_0494796 Ga0466963_0494796_147_839 194
8 3300048918 Ga0496115_0036527 Ga0496115_0036527_2236_2922 195
9 3300028563 Ga0265319_1037147 Ga0265319_10371472 196
10 3300045049 Ga0466959_0267947 Ga0466959_0267947_217_1011 197
11 3300045836 Ga0466958_0013947 Ga0466958_0013947_2734_3528 197
12 3300038443 Ga0395901_0504816 Ga0395901_0504816_82_873 198
13 3300046455 Ga0495603_0008836 Ga0495603_0008836_2866_3669 198
14 3300046461 Ga0495641_0030160 Ga0495641_0030160_1339_2142 198
15 3300005435 Ga0070714_100007459 Ga0070714_1000074595 200
16 3300005436 Ga0070713_100307065 Ga0070713_1003070652 200
17 3300005337 Ga0070682_100279765 Ga0070682_1002797652 201
18 3300005434 Ga0070709_10009642 Ga0070709_100096426 201
19 3300005435 Ga0070714_100117692 Ga0070714_1001176922 201
20 3300005436 Ga0070713_100018306 Ga0070713_1000183065 201
21 3300005437 Ga0070710_10000589 Ga0070710_1000058922 201
22 3300005439 Ga0070711_100006227 Ga0070711_1000062272 201
23 3300005440 Ga0070705_100184259 Ga0070705_1001842592 201
24 3300006028 Ga0070717_10013735 Ga0070717_100137353 201
25 3300006163 Ga0070715_10038666 Ga0070715_100386662 201
26 3300006173 Ga0070716_100007254 Ga0070716_1000072546 201
27 3300009101 Ga0105247_10196567 Ga0105247_101965672 201
28 3300009174 Ga0105241_10239060 Ga0105241_102390602 201
29 3300013296 Ga0157374_10011973 Ga0157374_100119733 201
30 3300025898 Ga0207692_10001763 Ga0207692_100017631 201
31 3300025900 Ga0207710_10115827 Ga0207710_101158272 201
32 3300025905 Ga0207685_10007005 Ga0207685_100070053 201
33 3300025906 Ga0207699_10007743 Ga0207699_100077431 201
34 3300025911 Ga0207654_10218272 Ga0207654_102182722 201
35 3300025915 Ga0207693_10000662 Ga0207693_100006628 201
36 3300025916 Ga0207663_10000565 Ga0207663_1000056521 201
37 3300025928 Ga0207700_10003047 Ga0207700_1000304712 201
38 3300025929 Ga0207664_10012742 Ga0207664_100127422 201
39 3300025931 Ga0207644_10582684 Ga0207644_105826842 201
40 3300025939 Ga0207665_10000060 Ga0207665_1000006076 201
41 3300035691 Ga0373931_0053043 Ga0373931_0053043_1200_2003 201
42 3300044693 Ga0466961_0029139 Ga0466961_0029139_539_1342 201
43 3300044694 Ga0466963_0012943 Ga0466963_0012943_2944_3747 201
44 3300044719 Ga0466971_0003087 Ga0466971_0003087_1172_1975 201
45 3300044735 Ga0466968_0018370 Ga0466968_0018370_1642_2478 201
46 3300044842 Ga0466957_0012738 Ga0466957_0012738_2603_3406 201
47 3300045049 Ga0466959_0108779 Ga0466959_0108779_799_1602 201
48 3300048903 Ga0496100_0011703 Ga0496100_0011703_837_1640 201
49 3300048904 Ga0496101_0009494 Ga0496101_0009494_689_1492 201
50 3300048905 Ga0496102_0010283 Ga0496102_0010283_6113_6916 201
51 3300048907 Ga0496104_0194645 Ga0496104_0194645_864_1667 201
52 3300048907 Ga0496104_0918498 Ga0496104_0918498_48_761 201
53 3300048908 Ga0496105_0101922 Ga0496105_0101922_468_1271 201
54 3300048910 Ga0496107_0007244 Ga0496107_0007244_4553_5356 201
55 3300048911 Ga0496108_0010155 Ga0496108_0010155_6023_6826 201
56 3300048913 Ga0496110_0092761 Ga0496110_0092761_837_1640 201
57 3300048914 Ga0496111_0066912 Ga0496111_0066912_1458_2261 201
58 3300048915 Ga0496112_0036861 Ga0496112_0036861_3279_4082 201
59 3300048916 Ga0496113_0038669 Ga0496113_0038669_2433_3236 201
60 3300048917 Ga0496114_0001144 Ga0496114_0001144_6596_7399 201
61 3300048918 Ga0496115_0007850 Ga0496115_0007850_5704_6507 201
62 3300061719 Ga0466962_0018368 Ga0466962_0018368_199_1002 201
63 3300047321 Ga0495676_0423062 Ga0495676_0423062_24_731 202
64 3300013105 Ga0157369_10004504 Ga0157369_1000450420 204
65 3300025906 Ga0207699_10220737 Ga0207699_102207372 204
66 3300044656 Ga0466969_0106550 Ga0466969_0106550_116_919 204
67 3300044684 Ga0466966_0013353 Ga0466966_0013353_1942_2745 204
68 3300044693 Ga0466961_0002717 Ga0466961_0002717_8481_9284 204
69 3300045049 Ga0466959_0015076 Ga0466959_0015076_1972_2775 204
70 3300048915 Ga0496112_0051056 Ga0496112_0051056_881_1684 204
71 3300037312 Ga0395899_0009229 Ga0395899_0009229_4279_5118 205
72 3300037312 Ga0395899_0010571 Ga0395899_0010571_4579_5379 205
73 3300037418 Ga0395900_0069134 Ga0395900_0069134_2795_3595 205
74 3300037466 Ga0395898_0027338 Ga0395898_0027338_901_1701 205
75 3300037466 Ga0395898_0049132 Ga0395898_0049132_3027_3866 205
76 3300037471 Ga0395905_0007609 Ga0395905_0007609_8208_9047 205
77 3300037471 Ga0395905_0068364 Ga0395905_0068364_1206_2006 205
78 3300038443 Ga0395901_0015037 Ga0395901_0015037_962_1801 205
79 3300038443 Ga0395901_0165042 Ga0395901_0165042_320_1120 205
80 3300005329 Ga0070683_100155595 Ga0070683_1001555952 207
81 3300061734 Ga0530510_0098832 Ga0530510_0098832_567_1313 207
82 3300013105 Ga0157369_10048846 Ga0157369_100488463 208
83 3300049585 Ga0501069_0034203 Ga0501069_0034203_1865_2668 210
84 3300005985 Ga0081539_10000041 Ga0081539_1000004196 211
85 3300031548 Ga0307408_100264188 Ga0307408_1002641882 211
86 3300031824 Ga0307413_10009249 Ga0307413_100092495 211
87 3300031911 Ga0307412_10426189 Ga0307412_104261892 211
88 3300031995 Ga0307409_100014786 Ga0307409_1000147865 211
89 3300045049 Ga0466959_0005574 Ga0466959_0005574_4758_5582 211
90 3300046477 Ga0495664_0235925 Ga0495664_0235925_344_1087 211
91 3300046533 Ga0495640_0466177 Ga0495640_0466177_10_753 211
92 3300028573 Ga0265334_10008192 Ga0265334_100081924 212
93 3300028800 Ga0265338_10002058 Ga0265338_1000205833 212
94 3300031595 Ga0265313_10007875 Ga0265313_100078757 212
95 3300038443 Ga0395901_0542643 Ga0395901_0542643_65_865 212
96 3300044842 Ga0466957_0011854 Ga0466957_0011854_2018_2770 214
97 3300045976 Ga0466967_0021073 Ga0466967_0021073_3177_3929 214
98 3300048908 Ga0496105_0215519 Ga0496105_0215519_267_1070 215
99 3300048911 Ga0496108_0084587 Ga0496108_0084587_527_1330 215
100 3300048912 Ga0496109_0186223 Ga0496109_0186223_132_935 215
101 3300048913 Ga0496110_0067762 Ga0496110_0067762_1752_2555 215
102 3300048915 Ga0496112_0031945 Ga0496112_0031945_442_1245 215
103 3300048917 Ga0496114_0120943 Ga0496114_0120943_1248_2051 215
104 3300005459 Ga0068867_100521232 Ga0068867_1005212321 219
105 3300009098 Ga0105245_10463867 Ga0105245_104638671 219
106 3300010375 Ga0105239_10920759 Ga0105239_109207591 219
107 3300049583 Ga0501067_0039357 Ga0501067_0039357_807_1607 219
108 3300049584 Ga0501068_0007032 Ga0501068_0007032_5003_5803 219
109 3300049585 Ga0501069_0041023 Ga0501069_0041023_1070_1870 219
110 3300049586 Ga0501070_0334836 Ga0501070_0334836_203_1003 219
111 3300061734 Ga0530510_0194938 Ga0530510_0194938_130_930 219
112 3300047319 Ga0495674_0054134 Ga0495674_0054134_2733_3503 220
113 3300048905 Ga0496102_0052433 Ga0496102_0052433_59_862 220
114 3300048910 Ga0496107_0009675 Ga0496107_0009675_2930_3733 220
115 3300005458 Ga0070681_10240090 Ga0070681_102400902 221
116 3300005548 Ga0070665_100070154 Ga0070665_1000701542 221
117 3300009094 Ga0111539_10068910 Ga0111539_100689103 221
118 3300009147 Ga0114129_10128447 Ga0114129_101284472 221
119 3300028379 Ga0268266_10087708 Ga0268266_100877083 221
120 3300028800 Ga0265338_10100177 Ga0265338_101001772 221
121 3300048909 Ga0496106_0011036 Ga0496106_0011036_4707_5510 221
122 3300048913 Ga0496110_0150439 Ga0496110_0150439_355_1152 221
123 3300049572 Ga0501036_0007319 Ga0501036_0007319_7236_8036 221
124 3300049576 Ga0501040_0050379 Ga0501040_0050379_1405_2205 221
125 3300049578 Ga0501042_0003743 Ga0501042_0003743_1600_2400 221
126 3300049582 Ga0501048_0004195 Ga0501048_0004195_9606_10406 221
127 3300049587 Ga0501071_0015826 Ga0501071_0015826_4033_4833 221
128 3300049587 Ga0501071_0130527 Ga0501071_0130527_743_1543 221
129 3300049588 Ga0501072_0112317 Ga0501072_0112317_1337_2137 221
130 3300049590 Ga0501074_0081053 Ga0501074_0081053_1134_1934 221
131 3300049591 Ga0501075_0019960 Ga0501075_0019960_3478_4278 221
132 3300049592 Ga0501076_0005282 Ga0501076_0005282_103_903 221
133 3300049593 Ga0501077_0141612 Ga0501077_0141612_631_1431 221
134 3300049741 Ga0501079_0105989 Ga0501079_0105989_1282_2082 221
135 3300049743 Ga0501081_0005311 Ga0501081_0005311_241_1041 221
136 3300049743 Ga0501081_0173027 Ga0501081_0173027_549_1349 221
137 3300049824 Ga0501045_0002356 Ga0501045_0002356_3833_4633 221
138 3300054114 Ga0501084_0030386 Ga0501084_0030386_1936_2736 221
139 3300061734 Ga0530510_0004716 Ga0530510_0004716_1185_1985 221
140 3300045976 Ga0466967_0136807 Ga0466967_0136807_20_796 222
141 3300005330 Ga0070690_100100853 Ga0070690_1001008532 223
142 3300009093 Ga0105240_10009653 Ga0105240_100096532 223
143 3300048905 Ga0496102_0098707 Ga0496102_0098707_810_1589 223
144 3300048906 Ga0496103_0242629 Ga0496103_0242629_55_834 223
145 3300005468 Ga0070707_100153336 Ga0070707_1001533362 224
146 3300025922 Ga0207646_10202568 Ga0207646_102025682 224
147 3300044684 Ga0466966_0168292 Ga0466966_0168292_449_1252 224
148 3300044693 Ga0466961_0176426 Ga0466961_0176426_368_1171 224
149 3300044694 Ga0466963_0299763 Ga0466963_0299763_131_934 224
150 3300044719 Ga0466971_0003696 Ga0466971_0003696_4606_5409 224
151 3300044842 Ga0466957_0079534 Ga0466957_0079534_652_1455 224
152 3300045836 Ga0466958_0004001 Ga0466958_0004001_1826_2629 224
153 3300045836 Ga0466958_0113817 Ga0466958_0113817_212_994 224
154 3300046809 Ga0495600_0214565 Ga0495600_0214565_435_1217 224
155 3300061719 Ga0466962_0100401 Ga0466962_0100401_174_977 224
156 3300005327 Ga0070658_10039243 Ga0070658_100392432 225
157 3300009093 Ga0105240_10703432 Ga0105240_107034321 225
158 3300009551 Ga0105238_10572521 Ga0105238_105725212 225
159 3300013307 Ga0157372_10181793 Ga0157372_101817933 225
160 3300025909 Ga0207705_10001180 Ga0207705_100011802 225
161 3300025919 Ga0207657_10048812 Ga0207657_100488125 225
162 3300025944 Ga0207661_10019738 Ga0207661_100197386 225
163 3300028577 Ga0265318_10003094 Ga0265318_100030946 225
164 3300028654 Ga0265322_10064228 Ga0265322_100642282 225
165 3300031235 Ga0265330_10009834 Ga0265330_100098342 225
166 3300031238 Ga0265332_10018123 Ga0265332_100181232 225
167 3300031239 Ga0265328_10005742 Ga0265328_100057422 225
168 3300031240 Ga0265320_10010065 Ga0265320_100100656 225
169 3300031242 Ga0265329_10040737 Ga0265329_100407372 225
170 3300031247 Ga0265340_10013271 Ga0265340_100132713 225
171 3300031249 Ga0265339_10050781 Ga0265339_100507812 225
172 3300031251 Ga0265327_10010760 Ga0265327_100107606 225
173 3300031344 Ga0265316_10231805 Ga0265316_102318051 225
174 3300037312 Ga0395899_0030617 Ga0395899_0030617_1768_2571 225
175 3300037466 Ga0395898_0093913 Ga0395898_0093913_1226_2029 225
176 3300037471 Ga0395905_0413997 Ga0395905_0413997_354_1157 225
177 3300038443 Ga0395901_0716263 Ga0395901_0716263_61_864 225
178 3300049571 Ga0501034_0045663 Ga0501034_0045663_3509_4312 225
179 3300049586 Ga0501070_0008618 Ga0501070_0008618_1599_2402 225
180 3300049741 Ga0501079_0213822 Ga0501079_0213822_276_1079 225
181 3300049742 Ga0501080_0013880 Ga0501080_0013880_2485_3288 225
182 3300005467 Ga0070706_100382290 Ga0070706_1003822902 226
183 3300005471 Ga0070698_100383323 Ga0070698_1003833232 226
184 3300006871 Ga0075434_100266280 Ga0075434_1002662802 226
185 3300025909 Ga0207705_10056857 Ga0207705_100568571 226
186 3300049583 Ga0501067_0194885 Ga0501067_0194885_148_951 226
187 3300049586 Ga0501070_0022041 Ga0501070_0022041_2167_2970 226
188 3300049588 Ga0501072_0036462 Ga0501072_0036462_1984_2787 226
189 3300049744 Ga0501083_0000131 Ga0501083_0000131_13947_14750 226
190 3300050512 nmdc:mga0n895_261218_c1 nmdc:mga0n895_261218_c1_403_1242 226
191 3300054114 Ga0501084_0587171 Ga0501084_0587171_12_815 226
192 3300009551 Ga0105238_10056734 Ga0105238_100567344 227
193 3300013307 Ga0157372_10888891 Ga0157372_108888912 227
194 3300025919 Ga0207657_10000739 Ga0207657_1000073912 227
195 3300025932 Ga0207690_10306303 Ga0207690_103063032 227
196 3300045051 Ga0451576_0122609 Ga0451576_0122609_1293_2093 227
197 3300046501 Ga0495607_0043367 Ga0495607_0043367_166_966 227
198 3300046664 Ga0495659_0051673 Ga0495659_0051673_616_1416 227
199 3300049568 Ga0501031_0264377 Ga0501031_0264377_254_1042 227
200 3300049570 Ga0501033_0266425 Ga0501033_0266425_203_991 227
201 3300049572 Ga0501036_0138452 Ga0501036_0138452_49_837 227
202 3300049575 Ga0501039_0411487 Ga0501039_0411487_138_926 227
203 3300049576 Ga0501040_0175425 Ga0501040_0175425_145_933 227
204 3300049582 Ga0501048_0071535 Ga0501048_0071535_1348_2136 227
205 3300049587 Ga0501071_0114557 Ga0501071_0114557_352_1140 227
206 3300049743 Ga0501081_0041666 Ga0501081_0041666_638_1426 227
207 3300049824 Ga0501045_0028746 Ga0501045_0028746_230_1018 227
208 3300050507 nmdc:mga05p37_422341_c1 nmdc:mga05p37_422341_c1_610_1410 227
209 3300005937 Ga0081455_10031319 Ga0081455_100313194 228
210 3300042005 Ga0439448_0014033 Ga0439448_0014033_1413_2213 228
211 3300046452 Ga0495617_062445 Ga0495617_062445_271_1071 228
212 3300046513 Ga0495616_0066386 Ga0495616_0066386_67_867 228
213 3300046520 Ga0495637_0100543 Ga0495637_0100543_128_928 228
214 3300046539 Ga0495621_0010505 Ga0495621_0010505_1029_1829 228
215 3300046692 Ga0495671_0053023 Ga0495671_0053023_752_1552 228
216 3300046694 Ga0495649_0187671 Ga0495649_0187671_250_1050 228
217 3300047445 Ga0495677_0082603 Ga0495677_0082603_163_963 228
218 3300047446 Ga0495679_028633 Ga0495679_028633_86_886 228
219 3300047470 Ga0495681_0089023 Ga0495681_0089023_55_855 228
220 3300005981 Ga0081538_10007438 Ga0081538_100074389 229
221 3300005981 Ga0081538_10035380 Ga0081538_100353802 229
222 3300009094 Ga0111539_10004030 Ga0111539_100040308 229
223 3300009147 Ga0114129_10062927 Ga0114129_100629273 229
224 3300046689 Ga0495613_0264661 Ga0495613_0264661_310_1104 229
225 3300005329 Ga0070683_100007546 Ga0070683_10000754614 230
226 3300005336 Ga0070680_100246477 Ga0070680_1002464772 230
227 3300005338 Ga0068868_100406575 Ga0068868_1004065752 230
228 3300005341 Ga0070691_10098492 Ga0070691_100984922 230
229 3300005367 Ga0070667_100033005 Ga0070667_1000330052 230
230 3300005459 Ga0068867_100239083 Ga0068867_1002390832 230
231 3300005535 Ga0070684_100036287 Ga0070684_1000362874 230
232 3300005535 Ga0070684_100280526 Ga0070684_1002805262 230
233 3300005563 Ga0068855_100199484 Ga0068855_1001994842 230
234 3300005564 Ga0070664_100063384 Ga0070664_1000633842 230
235 3300005578 Ga0068854_100333152 Ga0068854_1003331522 230
236 3300005614 Ga0068856_100493987 Ga0068856_1004939871 230
237 3300005618 Ga0068864_100792099 Ga0068864_1007920991 230
238 3300010375 Ga0105239_10157109 Ga0105239_101571092 230
239 3300013105 Ga0157369_10205378 Ga0157369_102053782 230
240 3300013308 Ga0157375_10310775 Ga0157375_103107752 230
241 3300014968 Ga0157379_10108207 Ga0157379_101082073 230
242 3300021358 Ga0213873_10039324 Ga0213873_100393241 230
243 3300021441 Ga0213871_10061727 Ga0213871_100617272 230
244 3300025901 Ga0207688_10139234 Ga0207688_101392342 230
245 3300025919 Ga0207657_10340144 Ga0207657_103401442 230
246 3300025921 Ga0207652_10480204 Ga0207652_104802041 230
247 3300025933 Ga0207706_10183969 Ga0207706_101839691 230
248 3300025937 Ga0207669_10194565 Ga0207669_101945652 230
249 3300025942 Ga0207689_10102116 Ga0207689_101021163 230
250 3300025981 Ga0207640_10428243 Ga0207640_104282432 230
251 3300025986 Ga0207658_10014892 Ga0207658_100148923 230
252 3300026023 Ga0207677_10224757 Ga0207677_102247572 230
253 3300026116 Ga0207674_10056193 Ga0207674_100561934 230
254 3300028800 Ga0265338_10075399 Ga0265338_100753993 230
255 3300031731 Ga0307405_10064978 Ga0307405_100649782 230
256 3300037312 Ga0395899_0001267 Ga0395899_0001267_8120_8920 230
257 3300037418 Ga0395900_0003489 Ga0395900_0003489_13131_13931 230
258 3300037466 Ga0395898_0001276 Ga0395898_0001276_11449_12249 230
259 3300037471 Ga0395905_0001281 Ga0395905_0001281_13788_14588 230
260 3300038443 Ga0395901_0001957 Ga0395901_0001957_7960_8760 230
261 3300039438 Ga0436360_0996113 Ga0436360_0996113_292_1083 230
262 3300039453 Ga0436362_1158851 Ga0436362_1158851_1296_2087 230
263 3300044693 Ga0466961_0106621 Ga0466961_0106621_471_1265 230
264 3300044706 Ga0466964_0002060 Ga0466964_0002060_278_1081 230
265 3300044706 Ga0466964_0053541 Ga0466964_0053541_193_984 230
266 3300045976 Ga0466967_0006003 Ga0466967_0006003_5029_5832 230
267 3300045976 Ga0466967_0192283 Ga0466967_0192283_190_981 230
268 3300045976 Ga0466967_0388324 Ga0466967_0388324_133_930 230
269 3300046454 Ga0495592_0170180 Ga0495592_0170180_102_893 230
270 3300046459 Ga0495629_0055500 Ga0495629_0055500_1229_2020 230
271 3300046461 Ga0495641_0077294 Ga0495641_0077294_148_939 230
272 3300046462 Ga0495651_0011313 Ga0495651_0011313_1140_1931 230
273 3300046477 Ga0495664_0052144 Ga0495664_0052144_790_1581 230
274 3300046511 Ga0495608_0077922 Ga0495608_0077922_264_1055 230
275 3300046516 Ga0495628_0061568 Ga0495628_0061568_2020_2811 230
276 3300046517 Ga0495630_0004222 Ga0495630_0004222_3967_4758 230
277 3300046526 Ga0495666_0048603 Ga0495666_0048603_876_1667 230
278 3300046533 Ga0495640_0023163 Ga0495640_0023163_1032_1823 230
279 3300046642 Ga0495634_0052476 Ga0495634_0052476_532_1323 230
280 3300046678 Ga0495599_0248550 Ga0495599_0248550_193_984 230
281 3300046689 Ga0495613_0014418 Ga0495613_0014418_1542_2333 230
282 3300046809 Ga0495600_0105289 Ga0495600_0105289_894_1685 230
283 3300047319 Ga0495674_0001135 Ga0495674_0001135_19410_20201 230
284 3300047322 Ga0495680_0004067 Ga0495680_0004067_13222_14013 230
285 3300047471 Ga0495684_0165161 Ga0495684_0165161_672_1463 230
286 3300048088 Ga0495602_0330272 Ga0495602_0330272_173_964 230
287 3300048904 Ga0496101_0209701 Ga0496101_0209701_673_1476 230
288 3300048907 Ga0496104_0169746 Ga0496104_0169746_352_1149 230
289 3300048910 Ga0496107_0067729 Ga0496107_0067729_1062_1862 230
290 3300048911 Ga0496108_0014451 Ga0496108_0014451_245_1045 230
291 3300048911 Ga0496108_0549935 Ga0496108_0549935_129_932 230
292 3300048912 Ga0496109_0000991 Ga0496109_0000991_18289_19089 230
293 3300048913 Ga0496110_0001407 Ga0496110_0001407_6777_7577 230
294 3300048914 Ga0496111_0000429 Ga0496111_0000429_13468_14268 230
295 3300048918 Ga0496115_0112564 Ga0496115_0112564_473_1270 230
296 3300049591 Ga0501075_0273321 Ga0501075_0273321_179_976 230
297 3300053085 Ga0495619_0126975 Ga0495619_0126975_331_1122 230
298 3300061734 Ga0530510_0105334 Ga0530510_0105334_545_1384 230
299 3300005327 Ga0070658_10014188 Ga0070658_100141885 231
300 3300005329 Ga0070683_100003014 Ga0070683_10000301417 231
301 3300005334 Ga0068869_100036551 Ga0068869_1000365512 231
302 3300005336 Ga0070680_100092377 Ga0070680_1000923773 231
303 3300005339 Ga0070660_100036788 Ga0070660_1000367885 231
304 3300005344 Ga0070661_100013123 Ga0070661_1000131232 231
305 3300005435 Ga0070714_100114075 Ga0070714_1001140753 231
306 3300005435 Ga0070714_100207512 Ga0070714_1002075122 231
307 3300005435 Ga0070714_100584308 Ga0070714_1005843081 231
308 3300005437 Ga0070710_10006973 Ga0070710_100069736 231
309 3300005445 Ga0070708_100650847 Ga0070708_1006508472 231
310 3300005458 Ga0070681_10011454 Ga0070681_100114541 231
311 3300005458 Ga0070681_10020004 Ga0070681_100200044 231
312 3300005458 Ga0070681_10034201 Ga0070681_100342014 231
313 3300005468 Ga0070707_100001400 Ga0070707_10000140018 231
314 3300005468 Ga0070707_100111218 Ga0070707_1001112184 231
315 3300005471 Ga0070698_100056389 Ga0070698_1000563892 231
316 3300005530 Ga0070679_100019792 Ga0070679_1000197926 231
317 3300005530 Ga0070679_100089465 Ga0070679_1000894653 231
318 3300005530 Ga0070679_100125102 Ga0070679_1001251023 231
319 3300005535 Ga0070684_100004862 Ga0070684_1000048624 231
320 3300005535 Ga0070684_100373638 Ga0070684_1003736382 231
321 3300005545 Ga0070695_100000062 Ga0070695_10000006211 231
322 3300005563 Ga0068855_100010562 Ga0068855_10001056215 231
323 3300005614 Ga0068856_100344313 Ga0068856_1003443132 231
324 3300005618 Ga0068864_100303387 Ga0068864_1003033872 231
325 3300006028 Ga0070717_10011348 Ga0070717_100113485 231
326 3300006028 Ga0070717_10020225 Ga0070717_100202252 231
327 3300006028 Ga0070717_10203831 Ga0070717_102038312 231
328 3300006028 Ga0070717_10217102 Ga0070717_102171022 231
329 3300006173 Ga0070716_100511198 Ga0070716_1005111981 231
330 3300006871 Ga0075434_100026447 Ga0075434_1000264476 231
331 3300006881 Ga0068865_100133230 Ga0068865_1001332301 231
332 3300006914 Ga0075436_100238901 Ga0075436_1002389012 231
333 3300009093 Ga0105240_10084757 Ga0105240_100847572 231
334 3300009093 Ga0105240_10292326 Ga0105240_102923262 231
335 3300009176 Ga0105242_10064870 Ga0105242_100648704 231
336 3300009177 Ga0105248_10274395 Ga0105248_102743952 231
337 3300013100 Ga0157373_10290288 Ga0157373_102902882 231
338 3300013104 Ga0157370_10012187 Ga0157370_100121872 231
339 3300013104 Ga0157370_10017960 Ga0157370_100179606 231
340 3300013105 Ga0157369_10001204 Ga0157369_1000120436 231
341 3300013105 Ga0157369_10065952 Ga0157369_100659522 231
342 3300013306 Ga0163162_10625241 Ga0163162_106252412 231
343 3300013307 Ga0157372_10237668 Ga0157372_102376683 231
344 3300013307 Ga0157372_10518430 Ga0157372_105184302 231
345 3300014497 Ga0182008_10003715 Ga0182008_1000371510 231
346 3300014497 Ga0182008_10050772 Ga0182008_100507722 231
347 3300014969 Ga0157376_10123649 Ga0157376_101236493 231
348 3300015261 Ga0182006_1012613 Ga0182006_10126135 231
349 3300015262 Ga0182007_10033923 Ga0182007_100339232 231
350 3300020082 Ga0206353_11182390 Ga0206353_111823907 231
351 3300020082 Ga0206353_12036014 Ga0206353_120360142 231
352 3300025906 Ga0207699_10025505 Ga0207699_100255052 231
353 3300025912 Ga0207707_10050785 Ga0207707_100507854 231
354 3300025912 Ga0207707_10155620 Ga0207707_101556202 231
355 3300025912 Ga0207707_10295655 Ga0207707_102956552 231
356 3300025913 Ga0207695_10016356 Ga0207695_100163568 231
357 3300025913 Ga0207695_10291866 Ga0207695_102918661 231
358 3300025915 Ga0207693_10194909 Ga0207693_101949093 231
359 3300025917 Ga0207660_10077639 Ga0207660_100776392 231
360 3300025917 Ga0207660_10156435 Ga0207660_101564352 231
361 3300025919 Ga0207657_10006735 Ga0207657_100067356 231
362 3300025920 Ga0207649_10049404 Ga0207649_100494043 231
363 3300025920 Ga0207649_10414348 Ga0207649_104143482 231
364 3300025921 Ga0207652_10059252 Ga0207652_100592525 231
365 3300025921 Ga0207652_10197161 Ga0207652_101971612 231
366 3300025922 Ga0207646_10002734 Ga0207646_1000273425 231
367 3300025922 Ga0207646_10365937 Ga0207646_103659372 231
368 3300025928 Ga0207700_10033252 Ga0207700_100332523 231
369 3300025929 Ga0207664_10033209 Ga0207664_100332095 231
370 3300025929 Ga0207664_10151520 Ga0207664_101515203 231
371 3300025929 Ga0207664_10337774 Ga0207664_103377741 231
372 3300025944 Ga0207661_10031672 Ga0207661_100316727 231
373 3300025949 Ga0207667_10334725 Ga0207667_103347252 231
374 3300025981 Ga0207640_10328518 Ga0207640_103285182 231
375 3300026078 Ga0207702_10311792 Ga0207702_103117922 231
376 3300026088 Ga0207641_10467420 Ga0207641_104674202 231
377 3300026095 Ga0207676_10098654 Ga0207676_100986542 231
378 3300026142 Ga0207698_10275655 Ga0207698_102756552 231
379 3300027695 Ga0209966_1031889 Ga0209966_10318892 231
380 3300027907 Ga0207428_10321087 Ga0207428_103210872 231
381 3300028800 Ga0265338_10010584 Ga0265338_1001058411 231
382 3300028800 Ga0265338_10038539 Ga0265338_100385395 231
383 3300029957 Ga0265324_10011016 Ga0265324_100110162 231
384 3300031901 Ga0307406_10172265 Ga0307406_101722652 231
385 3300032002 Ga0307416_100028486 Ga0307416_1000284865 231
386 3300035116 Ga0373945_0028235 Ga0373945_0028235_1007_1810 231
387 3300035118 Ga0373954_0231701 Ga0373954_0231701_95_898 231
388 3300035410 Ga0373924_0101734 Ga0373924_0101734_334_1137 231
389 3300035410 Ga0373924_0132437 Ga0373924_0132437_177_980 231
390 3300035724 Ga0373933_0056907 Ga0373933_0056907_242_1045 231
391 3300035725 Ga0373947_0019368 Ga0373947_0019368_870_1673 231
392 3300035725 Ga0373947_0190801 Ga0373947_0190801_250_1053 231
393 3300036401 Ga0373937_0079431 Ga0373937_0079431_1166_1969 231
394 3300037068 Ga0373925_0006971 Ga0373925_0006971_4851_5654 231
395 3300037418 Ga0395900_0603820 Ga0395900_0603820_211_1014 231
396 3300037466 Ga0395898_0021663 Ga0395898_0021663_1952_2755 231
397 3300037466 Ga0395898_0046859 Ga0395898_0046859_2074_2877 231
398 3300037466 Ga0395898_0216660 Ga0395898_0216660_764_1567 231
399 3300038443 Ga0395901_0326565 Ga0395901_0326565_454_1257 231
400 3300038443 Ga0395901_0521359 Ga0395901_0521359_380_1183 231
401 3300038443 Ga0395901_0523228 Ga0395901_0523228_353_1177 231
402 3300039438 Ga0436360_0978461 Ga0436360_0978461_614_1417 231
403 3300044683 Ga0466965_0126173 Ga0466965_0126173_322_1125 231
404 3300044684 Ga0466966_0022136 Ga0466966_0022136_211_1014 231
405 3300044693 Ga0466961_0053667 Ga0466961_0053667_540_1343 231
406 3300044694 Ga0466963_0000885 Ga0466963_0000885_9154_9957 231
407 3300044694 Ga0466963_0002401 Ga0466963_0002401_1784_2587 231
408 3300044694 Ga0466963_0003553 Ga0466963_0003553_6961_7764 231
409 3300044694 Ga0466963_0004822 Ga0466963_0004822_2977_3804 231
410 3300044694 Ga0466963_0006281 Ga0466963_0006281_3464_4267 231
411 3300044694 Ga0466963_0015139 Ga0466963_0015139_153_956 231
412 3300044694 Ga0466963_0016858 Ga0466963_0016858_941_1738 231
413 3300044694 Ga0466963_0016894 Ga0466963_0016894_3125_3928 231
414 3300044694 Ga0466963_0041545 Ga0466963_0041545_1437_2282 231
415 3300044694 Ga0466963_0041824 Ga0466963_0041824_1223_2026 231
416 3300044694 Ga0466963_0057670 Ga0466963_0057670_321_1124 231
417 3300044694 Ga0466963_0322374 Ga0466963_0322374_125_928 231
418 3300044706 Ga0466964_0000825 Ga0466964_0000825_6013_6816 231
419 3300044706 Ga0466964_0005941 Ga0466964_0005941_2628_3431 231
420 3300044706 Ga0466964_0008596 Ga0466964_0008596_2587_3390 231
421 3300044706 Ga0466964_0010551 Ga0466964_0010551_1547_2350 231
422 3300044706 Ga0466964_0051019 Ga0466964_0051019_730_1533 231
423 3300044706 Ga0466964_0079453 Ga0466964_0079453_142_945 231
424 3300044719 Ga0466971_0020157 Ga0466971_0020157_1062_1865 231
425 3300044719 Ga0466971_0023628 Ga0466971_0023628_1061_1864 231
426 3300044719 Ga0466971_0039125 Ga0466971_0039125_923_1726 231
427 3300044719 Ga0466971_0052851 Ga0466971_0052851_100_903 231
428 3300044719 Ga0466971_0096371 Ga0466971_0096371_294_1097 231
429 3300044735 Ga0466968_0007081 Ga0466968_0007081_1081_1884 231
430 3300044735 Ga0466968_0039965 Ga0466968_0039965_1092_1895 231
431 3300044842 Ga0466957_0007928 Ga0466957_0007928_1156_1959 231
432 3300044842 Ga0466957_0008096 Ga0466957_0008096_2638_3435 231
433 3300044842 Ga0466957_0330875 Ga0466957_0330875_89_892 231
434 3300044842 Ga0466957_0367418 Ga0466957_0367418_126_929 231
435 3300044901 Ga0466960_0008413 Ga0466960_0008413_1083_1886 231
436 3300045049 Ga0466959_0004417 Ga0466959_0004417_252_1055 231
437 3300045836 Ga0466958_0000921 Ga0466958_0000921_10999_11802 231
438 3300045836 Ga0466958_0001307 Ga0466958_0001307_5015_5812 231
439 3300045836 Ga0466958_0027857 Ga0466958_0027857_1753_2556 231
440 3300045836 Ga0466958_0032616 Ga0466958_0032616_53_856 231
441 3300045836 Ga0466958_0036282 Ga0466958_0036282_1562_2365 231
442 3300045836 Ga0466958_0053833 Ga0466958_0053833_854_1657 231
443 3300045976 Ga0466967_0000305 Ga0466967_0000305_14473_15276 231
444 3300045976 Ga0466967_0004124 Ga0466967_0004124_1420_2217 231
445 3300045976 Ga0466967_0004340 Ga0466967_0004340_754_1557 231
446 3300045976 Ga0466967_0004811 Ga0466967_0004811_557_1360 231
447 3300045976 Ga0466967_0008963 Ga0466967_0008963_887_1690 231
448 3300045976 Ga0466967_0014089 Ga0466967_0014089_5270_6073 231
449 3300045976 Ga0466967_0018327 Ga0466967_0018327_3940_4785 231
450 3300045976 Ga0466967_0040972 Ga0466967_0040972_1246_2049 231
451 3300045976 Ga0466967_0081776 Ga0466967_0081776_1977_2780 231
452 3300045976 Ga0466967_0109183 Ga0466967_0109183_844_1647 231
453 3300045976 Ga0466967_0116726 Ga0466967_0116726_1006_1809 231
454 3300045976 Ga0466967_0157099 Ga0466967_0157099_64_867 231
455 3300045976 Ga0466967_0166704 Ga0466967_0166704_287_1090 231
456 3300045976 Ga0466967_0177617 Ga0466967_0177617_48_851 231
457 3300045976 Ga0466967_0201341 Ga0466967_0201341_809_1612 231
458 3300045976 Ga0466967_0281269 Ga0466967_0281269_522_1325 231
459 3300045976 Ga0466967_0670408 Ga0466967_0670408_51_854 231
460 3300046454 Ga0495592_0000100 Ga0495592_0000100_60591_61388 231
461 3300046454 Ga0495592_0017698 Ga0495592_0017698_523_1326 231
462 3300046454 Ga0495592_0018729 Ga0495592_0018729_2078_2875 231
463 3300046455 Ga0495603_0145107 Ga0495603_0145107_316_1119 231
464 3300046455 Ga0495603_0294702 Ga0495603_0294702_66_869 231
465 3300046459 Ga0495629_0005062 Ga0495629_0005062_188_991 231
466 3300046459 Ga0495629_0029070 Ga0495629_0029070_2780_3583 231
467 3300046459 Ga0495629_0126534 Ga0495629_0126534_604_1407 231
468 3300046461 Ga0495641_0005502 Ga0495641_0005502_7095_7898 231
469 3300046461 Ga0495641_0027909 Ga0495641_0027909_300_1103 231
470 3300046461 Ga0495641_0069780 Ga0495641_0069780_89_892 231
471 3300046462 Ga0495651_0000008 Ga0495651_0000008_70261_71058 231
472 3300046462 Ga0495651_0051621 Ga0495651_0051621_870_1667 231
473 3300046462 Ga0495651_0098477 Ga0495651_0098477_514_1317 231
474 3300046462 Ga0495651_0108425 Ga0495651_0108425_1080_1883 231
475 3300046463 Ga0495653_0000519 Ga0495653_0000519_19410_20207 231
476 3300046463 Ga0495653_0017412 Ga0495653_0017412_4934_5737 231
477 3300046463 Ga0495653_0051140 Ga0495653_0051140_1546_2349 231
478 3300046463 Ga0495653_0051798 Ga0495653_0051798_1892_2695 231
479 3300046472 Ga0495580_0195492 Ga0495580_0195492_529_1332 231
480 3300046473 Ga0495582_0041484 Ga0495582_0041484_35_838 231
481 3300046473 Ga0495582_0053447 Ga0495582_0053447_1356_2159 231
482 3300046475 Ga0495639_0003153 Ga0495639_0003153_6328_7131 231
483 3300046476 Ga0495662_0012890 Ga0495662_0012890_3196_3999 231
484 3300046476 Ga0495662_0038565 Ga0495662_0038565_785_1588 231
485 3300046477 Ga0495664_0030004 Ga0495664_0030004_2328_3131 231
486 3300046499 Ga0495594_0149967 Ga0495594_0149967_218_1021 231
487 3300046499 Ga0495594_0256619 Ga0495594_0256619_29_832 231
488 3300046511 Ga0495608_0002853 Ga0495608_0002853_10892_11689 231
489 3300046511 Ga0495608_0025390 Ga0495608_0025390_2866_3669 231
490 3300046514 Ga0495618_0008107 Ga0495618_0008107_1897_2694 231
491 3300046514 Ga0495618_0136278 Ga0495618_0136278_203_1006 231
492 3300046516 Ga0495628_0001255 Ga0495628_0001255_18254_19051 231
493 3300046516 Ga0495628_0037095 Ga0495628_0037095_403_1200 231
494 3300046516 Ga0495628_0112492 Ga0495628_0112492_85_888 231
495 3300046517 Ga0495630_0106281 Ga0495630_0106281_870_1673 231
496 3300046517 Ga0495630_0242954 Ga0495630_0242954_48_851 231
497 3300046517 Ga0495630_0267466 Ga0495630_0267466_231_1034 231
498 3300046526 Ga0495666_0008985 Ga0495666_0008985_353_1156 231
499 3300046529 Ga0495652_0000888 Ga0495652_0000888_18254_19051 231
500 3300046529 Ga0495652_0023777 Ga0495652_0023777_4032_4829 231
501 3300046529 Ga0495652_0077879 Ga0495652_0077879_260_1063 231
502 3300046529 Ga0495652_0145473 Ga0495652_0145473_872_1675 231
503 3300046529 Ga0495652_0228700 Ga0495652_0228700_38_841 231
504 3300046529 Ga0495652_0390283 Ga0495652_0390283_91_894 231
505 3300046531 Ga0495665_0024266 Ga0495665_0024266_39_842 231
506 3300046533 Ga0495640_0049832 Ga0495640_0049832_115_918 231
507 3300046533 Ga0495640_0180425 Ga0495640_0180425_342_1145 231
508 3300046533 Ga0495640_0206417 Ga0495640_0206417_119_922 231
509 3300046535 Ga0495586_0029182 Ga0495586_0029182_452_1255 231
510 3300046535 Ga0495586_0083485 Ga0495586_0083485_487_1290 231
511 3300046536 Ga0495587_0000048 Ga0495587_0000048_89286_90083 231
512 3300046536 Ga0495587_0015646 Ga0495587_0015646_983_1780 231
513 3300046536 Ga0495587_0073265 Ga0495587_0073265_440_1243 231
514 3300046543 Ga0495645_0000029 Ga0495645_0000029_23037_23834 231
515 3300046559 Ga0495667_0045237 Ga0495667_0045237_1370_2173 231
516 3300046559 Ga0495667_0199571 Ga0495667_0199571_277_1074 231
517 3300046615 Ga0495656_0196317 Ga0495656_0196317_53_853 231
518 3300046642 Ga0495634_0038422 Ga0495634_0038422_1474_2277 231
519 3300046642 Ga0495634_0070558 Ga0495634_0070558_284_1087 231
520 3300046663 Ga0495635_0085222 Ga0495635_0085222_1273_2076 231
521 3300046663 Ga0495635_0227649 Ga0495635_0227649_187_984 231
522 3300046663 Ga0495635_0368112 Ga0495635_0368112_103_900 231
523 3300046665 Ga0495661_0199409 Ga0495661_0199409_151_954 231
524 3300046675 Ga0495657_0021277 Ga0495657_0021277_658_1455 231
525 3300046675 Ga0495657_0030470 Ga0495657_0030470_1486_2283 231
526 3300046678 Ga0495599_0000181 Ga0495599_0000181_3147_3944 231
527 3300046678 Ga0495599_0067613 Ga0495599_0067613_1151_1948 231
528 3300046679 Ga0495623_0000093 Ga0495623_0000093_22182_22979 231
529 3300046680 Ga0495646_0000416 Ga0495646_0000416_4688_5485 231
530 3300046680 Ga0495646_0028309 Ga0495646_0028309_794_1591 231
531 3300046681 Ga0495647_0001300 Ga0495647_0001300_2786_3589 231
532 3300046681 Ga0495647_0020209 Ga0495647_0020209_224_1027 231
533 3300046681 Ga0495647_0033737 Ga0495647_0033737_565_1368 231
534 3300046683 Ga0495658_0001970 Ga0495658_0001970_822_1625 231
535 3300046683 Ga0495658_0201661 Ga0495658_0201661_29_832 231
536 3300046683 Ga0495658_0206876 Ga0495658_0206876_316_1119 231
537 3300046689 Ga0495613_0047036 Ga0495613_0047036_1061_1864 231
538 3300046689 Ga0495613_0085226 Ga0495613_0085226_1294_2097 231
539 3300046689 Ga0495613_0171918 Ga0495613_0171918_587_1390 231
540 3300046690 Ga0495624_0014510 Ga0495624_0014510_4093_4896 231
541 3300046809 Ga0495600_0015460 Ga0495600_0015460_1038_1835 231
542 3300046809 Ga0495600_0398322 Ga0495600_0398322_35_838 231
543 3300047315 Ga0495581_0019626 Ga0495581_0019626_2251_3054 231
544 3300047317 Ga0495604_0000111 Ga0495604_0000111_11414_12211 231
545 3300047317 Ga0495604_0048288 Ga0495604_0048288_1738_2541 231
546 3300047319 Ga0495674_0038310 Ga0495674_0038310_1170_1973 231
547 3300047319 Ga0495674_0346472 Ga0495674_0346472_15_818 231
548 3300047321 Ga0495676_0145078 Ga0495676_0145078_24_827 231
549 3300047322 Ga0495680_0013832 Ga0495680_0013832_3523_4326 231
550 3300047322 Ga0495680_0014786 Ga0495680_0014786_3944_4741 231
551 3300047322 Ga0495680_0035276 Ga0495680_0035276_350_1153 231
552 3300047322 Ga0495680_0102533 Ga0495680_0102533_814_1611 231
553 3300047322 Ga0495680_0323500 Ga0495680_0323500_17_820 231
554 3300047444 Ga0495675_0000376 Ga0495675_0000376_7947_8744 231
555 3300047444 Ga0495675_0218968 Ga0495675_0218968_283_1080 231
556 3300047471 Ga0495684_0074669 Ga0495684_0074669_185_988 231
557 3300047471 Ga0495684_0079530 Ga0495684_0079530_793_1590 231
558 3300047471 Ga0495684_0100983 Ga0495684_0100983_101_904 231
559 3300047471 Ga0495684_0224606 Ga0495684_0224606_511_1314 231
560 3300047673 Ga0495593_0017423 Ga0495593_0017423_3137_3940 231
561 3300048088 Ga0495602_0000141 Ga0495602_0000141_20511_21308 231
562 3300048088 Ga0495602_0006548 Ga0495602_0006548_10417_11214 231
563 3300048088 Ga0495602_0163369 Ga0495602_0163369_206_1009 231
564 3300048089 Ga0495614_0006610 Ga0495614_0006610_4221_5024 231
565 3300048907 Ga0496104_0033091 Ga0496104_0033091_2738_3541 231
566 3300048907 Ga0496104_0423891 Ga0496104_0423891_290_1093 231
567 3300048907 Ga0496104_0657728 Ga0496104_0657728_140_943 231
568 3300048908 Ga0496105_0003059 Ga0496105_0003059_6658_7461 231
569 3300048910 Ga0496107_0200107 Ga0496107_0200107_167_970 231
570 3300048910 Ga0496107_0396066 Ga0496107_0396066_125_928 231
571 3300048911 Ga0496108_0016271 Ga0496108_0016271_5242_6045 231
572 3300048911 Ga0496108_0090972 Ga0496108_0090972_369_1172 231
573 3300048912 Ga0496109_0023115 Ga0496109_0023115_32_835 231
574 3300048913 Ga0496110_0274830 Ga0496110_0274830_190_993 231
575 3300048917 Ga0496114_0014134 Ga0496114_0014134_5137_5940 231
576 3300048917 Ga0496114_0014487 Ga0496114_0014487_3225_4028 231
577 3300048917 Ga0496114_0216492 Ga0496114_0216492_694_1497 231
578 3300049583 Ga0501067_0007338 Ga0501067_0007338_3656_4480 231
579 3300049585 Ga0501069_0118502 Ga0501069_0118502_515_1339 231
580 3300049824 Ga0501045_0310890 Ga0501045_0310890_243_1046 231
581 3300050511 nmdc:mga08y16_239391_c1 nmdc:mga08y16_239391_c1_758_1561 231
582 3300050512 nmdc:mga0n895_158846_c1 nmdc:mga0n895_158846_c1_1463_2266 231
583 3300050514 nmdc:mga08x19_161148_c1 nmdc:mga08x19_161148_c1_245_1048 231
584 3300050515 nmdc:mga0a205_154640_c1 nmdc:mga0a205_154640_c1_867_1670 231
585 3300053077 Ga0495601_0000206 Ga0495601_0000206_21477_22274 231
586 3300053077 Ga0495601_0127526 Ga0495601_0127526_237_1040 231
587 3300053077 Ga0495601_0281390 Ga0495601_0281390_136_939 231
588 3300053078 Ga0495612_0018875 Ga0495612_0018875_658_1455 231
589 3300053078 Ga0495612_0060199 Ga0495612_0060199_235_1038 231
590 3300053084 Ga0495595_0005617 Ga0495595_0005617_4260_5063 231
591 3300053084 Ga0495595_0101287 Ga0495595_0101287_550_1347 231
592 3300053084 Ga0495595_0143483 Ga0495595_0143483_38_835 231
593 3300053085 Ga0495619_0000291 Ga0495619_0000291_27744_28541 231
594 3300053085 Ga0495619_0039474 Ga0495619_0039474_51_854 231
595 3300053085 Ga0495619_0055761 Ga0495619_0055761_66_869 231
596 3300061719 Ga0466962_0010625 Ga0466962_0010625_2639_3442 231
597 3300061719 Ga0466962_0112165 Ga0466962_0112165_84_887 231
598 3300061719 Ga0466962_0139429 Ga0466962_0139429_61_864 231
599 3300061734 Ga0530510_0085011 Ga0530510_0085011_577_1401 231
600 3300025944 Ga0207661_10347762 Ga0207661_103477622 232
601 3300003316 rootH1_10096223 rootH1_100962232 233
602 3300005341 Ga0070691_10027363 Ga0070691_100273633 233
603 3300005441 Ga0070700_100022193 Ga0070700_1000221933 233
604 3300005458 Ga0070681_10223319 Ga0070681_102233192 233
605 3300005535 Ga0070684_100051060 Ga0070684_1000510603 233
606 3300005545 Ga0070695_100273728 Ga0070695_1002737282 233
607 3300005547 Ga0070693_100378826 Ga0070693_1003788261 233
608 3300005577 Ga0068857_100004499 Ga0068857_10000449910 233
609 3300005719 Ga0068861_100102859 Ga0068861_1001028593 233
610 3300005844 Ga0068862_100241990 Ga0068862_1002419902 233
611 3300005937 Ga0081455_10109859 Ga0081455_101098593 233
612 3300005981 Ga0081538_10021172 Ga0081538_100211723 233
613 3300006195 Ga0075366_10184611 Ga0075366_101846112 233
614 3300009094 Ga0111539_10006384 Ga0111539_100063848 233
615 3300009098 Ga0105245_10029132 Ga0105245_100291322 233
616 3300009553 Ga0105249_10220639 Ga0105249_102206392 233
617 3300025899 Ga0207642_10055436 Ga0207642_100554362 233
618 3300025927 Ga0207687_10055410 Ga0207687_100554104 233
619 3300025933 Ga0207706_10013802 Ga0207706_100138029 233
620 3300026075 Ga0207708_10007293 Ga0207708_100072937 233
621 3300026089 Ga0207648_10058467 Ga0207648_100584674 233
622 3300026116 Ga0207674_10002093 Ga0207674_1000209310 233
623 3300026118 Ga0207675_100104032 Ga0207675_1001040322 233
624 3300028666 Ga0265336_10057009 Ga0265336_100570091 233
625 3300031241 Ga0265325_10018526 Ga0265325_100185262 233
626 3300031249 Ga0265339_10005030 Ga0265339_100050307 233
627 3300031250 Ga0265331_10029102 Ga0265331_100291024 233
628 3300031251 Ga0265327_10073748 Ga0265327_100737482 233
629 3300031344 Ga0265316_10056900 Ga0265316_100569002 233
630 3300031548 Ga0307408_100046396 Ga0307408_1000463964 233
631 3300031711 Ga0265314_10057907 Ga0265314_100579073 233
632 3300031712 Ga0265342_10043364 Ga0265342_100433642 233
633 3300031901 Ga0307406_10036628 Ga0307406_100366284 233
634 3300031995 Ga0307409_100061345 Ga0307409_1000613452 233
635 3300032002 Ga0307416_100006529 Ga0307416_1000065293 233
636 3300032126 Ga0307415_100000048 Ga0307415_10000004810 233
637 3300037471 Ga0395905_0194406 Ga0395905_0194406_847_1647 233
638 3300049743 Ga0501081_0236950 Ga0501081_0236950_434_1240 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01148

CTP_transf_1

Cytidylyltransferase family

19

278

0.88

PF01864

CarS-like

CDP-archaeol synthase

145

280

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.7005 11 227
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.6727 8 230
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.6567 11 227
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.6456 8 230
4mhw-assembly1.cif.gz_A crystal structure of thit with small molecule bat-25 0.374 61 191
ID Description Score Start End Superfamily
4mhwA00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.374 61 191 1.10.1760.20
af_O45507_139_348_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.3627 48 232 1.10.565.10
af_P77219_8_153_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.3342 30 226 1.20.1080.10
2lrkA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.2951 119 230 1.20.58.80
4mhwA00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.2899 61 191 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A7X6NPI0-F1-model_v4 deleted 0.8494 1 171
AF-A0A7V9KAV9-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.8313 2 174 GO:0004605
GO:0005886
GO:0016024
AF-A0A7X1ZIU5-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.8302 4 179 GO:0004605
GO:0005886
GO:0016024
AF-X1KCA0-F1-model_v4 Phosphatidate cytidylyltransferase 0.8281 88 186 GO:0004605
GO:0005886
GO:0016024
AF-A0A2M7JA63-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.8273 6 180 GO:0004605
GO:0005886
GO:0016024

Feature Viewer

pLDDT pTM Quality
77.6 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map