F471536
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 638 | 302 | 638 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300044683|Ga0466965_0068770|Ga0466965_0068770_332_841 |
| Length | 169 |
| Sequence | VKNRPPHEGGRPTGGADHANGANADRVDAIMSAEELHDAIAAYNEAWNAHDLERIRSLHAPDMVFENHTAGERAEGDEALAHIASIFDSWPDIAFTTRRLYVRDDLVVQEWTATATHVKPLSRGEIVAEPSGRRIEWEGMDIIPFEGGKVKRKDVYSDSVAILRQVGLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 198 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 199 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 200 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 201 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 202 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 203 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 204 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 254 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 255 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 256 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 257 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 281 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 302 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.23 |
| Nodule | 0 |
| Rhizoplane | 8.15 |
| Rhizosphere | 86.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001026 | 3300001977 | Bacteria | 4381 |
| 2 | JGI24740J21852_10002767 | 3300001979 | Bacteria | 7845 |
| 3 | JGI24751J29686_10070651 | 3300002459 | Bacteria | 720 |
| 4 | JGI25406J46586_10027831 | 3300003203 | Bacteria | 2161 |
| 5 | Ga0070683_100008978 | 3300005329 | Bacteria | 8520 |
| 6 | Ga0070683_100010609 | 3300005329 | Bacteria | 7919 |
| 7 | Ga0070683_100015665 | 3300005329 | Bacteria | 6665 |
| 8 | Ga0070683_100084594 | 3300005329 | Bacteria | 2972 |
| 9 | Ga0070683_100110699 | 3300005329 | Bacteria | 2591 |
| 10 | Ga0070683_100126241 | 3300005329 | Bacteria | 2419 |
| 11 | Ga0070690_100224293 | 3300005330 | Bacteria | 1318 |
| 12 | Ga0070690_101423488 | 3300005330 | Bacteria | 558 |
| 13 | Ga0070680_101335934 | 3300005336 | Bacteria | 620 |
| 14 | Ga0070682_101047517 | 3300005337 | Bacteria | 680 |
| 15 | Ga0068868_100000220 | 3300005338 | Bacteria | 38739 |
| 16 | Ga0068868_100192095 | 3300005338 | Bacteria | 1698 |
| 17 | Ga0068868_101302721 | 3300005338 | Bacteria | 675 |
| 18 | Ga0068868_101828348 | 3300005338 | Bacteria | 574 |
| 19 | Ga0070689_100071524 | 3300005340 | Bacteria | 2710 |
| 20 | Ga0070689_100954865 | 3300005340 | Bacteria | 761 |
| 21 | Ga0070691_10000275 | 3300005341 | Bacteria | 17919 |
| 22 | Ga0070691_10024493 | 3300005341 | Unclassified | 2805 |
| 23 | Ga0070661_100047912 | 3300005344 | Bacteria | 3128 |
| 24 | Ga0070668_100119881 | 3300005347 | Bacteria | 2102 |
| 25 | Ga0070669_100344091 | 3300005353 | Bacteria | 1209 |
| 26 | Ga0070669_101269003 | 3300005353 | Bacteria | 637 |
| 27 | Ga0070675_102041212 | 3300005354 | Bacteria | 529 |
| 28 | Ga0070673_100293591 | 3300005364 | Bacteria | 1429 |
| 29 | Ga0070688_100000053 | 3300005365 | Bacteria | 55064 |
| 30 | Ga0070688_100471154 | 3300005365 | Bacteria | 942 |
| 31 | Ga0070659_100005945 | 3300005366 | Bacteria | 8800 |
| 32 | Ga0070659_100150761 | 3300005366 | Bacteria | 1897 |
| 33 | Ga0070659_101017130 | 3300005366 | Bacteria | 728 |
| 34 | Ga0070667_100002266 | 3300005367 | Bacteria | 16947 |
| 35 | Ga0070709_10513680 | 3300005434 | Bacteria | 912 |
| 36 | Ga0070714_100036362 | 3300005435 | Bacteria | 4130 |
| 37 | Ga0070713_100759399 | 3300005436 | Bacteria | 928 |
| 38 | Ga0070713_101416795 | 3300005436 | Unclassified | 674 |
| 39 | Ga0070711_100018198 | 3300005439 | Bacteria | 4481 |
| 40 | Ga0070711_100245925 | 3300005439 | Bacteria | 1401 |
| 41 | Ga0070705_100296921 | 3300005440 | Bacteria | 1156 |
| 42 | Ga0070700_100005523 | 3300005441 | Bacteria | 6708 |
| 43 | Ga0070700_100054790 | 3300005441 | Bacteria | 2493 |
| 44 | Ga0070700_101268362 | 3300005441 | Bacteria | 618 |
| 45 | Ga0070708_100891983 | 3300005445 | Unclassified | 835 |
| 46 | Ga0070663_101124518 | 3300005455 | Unclassified | 687 |
| 47 | Ga0070678_100003823 | 3300005456 | Bacteria | 8447 |
| 48 | Ga0070678_100333495 | 3300005456 | Bacteria | 1299 |
| 49 | Ga0070678_101134511 | 3300005456 | Bacteria | 723 |
| 50 | Ga0070662_101080052 | 3300005457 | Bacteria | 688 |
| 51 | Ga0070681_10614403 | 3300005458 | Bacteria | 1001 |
| 52 | Ga0068867_100200329 | 3300005459 | Bacteria | 1598 |
| 53 | Ga0068867_100224070 | 3300005459 | Bacteria | 1517 |
| 54 | Ga0068867_100544601 | 3300005459 | Bacteria | 1004 |
| 55 | Ga0068867_100702266 | 3300005459 | Bacteria | 893 |
| 56 | Ga0070685_10000086 | 3300005466 | Bacteria | 57017 |
| 57 | Ga0070685_10029985 | 3300005466 | Bacteria | 3026 |
| 58 | Ga0070707_100221165 | 3300005468 | Unclassified | 1844 |
| 59 | Ga0070707_100265160 | 3300005468 | Bacteria | 1670 |
| 60 | Ga0070684_100000300 | 3300005535 | Bacteria | 34313 |
| 61 | Ga0070684_100044980 | 3300005535 | Bacteria | 3821 |
| 62 | Ga0070684_100185513 | 3300005535 | Bacteria | 1892 |
| 63 | Ga0070684_100188225 | 3300005535 | Bacteria | 1877 |
| 64 | Ga0070684_100605818 | 3300005535 | Bacteria | 1018 |
| 65 | Ga0070684_101199600 | 3300005535 | Bacteria | 714 |
| 66 | Ga0068853_101147488 | 3300005539 | Bacteria | 750 |
| 67 | Ga0070686_100122372 | 3300005544 | Bacteria | 1788 |
| 68 | Ga0070695_100766268 | 3300005545 | Bacteria | 771 |
| 69 | Ga0070665_100017640 | 3300005548 | Bacteria | 7168 |
| 70 | Ga0070665_100216008 | 3300005548 | Unclassified | 1918 |
| 71 | Ga0070665_100606321 | 3300005548 | Unclassified | 1108 |
| 72 | Ga0070665_100897632 | 3300005548 | Unclassified | 899 |
| 73 | Ga0070665_101242907 | 3300005548 | Bacteria | 755 |
| 74 | Ga0070704_100128171 | 3300005549 | Unclassified | 1962 |
| 75 | Ga0070704_100365985 | 3300005549 | Bacteria | 1221 |
| 76 | Ga0070664_100014728 | 3300005564 | Bacteria | 6386 |
| 77 | Ga0070664_100060258 | 3300005564 | Bacteria | 3231 |
| 78 | Ga0070664_100505543 | 3300005564 | Bacteria | 1114 |
| 79 | Ga0070664_100651091 | 3300005564 | Bacteria | 979 |
| 80 | Ga0070664_100831947 | 3300005564 | Bacteria | 864 |
| 81 | Ga0068857_100005209 | 3300005577 | Bacteria | 11066 |
| 82 | Ga0068857_100149525 | 3300005577 | Bacteria | 2115 |
| 83 | Ga0068857_101078277 | 3300005577 | Unclassified | 775 |
| 84 | Ga0068854_100000345 | 3300005578 | Bacteria | 29913 |
| 85 | Ga0068854_100900680 | 3300005578 | Bacteria | 777 |
| 86 | Ga0068856_100003669 | 3300005614 | Bacteria | 15395 |
| 87 | Ga0068856_101364076 | 3300005614 | Bacteria | 724 |
| 88 | Ga0070702_100198963 | 3300005615 | Unclassified | 1325 |
| 89 | Ga0068852_100007831 | 3300005616 | Bacteria | 7820 |
| 90 | Ga0068852_100008636 | 3300005616 | Bacteria | 7526 |
| 91 | Ga0068859_100410570 | 3300005617 | Bacteria | 1450 |
| 92 | Ga0068859_101283685 | 3300005617 | Bacteria | 807 |
| 93 | Ga0068859_101822915 | 3300005617 | Unclassified | 672 |
| 94 | Ga0068866_10237818 | 3300005718 | Bacteria | 1108 |
| 95 | Ga0068861_100192551 | 3300005719 | Unclassified | 1706 |
| 96 | Ga0068851_10005227 | 3300005834 | Bacteria | 5890 |
| 97 | Ga0068851_10020425 | 3300005834 | Bacteria | 3208 |
| 98 | Ga0068851_10132082 | 3300005834 | Bacteria | 1351 |
| 99 | Ga0068851_10565365 | 3300005834 | Bacteria | 689 |
| 100 | Ga0068870_10142061 | 3300005840 | Unclassified | 1406 |
| 101 | Ga0068870_10183472 | 3300005840 | Bacteria | 1258 |
| 102 | Ga0068863_100002888 | 3300005841 | Bacteria | 17015 |
| 103 | Ga0068858_100092118 | 3300005842 | Bacteria | 2821 |
| 104 | Ga0068858_100093347 | 3300005842 | Bacteria | 2802 |
| 105 | Ga0068858_100411920 | 3300005842 | Unclassified | 1299 |
| 106 | Ga0081455_10001231 | 3300005937 | Bacteria | 31996 |
| 107 | Ga0081455_10099757 | 3300005937 | Bacteria | 2335 |
| 108 | Ga0081455_10167912 | 3300005937 | Unclassified | 1675 |
| 109 | Ga0081455_10186108 | 3300005937 | Unclassified | 1568 |
| 110 | Ga0081540_1194534 | 3300005983 | Unclassified | 744 |
| 111 | Ga0081540_1218697 | 3300005983 | Unclassified | 679 |
| 112 | Ga0081539_10003833 | 3300005985 | Bacteria | 17661 |
| 113 | Ga0081539_10109602 | 3300005985 | Bacteria | 1392 |
| 114 | Ga0081539_10234791 | 3300005985 | Unclassified | 825 |
| 115 | Ga0070717_11749715 | 3300006028 | Bacteria | 562 |
| 116 | Ga0075365_10004155 | 3300006038 | Bacteria | 7619 |
| 117 | Ga0075365_10080967 | 3300006038 | Bacteria | 2199 |
| 118 | Ga0075365_10285626 | 3300006038 | Bacteria | 1161 |
| 119 | Ga0075363_100004167 | 3300006048 | Bacteria | 6281 |
| 120 | Ga0075363_100147607 | 3300006048 | Bacteria | 1326 |
| 121 | Ga0075363_100624927 | 3300006048 | Bacteria | 647 |
| 122 | Ga0075364_10032023 | 3300006051 | Bacteria | 3378 |
| 123 | Ga0075364_10037846 | 3300006051 | Bacteria | 3126 |
| 124 | Ga0075364_10226577 | 3300006051 | Unclassified | 1269 |
| 125 | Ga0075364_10293843 | 3300006051 | Bacteria | 1106 |
| 126 | Ga0075432_10031829 | 3300006058 | Bacteria | 1826 |
| 127 | Ga0075432_10057527 | 3300006058 | Bacteria | 1380 |
| 128 | Ga0075432_10133145 | 3300006058 | Bacteria | 943 |
| 129 | Ga0070716_100106063 | 3300006173 | Bacteria | 1732 |
| 130 | Ga0070716_100179404 | 3300006173 | Bacteria | 1389 |
| 131 | Ga0070712_100013203 | 3300006175 | Bacteria | 5271 |
| 132 | Ga0070712_100155843 | 3300006175 | Bacteria | 1759 |
| 133 | Ga0075367_10019603 | 3300006178 | Bacteria | 3752 |
| 134 | Ga0075367_10256231 | 3300006178 | Bacteria | 1098 |
| 135 | Ga0075367_10298522 | 3300006178 | Unclassified | 1014 |
| 136 | Ga0075367_10541370 | 3300006178 | Bacteria | 739 |
| 137 | Ga0075428_100028774 | 3300006844 | Bacteria | 6149 |
| 138 | Ga0075428_100104941 | 3300006844 | Bacteria | 3082 |
| 139 | Ga0075430_100009898 | 3300006846 | Bacteria | 8063 |
| 140 | Ga0075430_100073707 | 3300006846 | Bacteria | 2862 |
| 141 | Ga0075431_100023129 | 3300006847 | Bacteria | 6354 |
| 142 | Ga0075431_100024109 | 3300006847 | Bacteria | 6230 |
| 143 | Ga0075431_100125200 | 3300006847 | Bacteria | 2652 |
| 144 | Ga0075433_10071303 | 3300006852 | Bacteria | 3054 |
| 145 | Ga0075433_10410805 | 3300006852 | Bacteria | 1194 |
| 146 | Ga0075434_100001194 | 3300006871 | Bacteria | 21560 |
| 147 | Ga0075429_100004246 | 3300006880 | Bacteria | 12283 |
| 148 | Ga0068865_100129502 | 3300006881 | Bacteria | 1889 |
| 149 | Ga0068865_100165762 | 3300006881 | Bacteria | 1690 |
| 150 | Ga0068865_100680500 | 3300006881 | Bacteria | 877 |
| 151 | Ga0075436_100976752 | 3300006914 | Bacteria | 635 |
| 152 | Ga0075436_101417173 | 3300006914 | Unclassified | 527 |
| 153 | Ga0097620_100410554 | 3300006931 | Bacteria | 1450 |
| 154 | Ga0097620_101283695 | 3300006931 | Bacteria | 807 |
| 155 | Ga0097620_101822758 | 3300006931 | Unclassified | 672 |
| 156 | Ga0075435_100032887 | 3300007076 | Bacteria | 4098 |
| 157 | Ga0075435_100346269 | 3300007076 | Bacteria | 1274 |
| 158 | Ga0111539_10013057 | 3300009094 | Bacteria | 10393 |
| 159 | Ga0111539_10036089 | 3300009094 | Bacteria | 5980 |
| 160 | Ga0111539_10122100 | 3300009094 | Bacteria | 3053 |
| 161 | Ga0111539_10201867 | 3300009094 | Unclassified | 2318 |
| 162 | Ga0111539_10884775 | 3300009094 | Bacteria | 1039 |
| 163 | Ga0111539_12323932 | 3300009094 | Unclassified | 622 |
| 164 | Ga0105245_10007888 | 3300009098 | Bacteria | 9311 |
| 165 | Ga0105245_10009000 | 3300009098 | Bacteria | 8708 |
| 166 | Ga0105245_10019398 | 3300009098 | Bacteria | 5956 |
| 167 | Ga0105245_10114136 | 3300009098 | Bacteria | 2516 |
| 168 | Ga0105245_10313345 | 3300009098 | Bacteria | 1544 |
| 169 | Ga0105245_10943920 | 3300009098 | Bacteria | 905 |
| 170 | Ga0105245_11215220 | 3300009098 | Bacteria | 802 |
| 171 | Ga0105247_10002606 | 3300009101 | Bacteria | 12180 |
| 172 | Ga0105247_10134444 | 3300009101 | Bacteria | 1614 |
| 173 | Ga0105247_11154295 | 3300009101 | Unclassified | 614 |
| 174 | Ga0114129_10143929 | 3300009147 | Bacteria | 3266 |
| 175 | Ga0114129_10176418 | 3300009147 | Bacteria | 2911 |
| 176 | Ga0114129_10340564 | 3300009147 | Bacteria | 1989 |
| 177 | Ga0114129_10481931 | 3300009147 | Bacteria | 1623 |
| 178 | Ga0114129_10672083 | 3300009147 | Bacteria | 1334 |
| 179 | Ga0114129_11335224 | 3300009147 | Unclassified | 887 |
| 180 | Ga0114129_11419710 | 3300009147 | Bacteria | 856 |
| 181 | Ga0114129_12085584 | 3300009147 | Bacteria | 684 |
| 182 | Ga0114129_12487513 | 3300009147 | Unclassified | 619 |
| 183 | Ga0114129_12769483 | 3300009147 | Bacteria | 583 |
| 184 | Ga0105243_10006390 | 3300009148 | Bacteria | 9104 |
| 185 | Ga0105243_10094406 | 3300009148 | Bacteria | 2470 |
| 186 | Ga0105243_10103282 | 3300009148 | Bacteria | 2370 |
| 187 | Ga0105243_10176167 | 3300009148 | Bacteria | 1856 |
| 188 | Ga0105243_10209962 | 3300009148 | Bacteria | 1714 |
| 189 | Ga0105243_11543260 | 3300009148 | Bacteria | 689 |
| 190 | Ga0105241_10124872 | 3300009174 | Bacteria | 2077 |
| 191 | Ga0105241_10216916 | 3300009174 | Unclassified | 1606 |
| 192 | Ga0105242_10072255 | 3300009176 | Bacteria | 2865 |
| 193 | Ga0105242_13188490 | 3300009176 | Bacteria | 509 |
| 194 | Ga0105248_12757215 | 3300009177 | Bacteria | 560 |
| 195 | Ga0105237_10041255 | 3300009545 | Bacteria | 4655 |
| 196 | Ga0105237_12778055 | 3300009545 | Bacteria | 501 |
| 197 | Ga0105238_10012331 | 3300009551 | Bacteria | 8620 |
| 198 | Ga0105249_10000054 | 3300009553 | Bacteria | 162883 |
| 199 | Ga0105249_10446735 | 3300009553 | Bacteria | 1331 |
| 200 | Ga0105249_10610508 | 3300009553 | Unclassified | 1146 |
| 201 | Ga0105249_11021787 | 3300009553 | Unclassified | 896 |
| 202 | Ga0105249_11801559 | 3300009553 | Unclassified | 685 |
| 203 | Ga0105239_10217724 | 3300010375 | Bacteria | 2141 |
| 204 | Ga0105239_10332280 | 3300010375 | Bacteria | 1714 |
| 205 | Ga0105239_10468075 | 3300010375 | Bacteria | 1431 |
| 206 | Ga0105239_10536565 | 3300010375 | Bacteria | 1332 |
| 207 | Ga0105239_11321591 | 3300010375 | Unclassified | 832 |
| 208 | Ga0105246_10036422 | 3300011119 | Bacteria | 3296 |
| 209 | Ga0105246_10136309 | 3300011119 | Unclassified | 1840 |
| 210 | Ga0157344_1026385 | 3300012476 | Bacteria | 533 |
| 211 | Ga0157370_10050656 | 3300013104 | Bacteria | 3968 |
| 212 | Ga0157370_10228969 | 3300013104 | Bacteria | 1721 |
| 213 | Ga0157374_10694387 | 3300013296 | Unclassified | 1030 |
| 214 | Ga0157374_10921840 | 3300013296 | Bacteria | 892 |
| 215 | Ga0157378_10046947 | 3300013297 | Bacteria | 3839 |
| 216 | Ga0157378_10052908 | 3300013297 | Bacteria | 3613 |
| 217 | Ga0157378_11157248 | 3300013297 | Bacteria | 812 |
| 218 | Ga0157378_11996859 | 3300013297 | Bacteria | 630 |
| 219 | Ga0163162_12079337 | 3300013306 | Unclassified | 651 |
| 220 | Ga0157372_10000284 | 3300013307 | Bacteria | 56386 |
| 221 | Ga0157372_10103617 | 3300013307 | Bacteria | 3251 |
| 222 | Ga0157372_11702049 | 3300013307 | Unclassified | 726 |
| 223 | Ga0157375_10492995 | 3300013308 | Bacteria | 1390 |
| 224 | Ga0157375_12176095 | 3300013308 | Unclassified | 660 |
| 225 | Ga0163163_10959432 | 3300014325 | Unclassified | 918 |
| 226 | Ga0157380_10021138 | 3300014326 | Bacteria | 4878 |
| 227 | Ga0157380_10089529 | 3300014326 | Bacteria | 2536 |
| 228 | Ga0157380_10102618 | 3300014326 | Bacteria | 2385 |
| 229 | Ga0157380_10141838 | 3300014326 | Bacteria | 2065 |
| 230 | Ga0157380_11520086 | 3300014326 | Bacteria | 723 |
| 231 | Ga0157380_11692519 | 3300014326 | Bacteria | 690 |
| 232 | Ga0157377_10139331 | 3300014745 | Bacteria | 1489 |
| 233 | Ga0157377_10172065 | 3300014745 | Bacteria | 1355 |
| 234 | Ga0157377_10425882 | 3300014745 | Bacteria | 910 |
| 235 | Ga0157379_10024043 | 3300014968 | Bacteria | 5407 |
| 236 | Ga0157376_10111428 | 3300014969 | Bacteria | 2409 |
| 237 | Ga0157376_10427576 | 3300014969 | Bacteria | 1286 |
| 238 | Ga0157376_10945793 | 3300014969 | Bacteria | 882 |
| 239 | Ga0206356_10206281 | 3300020070 | Unclassified | 1890 |
| 240 | Ga0206353_10530369 | 3300020082 | Bacteria | 4320 |
| 241 | Ga0213873_10090042 | 3300021358 | Unclassified | 870 |
| 242 | Ga0213876_10086730 | 3300021384 | Bacteria | 1657 |
| 243 | Ga0207656_10002224 | 3300025321 | Bacteria | 6496 |
| 244 | Ga0207656_10008896 | 3300025321 | Bacteria | 3718 |
| 245 | Ga0207642_10294098 | 3300025899 | Unclassified | 939 |
| 246 | Ga0207710_10000096 | 3300025900 | Bacteria | 116063 |
| 247 | Ga0207688_10024164 | 3300025901 | Bacteria | 3331 |
| 248 | Ga0207688_10577124 | 3300025901 | Bacteria | 708 |
| 249 | Ga0207688_10722927 | 3300025901 | Bacteria | 630 |
| 250 | Ga0207680_10088670 | 3300025903 | Unclassified | 1962 |
| 251 | Ga0207647_10785994 | 3300025904 | Bacteria | 513 |
| 252 | Ga0207699_10539800 | 3300025906 | Bacteria | 845 |
| 253 | Ga0207645_10638417 | 3300025907 | Bacteria | 723 |
| 254 | Ga0207643_10035518 | 3300025908 | Bacteria | 2795 |
| 255 | Ga0207643_10125106 | 3300025908 | Unclassified | 1526 |
| 256 | Ga0207654_10117527 | 3300025911 | Bacteria | 1664 |
| 257 | Ga0207654_10165808 | 3300025911 | Unclassified | 1430 |
| 258 | Ga0207707_10282253 | 3300025912 | Bacteria | 1438 |
| 259 | Ga0207707_10358422 | 3300025912 | Unclassified | 1256 |
| 260 | Ga0207671_10088848 | 3300025914 | Bacteria | 2325 |
| 261 | Ga0207693_10017214 | 3300025915 | Bacteria | 5764 |
| 262 | Ga0207693_10044456 | 3300025915 | Bacteria | 3491 |
| 263 | Ga0207663_10230715 | 3300025916 | Bacteria | 1352 |
| 264 | Ga0207660_11116881 | 3300025917 | Bacteria | 642 |
| 265 | Ga0207662_11118252 | 3300025918 | Bacteria | 560 |
| 266 | Ga0207657_10015071 | 3300025919 | Bacteria | 7508 |
| 267 | Ga0207657_10399549 | 3300025919 | Bacteria | 1081 |
| 268 | Ga0207649_10097361 | 3300025920 | Bacteria | 1940 |
| 269 | Ga0207649_10503233 | 3300025920 | Bacteria | 922 |
| 270 | Ga0207649_10962752 | 3300025920 | Bacteria | 671 |
| 271 | Ga0207652_10191658 | 3300025921 | Bacteria | 1839 |
| 272 | Ga0207681_10435077 | 3300025923 | Bacteria | 1065 |
| 273 | Ga0207694_10096787 | 3300025924 | Bacteria | 2335 |
| 274 | Ga0207650_11501151 | 3300025925 | Bacteria | 573 |
| 275 | Ga0207687_10010977 | 3300025927 | Bacteria | 5919 |
| 276 | Ga0207687_10110090 | 3300025927 | Bacteria | 2042 |
| 277 | Ga0207687_10506881 | 3300025927 | Bacteria | 1008 |
| 278 | Ga0207687_11102528 | 3300025927 | Bacteria | 682 |
| 279 | Ga0207687_11364414 | 3300025927 | Bacteria | 609 |
| 280 | Ga0207700_10487464 | 3300025928 | Bacteria | 1090 |
| 281 | Ga0207664_10980379 | 3300025929 | Unclassified | 758 |
| 282 | Ga0207644_11344200 | 3300025931 | Unclassified | 600 |
| 283 | Ga0207690_10299330 | 3300025932 | Bacteria | 1258 |
| 284 | Ga0207690_10301112 | 3300025932 | Bacteria | 1255 |
| 285 | Ga0207686_10003508 | 3300025934 | Bacteria | 8424 |
| 286 | Ga0207709_10019786 | 3300025935 | Bacteria | 3789 |
| 287 | Ga0207709_10143163 | 3300025935 | Bacteria | 1646 |
| 288 | Ga0207709_10329893 | 3300025935 | Bacteria | 1145 |
| 289 | Ga0207709_10515805 | 3300025935 | Bacteria | 935 |
| 290 | Ga0207709_11041765 | 3300025935 | Unclassified | 670 |
| 291 | Ga0207670_10088689 | 3300025936 | Bacteria | 2182 |
| 292 | Ga0207670_10102412 | 3300025936 | Bacteria | 2047 |
| 293 | Ga0207670_10116398 | 3300025936 | Unclassified | 1935 |
| 294 | Ga0207669_10532357 | 3300025937 | Bacteria | 945 |
| 295 | Ga0207669_10742679 | 3300025937 | Bacteria | 810 |
| 296 | Ga0207704_10028152 | 3300025938 | Bacteria | 3113 |
| 297 | Ga0207704_10297883 | 3300025938 | Bacteria | 1234 |
| 298 | Ga0207665_10093657 | 3300025939 | Bacteria | 2086 |
| 299 | Ga0207665_10095892 | 3300025939 | Bacteria | 2062 |
| 300 | Ga0207665_10216950 | 3300025939 | Bacteria | 1400 |
| 301 | Ga0207665_10349159 | 3300025939 | Bacteria | 1116 |
| 302 | Ga0207665_10411516 | 3300025939 | Bacteria | 1031 |
| 303 | Ga0207691_10942009 | 3300025940 | Bacteria | 722 |
| 304 | Ga0207711_10517354 | 3300025941 | Bacteria | 1113 |
| 305 | Ga0207661_10005756 | 3300025944 | Bacteria | 8739 |
| 306 | Ga0207661_10005996 | 3300025944 | Bacteria | 8582 |
| 307 | Ga0207661_10019548 | 3300025944 | Bacteria | 5053 |
| 308 | Ga0207661_10093974 | 3300025944 | Unclassified | 2504 |
| 309 | Ga0207661_10808523 | 3300025944 | Bacteria | 863 |
| 310 | Ga0207679_10013592 | 3300025945 | Bacteria | 5336 |
| 311 | Ga0207679_10042876 | 3300025945 | Bacteria | 3254 |
| 312 | Ga0207679_10163335 | 3300025945 | Unclassified | 1826 |
| 313 | Ga0207679_10881164 | 3300025945 | Bacteria | 818 |
| 314 | Ga0207679_11374281 | 3300025945 | Unclassified | 648 |
| 315 | Ga0207651_10242430 | 3300025960 | Bacteria | 1470 |
| 316 | Ga0207712_10000032 | 3300025961 | Bacteria | 210628 |
| 317 | Ga0207712_10007217 | 3300025961 | Bacteria | 7008 |
| 318 | Ga0207712_10204694 | 3300025961 | Bacteria | 1567 |
| 319 | Ga0207712_10528434 | 3300025961 | Bacteria | 1012 |
| 320 | Ga0207712_11611902 | 3300025961 | Unclassified | 582 |
| 321 | Ga0207668_10068403 | 3300025972 | Bacteria | 2525 |
| 322 | Ga0207668_10080861 | 3300025972 | Unclassified | 2355 |
| 323 | Ga0207668_10995697 | 3300025972 | Bacteria | 749 |
| 324 | Ga0207640_10000077 | 3300025981 | Bacteria | 76155 |
| 325 | Ga0207640_10551317 | 3300025981 | Bacteria | 969 |
| 326 | Ga0207640_10607849 | 3300025981 | Bacteria | 926 |
| 327 | Ga0207658_10002876 | 3300025986 | Bacteria | 12335 |
| 328 | Ga0207677_10177042 | 3300026023 | Bacteria | 1674 |
| 329 | Ga0207703_10067575 | 3300026035 | Unclassified | 2942 |
| 330 | Ga0207703_10083718 | 3300026035 | Bacteria | 2666 |
| 331 | Ga0207639_11151912 | 3300026041 | Bacteria | 728 |
| 332 | Ga0207678_10080828 | 3300026067 | Bacteria | 2782 |
| 333 | Ga0207708_10008033 | 3300026075 | Bacteria | 7823 |
| 334 | Ga0207708_10037813 | 3300026075 | Bacteria | 3676 |
| 335 | Ga0207702_10000419 | 3300026078 | Bacteria | 48574 |
| 336 | Ga0207702_10621854 | 3300026078 | Bacteria | 1061 |
| 337 | Ga0207641_10002314 | 3300026088 | Bacteria | 17689 |
| 338 | Ga0207641_11864409 | 3300026088 | Bacteria | 603 |
| 339 | Ga0207648_10153748 | 3300026089 | Bacteria | 2030 |
| 340 | Ga0207648_10274512 | 3300026089 | Bacteria | 1507 |
| 341 | Ga0207648_10375681 | 3300026089 | Bacteria | 1284 |
| 342 | Ga0207674_10001853 | 3300026116 | Bacteria | 26957 |
| 343 | Ga0207674_10226625 | 3300026116 | Bacteria | 1817 |
| 344 | Ga0207674_10370061 | 3300026116 | Unclassified | 1385 |
| 345 | Ga0207674_11026379 | 3300026116 | Unclassified | 794 |
| 346 | Ga0207675_100244343 | 3300026118 | Unclassified | 1735 |
| 347 | Ga0207675_102192839 | 3300026118 | Unclassified | 568 |
| 348 | Ga0207683_10013197 | 3300026121 | Bacteria | 7048 |
| 349 | Ga0207683_10340413 | 3300026121 | Bacteria | 1376 |
| 350 | Ga0207698_10008081 | 3300026142 | Bacteria | 6635 |
| 351 | Ga0207698_10262179 | 3300026142 | Bacteria | 1588 |
| 352 | Ga0207428_10084372 | 3300027907 | Bacteria | 2476 |
| 353 | Ga0268266_10001186 | 3300028379 | Bacteria | 32148 |
| 354 | Ga0268266_10210857 | 3300028379 | Unclassified | 1781 |
| 355 | Ga0268266_10550397 | 3300028379 | Bacteria | 1106 |
| 356 | Ga0268266_11398313 | 3300028379 | Unclassified | 675 |
| 357 | Ga0268264_10120385 | 3300028381 | Bacteria | 2313 |
| 358 | Ga0265337_1002592 | 3300028556 | Bacteria | 8185 |
| 359 | Ga0265326_10000056 | 3300028558 | Bacteria | 64840 |
| 360 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 361 | Ga0265319_1070324 | 3300028563 | Bacteria | 1123 |
| 362 | Ga0265322_10000017 | 3300028654 | Bacteria | 114833 |
| 363 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 364 | Ga0265338_10559285 | 3300028800 | Unclassified | 800 |
| 365 | Ga0265324_10001639 | 3300029957 | Bacteria | 12385 |
| 366 | Ga0265328_10000258 | 3300031239 | Bacteria | 24453 |
| 367 | Ga0265320_10000068 | 3300031240 | Bacteria | 91884 |
| 368 | Ga0265325_10005471 | 3300031241 | Bacteria | 7835 |
| 369 | Ga0265339_10023454 | 3300031249 | Bacteria | 3566 |
| 370 | Ga0265331_10005995 | 3300031250 | Bacteria | 7252 |
| 371 | Ga0265327_10000317 | 3300031251 | Bacteria | 92215 |
| 372 | Ga0265327_10378005 | 3300031251 | Bacteria | 617 |
| 373 | Ga0265316_10127295 | 3300031344 | Unclassified | 1920 |
| 374 | Ga0265314_10000973 | 3300031711 | Bacteria | 33669 |
| 375 | Ga0265342_10201265 | 3300031712 | Bacteria | 1082 |
| 376 | Ga0307405_10409326 | 3300031731 | Bacteria | 1064 |
| 377 | Ga0307412_10686438 | 3300031911 | Bacteria | 877 |
| 378 | Ga0307409_100093628 | 3300031995 | Bacteria | 2470 |
| 379 | Ga0307409_100363314 | 3300031995 | Bacteria | 1370 |
| 380 | Ga0307409_100898684 | 3300031995 | Bacteria | 899 |
| 381 | Ga0307409_100964232 | 3300031995 | Bacteria | 869 |
| 382 | Ga0307416_100097604 | 3300032002 | Bacteria | 2545 |
| 383 | Ga0307416_100157621 | 3300032002 | Unclassified | 2093 |
| 384 | Ga0307416_100405191 | 3300032002 | Bacteria | 1403 |
| 385 | Ga0307416_100838987 | 3300032002 | Unclassified | 1017 |
| 386 | Ga0307414_10475724 | 3300032004 | Bacteria | 1101 |
| 387 | Ga0307414_10923631 | 3300032004 | Bacteria | 801 |
| 388 | Ga0307411_10637127 | 3300032005 | Bacteria | 921 |
| 389 | Ga0307415_100004333 | 3300032126 | Bacteria | 7349 |
| 390 | Ga0307415_100020148 | 3300032126 | Bacteria | 4066 |
| 391 | Ga0307415_100286679 | 3300032126 | Bacteria | 1357 |
| 392 | Ga0307415_100646199 | 3300032126 | Unclassified | 948 |
| 393 | Ga0373923_0078824 | 3300035111 | Archaea | 1426 |
| 394 | Ga0373923_0317786 | 3300035111 | Bacteria | 739 |
| 395 | Ga0373956_0601583 | 3300035119 | Bacteria | 525 |
| 396 | Ga0373947_0450262 | 3300035725 | Unclassified | 872 |
| 397 | Ga0373937_0042838 | 3300036401 | Unclassified | 4131 |
| 398 | Ga0373937_0106439 | 3300036401 | Bacteria | 2607 |
| 399 | Ga0373937_0479421 | 3300036401 | Unclassified | 1182 |
| 400 | Ga0395899_0014597 | 3300037312 | Bacteria | 5995 |
| 401 | Ga0395900_0166985 | 3300037418 | Unclassified | 2242 |
| 402 | Ga0395900_1341804 | 3300037418 | Bacteria | 629 |
| 403 | Ga0395898_0001996 | 3300037466 | Bacteria | 25620 |
| 404 | Ga0395898_0442055 | 3300037466 | Bacteria | 1239 |
| 405 | Ga0395898_1089972 | 3300037466 | Bacteria | 732 |
| 406 | Ga0395905_0012030 | 3300037471 | Bacteria | 8343 |
| 407 | Ga0395905_1638331 | 3300037471 | Unclassified | 548 |
| 408 | Ga0436364_1340043 | 3300037853 | Bacteria | 976 |
| 409 | Ga0395901_0034351 | 3300038443 | Bacteria | 5236 |
| 410 | Ga0395901_0171605 | 3300038443 | Bacteria | 2276 |
| 411 | Ga0395901_0818887 | 3300038443 | Bacteria | 919 |
| 412 | Ga0436365_0511075 | 3300039437 | Bacteria | 1527 |
| 413 | Ga0436365_1904503 | 3300039437 | Bacteria | 1523 |
| 414 | Ga0436362_0671578 | 3300039453 | Unclassified | 983 |
| 415 | Ga0436362_1260871 | 3300039453 | Bacteria | 1884 |
| 416 | Ga0451791_0052506 | 3300041451 | Bacteria | 1246 |
| 417 | Ga0451798_0544195 | 3300041458 | Bacteria | 1052 |
| 418 | Ga0451807_0497514 | 3300041486 | Bacteria | 2174 |
| 419 | Ga0451807_1989586 | 3300041486 | Bacteria | 2026 |
| 420 | Ga0451835_0152756 | 3300041492 | Unclassified | 1301 |
| 421 | Ga0451839_1560512 | 3300041496 | Archaea | 1059 |
| 422 | Ga0451853_3583735 | 3300041512 | Bacteria | 585 |
| 423 | Ga0450900_026288 | 3300042136 | Bacteria | 832 |
| 424 | Ga0439459_0081443 | 3300042438 | Bacteria | 765 |
| 425 | Ga0439464_0095572 | 3300042439 | Bacteria | 899 |
| 426 | Ga0439460_0110157 | 3300042461 | Unclassified | 893 |
| 427 | Ga0466965_0068770 | 3300044683 | Bacteria | 1778 |
| 428 | Ga0466965_0405103 | 3300044683 | Unclassified | 754 |
| 429 | Ga0466966_0068613 | 3300044684 | Bacteria | 2226 |
| 430 | Ga0466961_0363200 | 3300044693 | Bacteria | 880 |
| 431 | Ga0466963_0040454 | 3300044694 | Bacteria | 3055 |
| 432 | Ga0466963_0324430 | 3300044694 | Bacteria | 1084 |
| 433 | Ga0466964_0172360 | 3300044706 | Bacteria | 1020 |
| 434 | Ga0466964_0334035 | 3300044706 | Bacteria | 774 |
| 435 | Ga0466964_0499550 | 3300044706 | Bacteria | 653 |
| 436 | Ga0466964_0774748 | 3300044706 | Bacteria | 540 |
| 437 | Ga0466971_0016134 | 3300044719 | Bacteria | 3291 |
| 438 | Ga0466968_0288721 | 3300044735 | Bacteria | 787 |
| 439 | Ga0466968_0392458 | 3300044735 | Bacteria | 679 |
| 440 | Ga0466970_0039150 | 3300044765 | Bacteria | 2516 |
| 441 | Ga0466957_0004676 | 3300044842 | Bacteria | 7654 |
| 442 | Ga0466960_0084385 | 3300044901 | Bacteria | 1607 |
| 443 | Ga0466960_0126954 | 3300044901 | Bacteria | 1342 |
| 444 | Ga0466959_0034249 | 3300045049 | Bacteria | 3757 |
| 445 | Ga0466959_0381528 | 3300045049 | Bacteria | 959 |
| 446 | Ga0466958_0002339 | 3300045836 | Bacteria | 9475 |
| 447 | Ga0466958_0029585 | 3300045836 | Bacteria | 3250 |
| 448 | Ga0466958_0074384 | 3300045836 | Unclassified | 2082 |
| 449 | Ga0466958_0460257 | 3300045836 | Unclassified | 824 |
| 450 | Ga0466967_0053245 | 3300045976 | Bacteria | 3556 |
| 451 | Ga0466967_0056267 | 3300045976 | Bacteria | 3467 |
| 452 | Ga0466967_0304885 | 3300045976 | Bacteria | 1533 |
| 453 | Ga0466967_0535772 | 3300045976 | Bacteria | 1151 |
| 454 | Ga0466967_0844674 | 3300045976 | Bacteria | 910 |
| 455 | Ga0466967_2262623 | 3300045976 | Bacteria | 539 |
| 456 | Ga0495592_0515500 | 3300046454 | Bacteria | 740 |
| 457 | Ga0495629_0000421 | 3300046459 | Bacteria | 35460 |
| 458 | Ga0495641_0002767 | 3300046461 | Bacteria | 13588 |
| 459 | Ga0495641_0126663 | 3300046461 | Bacteria | 1140 |
| 460 | Ga0495641_0346543 | 3300046461 | Bacteria | 671 |
| 461 | Ga0495596_0147691 | 3300046500 | Unclassified | 913 |
| 462 | Ga0495606_0000908 | 3300046507 | Bacteria | 43982 |
| 463 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 464 | Ga0495610_0267800 | 3300046512 | Unclassified | 670 |
| 465 | Ga0495616_0026032 | 3300046513 | Bacteria | 3118 |
| 466 | Ga0495618_0007882 | 3300046514 | Bacteria | 6445 |
| 467 | Ga0495618_0631267 | 3300046514 | Unclassified | 635 |
| 468 | Ga0495628_0126513 | 3300046516 | Bacteria | 1958 |
| 469 | Ga0495628_0365515 | 3300046516 | Bacteria | 1059 |
| 470 | Ga0495631_0169815 | 3300046518 | Unclassified | 935 |
| 471 | Ga0495637_0062760 | 3300046520 | Bacteria | 1520 |
| 472 | Ga0495666_0141567 | 3300046526 | Bacteria | 1121 |
| 473 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 474 | Ga0495652_0859306 | 3300046529 | Bacteria | 601 |
| 475 | Ga0495654_0192611 | 3300046530 | Unclassified | 877 |
| 476 | Ga0495640_0330949 | 3300046533 | Unclassified | 942 |
| 477 | Ga0495587_0011918 | 3300046536 | Bacteria | 5495 |
| 478 | Ga0495587_0042253 | 3300046536 | Bacteria | 2719 |
| 479 | Ga0495587_0168992 | 3300046536 | Unclassified | 1243 |
| 480 | Ga0495645_0000088 | 3300046543 | Bacteria | 63785 |
| 481 | Ga0495667_0424127 | 3300046559 | Unclassified | 837 |
| 482 | Ga0495656_0001553 | 3300046615 | Bacteria | 7504 |
| 483 | Ga0495635_0155602 | 3300046663 | Unclassified | 1556 |
| 484 | Ga0495588_0000247 | 3300046674 | Bacteria | 45295 |
| 485 | Ga0495588_0279375 | 3300046674 | Bacteria | 880 |
| 486 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 487 | Ga0495657_0003926 | 3300046675 | Bacteria | 11935 |
| 488 | Ga0495623_0230829 | 3300046679 | Unclassified | 1050 |
| 489 | Ga0495646_0508939 | 3300046680 | Bacteria | 618 |
| 490 | Ga0495581_0328233 | 3300047315 | Unclassified | 894 |
| 491 | Ga0495604_0000527 | 3300047317 | Bacteria | 33774 |
| 492 | Ga0495604_0177084 | 3300047317 | Unclassified | 1494 |
| 493 | Ga0495604_0281392 | 3300047317 | Unclassified | 1123 |
| 494 | Ga0495674_0000024 | 3300047319 | Bacteria | 141746 |
| 495 | Ga0495676_0037312 | 3300047321 | Bacteria | 4046 |
| 496 | Ga0495676_0043491 | 3300047321 | Bacteria | 3674 |
| 497 | Ga0495676_0172123 | 3300047321 | Bacteria | 1523 |
| 498 | Ga0495676_0528794 | 3300047321 | Bacteria | 772 |
| 499 | Ga0495680_0011541 | 3300047322 | Bacteria | 7816 |
| 500 | Ga0495680_0160606 | 3300047322 | Bacteria | 1632 |
| 501 | Ga0495680_0406497 | 3300047322 | Unclassified | 939 |
| 502 | Ga0495675_0000094 | 3300047444 | Bacteria | 63338 |
| 503 | Ga0495675_0197185 | 3300047444 | Unclassified | 1227 |
| 504 | Ga0495593_0048881 | 3300047673 | Unclassified | 2247 |
| 505 | Ga0495602_0001025 | 3300048088 | Bacteria | 27203 |
| 506 | Ga0495602_0002781 | 3300048088 | Bacteria | 17886 |
| 507 | Ga0495602_0245984 | 3300048088 | Unclassified | 1335 |
| 508 | Ga0495602_0480554 | 3300048088 | Bacteria | 872 |
| 509 | Ga0496100_0000019 | 3300048903 | Bacteria | 149995 |
| 510 | Ga0496100_0037684 | 3300048903 | Bacteria | 3058 |
| 511 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 512 | Ga0496101_0012095 | 3300048904 | Bacteria | 5752 |
| 513 | Ga0496102_0000438 | 3300048905 | Bacteria | 47526 |
| 514 | Ga0496102_0014250 | 3300048905 | Bacteria | 6907 |
| 515 | Ga0496102_0275993 | 3300048905 | Bacteria | 1584 |
| 516 | Ga0496102_0290837 | 3300048905 | Bacteria | 1540 |
| 517 | Ga0496102_0390136 | 3300048905 | Bacteria | 1310 |
| 518 | Ga0496102_1334753 | 3300048905 | Unclassified | 636 |
| 519 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 520 | Ga0496103_0012743 | 3300048906 | Bacteria | 4987 |
| 521 | Ga0496103_0093111 | 3300048906 | Bacteria | 1903 |
| 522 | Ga0496103_0744977 | 3300048906 | Bacteria | 620 |
| 523 | Ga0496104_0015865 | 3300048907 | Bacteria | 6834 |
| 524 | Ga0496104_0030147 | 3300048907 | Bacteria | 5038 |
| 525 | Ga0496104_0077504 | 3300048907 | Bacteria | 3167 |
| 526 | Ga0496105_0000386 | 3300048908 | Bacteria | 28919 |
| 527 | Ga0496105_0023169 | 3300048908 | Bacteria | 5034 |
| 528 | Ga0496106_0000156 | 3300048909 | Bacteria | 50301 |
| 529 | Ga0496106_0003859 | 3300048909 | Bacteria | 11174 |
| 530 | Ga0496106_1527038 | 3300048909 | Bacteria | 513 |
| 531 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 532 | Ga0496107_0036478 | 3300048910 | Bacteria | 3526 |
| 533 | Ga0496108_0000349 | 3300048911 | Bacteria | 39032 |
| 534 | Ga0496108_0026391 | 3300048911 | Bacteria | 4791 |
| 535 | Ga0496108_1469310 | 3300048911 | Bacteria | 568 |
| 536 | Ga0496109_0000307 | 3300048912 | Bacteria | 46191 |
| 537 | Ga0496109_0023193 | 3300048912 | Bacteria | 5506 |
| 538 | Ga0496109_0043003 | 3300048912 | Bacteria | 4095 |
| 539 | Ga0496109_0506353 | 3300048912 | Viruses | 1140 |
| 540 | Ga0496109_0659835 | 3300048912 | Bacteria | 983 |
| 541 | Ga0496109_0774298 | 3300048912 | Unclassified | 898 |
| 542 | Ga0496109_1637181 | 3300048912 | Bacteria | 578 |
| 543 | Ga0496110_0191812 | 3300048913 | Unclassified | 1855 |
| 544 | Ga0496110_0424779 | 3300048913 | Bacteria | 1212 |
| 545 | Ga0496111_0008560 | 3300048914 | Bacteria | 6778 |
| 546 | Ga0496111_0852053 | 3300048914 | Unclassified | 658 |
| 547 | Ga0496112_0025758 | 3300048915 | Bacteria | 5649 |
| 548 | Ga0496112_0189395 | 3300048915 | Bacteria | 2020 |
| 549 | Ga0496112_0266764 | 3300048915 | Bacteria | 1661 |
| 550 | Ga0496113_0000017 | 3300048916 | Bacteria | 74327 |
| 551 | Ga0496113_0003639 | 3300048916 | Bacteria | 9267 |
| 552 | Ga0496114_0003035 | 3300048917 | Bacteria | 12860 |
| 553 | Ga0496115_0000022 | 3300048918 | Bacteria | 164224 |
| 554 | Ga0496115_0000034 | 3300048918 | Bacteria | 135380 |
| 555 | Ga0496115_0000199 | 3300048918 | Bacteria | 56119 |
| 556 | Ga0496115_0070027 | 3300048918 | Bacteria | 2842 |
| 557 | Ga0501036_1251081 | 3300049572 | Bacteria | 604 |
| 558 | Ga0501040_0451419 | 3300049576 | Bacteria | 925 |
| 559 | Ga0501040_0679531 | 3300049576 | Bacteria | 744 |
| 560 | Ga0501040_0933706 | 3300049576 | Unclassified | 629 |
| 561 | Ga0501041_0934666 | 3300049577 | Bacteria | 557 |
| 562 | Ga0501042_0240369 | 3300049578 | Bacteria | 1307 |
| 563 | Ga0501042_0659414 | 3300049578 | Bacteria | 761 |
| 564 | Ga0501046_0287200 | 3300049580 | Bacteria | 1204 |
| 565 | Ga0501048_0393113 | 3300049582 | Bacteria | 991 |
| 566 | Ga0501048_0394578 | 3300049582 | Bacteria | 989 |
| 567 | Ga0501048_0692050 | 3300049582 | Unclassified | 732 |
| 568 | Ga0501068_1122107 | 3300049584 | Bacteria | 520 |
| 569 | Ga0501071_0348968 | 3300049587 | Bacteria | 1126 |
| 570 | Ga0501071_1163669 | 3300049587 | Unclassified | 596 |
| 571 | Ga0501071_1390207 | 3300049587 | Bacteria | 542 |
| 572 | Ga0501072_0286801 | 3300049588 | Bacteria | 1309 |
| 573 | Ga0501072_0902998 | 3300049588 | Unclassified | 690 |
| 574 | Ga0501075_0521517 | 3300049591 | Bacteria | 907 |
| 575 | Ga0501076_0275944 | 3300049592 | Bacteria | 1377 |
| 576 | Ga0501079_0245111 | 3300049741 | Bacteria | 1400 |
| 577 | Ga0501079_0298322 | 3300049741 | Bacteria | 1261 |
| 578 | Ga0501081_0072196 | 3300049743 | Bacteria | 2407 |
| 579 | Ga0501081_0246591 | 3300049743 | Unclassified | 1303 |
| 580 | Ga0501081_0257752 | 3300049743 | Bacteria | 1274 |
| 581 | Ga0501045_0344645 | 3300049824 | Bacteria | 1109 |
| 582 | nmdc:mga03n38_125390_c1 | 3300050490 | Bacteria | 1267 |
| 583 | nmdc:mga03n38_77330_c1 | 3300050490 | Bacteria | 1555 |
| 584 | nmdc:mga03n38_774754_c1 | 3300050490 | Bacteria | 557 |
| 585 | nmdc:mga00v17_383594_c1 | 3300050491 | Bacteria | 913 |
| 586 | nmdc:mga00v17_515863_c1 | 3300050491 | Bacteria | 774 |
| 587 | nmdc:mga00v17_54328_c1 | 3300050491 | Bacteria | 2443 |
| 588 | nmdc:mga00v17_867896_c1 | 3300050491 | Bacteria | 572 |
| 589 | nmdc:mga0yw44_123529_c1 | 3300050492 | Bacteria | 1669 |
| 590 | nmdc:mga0yw44_24246_c1 | 3300050492 | Bacteria | 3431 |
| 591 | nmdc:mga06z11_358425_c1 | 3300050494 | Unclassified | 874 |
| 592 | nmdc:mga06z11_740793_c1 | 3300050494 | Bacteria | 599 |
| 593 | nmdc:mga06z11_840551_c1 | 3300050494 | Unclassified | 559 |
| 594 | nmdc:mga05p37_1253453_c1 | 3300050507 | Unclassified | 760 |
| 595 | nmdc:mga05p37_135973_c1 | 3300050507 | Bacteria | 3014 |
| 596 | nmdc:mga05p37_1493425_c1 | 3300050507 | Bacteria | 673 |
| 597 | nmdc:mga05p37_1900666_c1 | 3300050507 | Bacteria | 568 |
| 598 | nmdc:mga05p37_43547_c1 | 3300050507 | Bacteria | 5522 |
| 599 | nmdc:mga05p37_483224_c1 | 3300050507 | Bacteria | 1426 |
| 600 | nmdc:mga09592_1135534_c1 | 3300050508 | Unclassified | 648 |
| 601 | nmdc:mga09592_9549_c1 | 3300050508 | Bacteria | 7883 |
| 602 | nmdc:mga0qj67_404678_c1 | 3300050509 | Bacteria | 1101 |
| 603 | nmdc:mga0qj67_515869_c1 | 3300050509 | Unclassified | 960 |
| 604 | nmdc:mga06r32_854578_c1 | 3300050510 | Bacteria | 868 |
| 605 | nmdc:mga08y16_137651_c1 | 3300050511 | Unclassified | 2538 |
| 606 | nmdc:mga08y16_437469_c1 | 3300050511 | Bacteria | 1335 |
| 607 | nmdc:mga08y16_75890_c1 | 3300050511 | Bacteria | 3503 |
| 608 | nmdc:mga08y16_88348_c1 | 3300050511 | Bacteria | 3230 |
| 609 | nmdc:mga0n895_101711_c1 | 3300050512 | Bacteria | 2884 |
| 610 | nmdc:mga0n895_25902_c1 | 3300050512 | Bacteria | 5546 |
| 611 | nmdc:mga0n895_375319_c1 | 3300050512 | Bacteria | 1439 |
| 612 | nmdc:mga0rr50_50969_c1 | 3300050513 | Bacteria | 3069 |
| 613 | nmdc:mga0rr50_97779_c1 | 3300050513 | Bacteria | 2299 |
| 614 | nmdc:mga08x19_214285_c1 | 3300050514 | Bacteria | 1322 |
| 615 | nmdc:mga0a205_417571_c1 | 3300050515 | Bacteria | 1204 |
| 616 | nmdc:mga0a205_7528_c1 | 3300050515 | Bacteria | 9862 |
| 617 | Ga0495601_0000029 | 3300053077 | Bacteria | 111437 |
| 618 | Ga0495601_0041695 | 3300053077 | Bacteria | 2878 |
| 619 | Ga0495612_0002233 | 3300053078 | Bacteria | 7962 |
| 620 | Ga0495612_0020013 | 3300053078 | Bacteria | 2681 |
| 621 | Ga0495655_0000010 | 3300053083 | Bacteria | 125615 |
| 622 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 623 | Ga0495619_0000233 | 3300053085 | Bacteria | 40638 |
| 624 | Ga0495619_0001241 | 3300053085 | Bacteria | 16706 |
| 625 | Ga0495619_0010884 | 3300053085 | Bacteria | 5724 |
| 626 | Ga0495619_0071843 | 3300053085 | Unclassified | 2316 |
| 627 | Ga0495619_0086364 | 3300053085 | Unclassified | 2120 |
| 628 | Ga0500628_000039 | 3300053129 | Bacteria | 49907 |
| 629 | Ga0501084_0173867 | 3300054114 | Bacteria | 1818 |
| 630 | Ga0501084_0200694 | 3300054114 | Bacteria | 1683 |
| 631 | Ga0501084_0653170 | 3300054114 | Bacteria | 888 |
| 632 | Ga0501084_0910033 | 3300054114 | Bacteria | 740 |
| 633 | Ga0501082_0561117 | 3300060353 | Bacteria | 999 |
| 634 | Ga0501082_0946006 | 3300060353 | Bacteria | 753 |
| 635 | Ga0466962_0135528 | 3300061719 | Bacteria | 1191 |
| 636 | Ga0530510_0082390 | 3300061734 | Bacteria | 2343 |
| 637 | Ga0530510_0300105 | 3300061734 | Bacteria | 1202 |
| 638 | Ga0530510_1594159 | 3300061734 | Bacteria | 501 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014325 | Ga0163163_10959432 | Ga0163163_109594321 | 134 |
| 2 | 3300005336 | Ga0070680_101335934 | Ga0070680_1013359342 | 136 |
| 3 | 3300005344 | Ga0070661_100047912 | Ga0070661_1000479123 | 136 |
| 4 | 3300005366 | Ga0070659_100005945 | Ga0070659_1000059452 | 136 |
| 5 | 3300005458 | Ga0070681_10614403 | Ga0070681_106144032 | 136 |
| 6 | 3300005535 | Ga0070684_100188225 | Ga0070684_1001882253 | 136 |
| 7 | 3300005564 | Ga0070664_100831947 | Ga0070664_1008319472 | 136 |
| 8 | 3300005577 | Ga0068857_100149525 | Ga0068857_1001495254 | 136 |
| 9 | 3300005616 | Ga0068852_100007831 | Ga0068852_1000078318 | 136 |
| 10 | 3300009098 | Ga0105245_11215220 | Ga0105245_112152202 | 136 |
| 11 | 3300013307 | Ga0157372_10103617 | Ga0157372_101036173 | 136 |
| 12 | 3300020082 | Ga0206353_10530369 | Ga0206353_105303693 | 136 |
| 13 | 3300025912 | Ga0207707_10282253 | Ga0207707_102822534 | 136 |
| 14 | 3300025917 | Ga0207660_11116881 | Ga0207660_111168812 | 136 |
| 15 | 3300025920 | Ga0207649_10097361 | Ga0207649_100973613 | 136 |
| 16 | 3300025920 | Ga0207649_10503233 | Ga0207649_105032332 | 136 |
| 17 | 3300025921 | Ga0207652_10191658 | Ga0207652_101916583 | 136 |
| 18 | 3300025924 | Ga0207694_10096787 | Ga0207694_100967872 | 136 |
| 19 | 3300025932 | Ga0207690_10299330 | Ga0207690_102993302 | 136 |
| 20 | 3300025944 | Ga0207661_10093974 | Ga0207661_100939742 | 136 |
| 21 | 3300026116 | Ga0207674_10226625 | Ga0207674_102266253 | 136 |
| 22 | 3300026116 | Ga0207674_10370061 | Ga0207674_103700612 | 136 |
| 23 | 3300026142 | Ga0207698_10262179 | Ga0207698_102621791 | 136 |
| 24 | 3300048911 | Ga0496108_1469310 | Ga0496108_1469310_130_540 | 136 |
| 25 | 3300048913 | Ga0496110_0424779 | Ga0496110_0424779_340_750 | 136 |
| 26 | 3300049576 | Ga0501040_0451419 | Ga0501040_0451419_367_783 | 136 |
| 27 | 3300049577 | Ga0501041_0934666 | Ga0501041_0934666_90_506 | 136 |
| 28 | 3300049578 | Ga0501042_0240369 | Ga0501042_0240369_558_977 | 136 |
| 29 | 3300060353 | Ga0501082_0946006 | Ga0501082_0946006_42_458 | 136 |
| 30 | 3300061734 | Ga0530510_1594159 | Ga0530510_1594159_37_453 | 136 |
| 31 | 3300005329 | Ga0070683_100084594 | Ga0070683_1000845942 | 137 |
| 32 | 3300005834 | Ga0068851_10132082 | Ga0068851_101320822 | 137 |
| 33 | 3300009094 | Ga0111539_10884775 | Ga0111539_108847752 | 137 |
| 34 | 3300009545 | Ga0105237_12778055 | Ga0105237_127780551 | 137 |
| 35 | 3300025914 | Ga0207671_10088848 | Ga0207671_100888481 | 137 |
| 36 | 3300025919 | Ga0207657_10015071 | Ga0207657_1001507112 | 137 |
| 37 | 3300025939 | Ga0207665_10411516 | Ga0207665_104115162 | 137 |
| 38 | 3300044735 | Ga0466968_0288721 | Ga0466968_0288721_45_458 | 137 |
| 39 | 3300048905 | Ga0496102_0390136 | Ga0496102_0390136_495_908 | 137 |
| 40 | 3300005354 | Ga0070675_102041212 | Ga0070675_1020412121 | 138 |
| 41 | 3300005548 | Ga0070665_100897632 | Ga0070665_1008976322 | 138 |
| 42 | 3300006178 | Ga0075367_10298522 | Ga0075367_102985222 | 138 |
| 43 | 3300009101 | Ga0105247_10134444 | Ga0105247_101344441 | 138 |
| 44 | 3300009545 | Ga0105237_10041255 | Ga0105237_100412557 | 138 |
| 45 | 3300010375 | Ga0105239_10468075 | Ga0105239_104680753 | 138 |
| 46 | 3300013104 | Ga0157370_10050656 | Ga0157370_100506563 | 138 |
| 47 | 3300037466 | Ga0395898_1089972 | Ga0395898_1089972_48_464 | 138 |
| 48 | 3300042461 | Ga0439460_0110157 | Ga0439460_0110157_11_427 | 138 |
| 49 | 3300050494 | nmdc:mga06z11_358425_c1 | nmdc:mga06z11_358425_c1_242_661 | 138 |
| 50 | 3300005340 | Ga0070689_100954865 | Ga0070689_1009548652 | 139 |
| 51 | 3300005366 | Ga0070659_100150761 | Ga0070659_1001507613 | 139 |
| 52 | 3300005441 | Ga0070700_100054790 | Ga0070700_1000547903 | 139 |
| 53 | 3300005459 | Ga0068867_100702266 | Ga0068867_1007022662 | 139 |
| 54 | 3300005564 | Ga0070664_100505543 | Ga0070664_1005055432 | 139 |
| 55 | 3300005718 | Ga0068866_10237818 | Ga0068866_102378182 | 139 |
| 56 | 3300005840 | Ga0068870_10183472 | Ga0068870_101834722 | 139 |
| 57 | 3300006048 | Ga0075363_100004167 | Ga0075363_1000041677 | 139 |
| 58 | 3300006048 | Ga0075363_100147607 | Ga0075363_1001476072 | 139 |
| 59 | 3300006051 | Ga0075364_10226577 | Ga0075364_102265772 | 139 |
| 60 | 3300006058 | Ga0075432_10057527 | Ga0075432_100575272 | 139 |
| 61 | 3300006178 | Ga0075367_10019603 | Ga0075367_100196033 | 139 |
| 62 | 3300006881 | Ga0068865_100165762 | Ga0068865_1001657622 | 139 |
| 63 | 3300009098 | Ga0105245_10007888 | Ga0105245_1000788811 | 139 |
| 64 | 3300009551 | Ga0105238_10012331 | Ga0105238_100123312 | 139 |
| 65 | 3300011119 | Ga0105246_10036422 | Ga0105246_100364225 | 139 |
| 66 | 3300013296 | Ga0157374_10921840 | Ga0157374_109218402 | 139 |
| 67 | 3300014326 | Ga0157380_10021138 | Ga0157380_100211383 | 139 |
| 68 | 3300014326 | Ga0157380_10141838 | Ga0157380_101418382 | 139 |
| 69 | 3300025901 | Ga0207688_10577124 | Ga0207688_105771242 | 139 |
| 70 | 3300025907 | Ga0207645_10638417 | Ga0207645_106384172 | 139 |
| 71 | 3300025908 | Ga0207643_10035518 | Ga0207643_100355182 | 139 |
| 72 | 3300025925 | Ga0207650_11501151 | Ga0207650_115011511 | 139 |
| 73 | 3300025937 | Ga0207669_10532357 | Ga0207669_105323572 | 139 |
| 74 | 3300025945 | Ga0207679_11374281 | Ga0207679_113742811 | 139 |
| 75 | 3300026075 | Ga0207708_10008033 | Ga0207708_100080335 | 139 |
| 76 | 3300026089 | Ga0207648_10153748 | Ga0207648_101537482 | 139 |
| 77 | 3300026118 | Ga0207675_102192839 | Ga0207675_1021928392 | 139 |
| 78 | 3300028379 | Ga0268266_10550397 | Ga0268266_105503972 | 139 |
| 79 | 3300031995 | Ga0307409_100898684 | Ga0307409_1008986841 | 139 |
| 80 | 3300032002 | Ga0307416_100838987 | Ga0307416_1008389872 | 139 |
| 81 | 3300049576 | Ga0501040_0933706 | Ga0501040_0933706_160_582 | 139 |
| 82 | 3300049588 | Ga0501072_0902998 | Ga0501072_0902998_171_593 | 139 |
| 83 | 3300049741 | Ga0501079_0298322 | Ga0501079_0298322_161_583 | 139 |
| 84 | 3300050490 | nmdc:mga03n38_125390_c1 | nmdc:mga03n38_125390_c1_166_588 | 139 |
| 85 | 3300050490 | nmdc:mga03n38_77330_c1 | nmdc:mga03n38_77330_c1_491_913 | 139 |
| 86 | 3300050494 | nmdc:mga06z11_740793_c1 | nmdc:mga06z11_740793_c1_68_490 | 139 |
| 87 | 3300054114 | Ga0501084_0910033 | Ga0501084_0910033_147_569 | 139 |
| 88 | 3300005329 | Ga0070683_100110699 | Ga0070683_1001106993 | 141 |
| 89 | 3300005366 | Ga0070659_101017130 | Ga0070659_1010171302 | 141 |
| 90 | 3300005434 | Ga0070709_10513680 | Ga0070709_105136802 | 141 |
| 91 | 3300005436 | Ga0070713_100759399 | Ga0070713_1007593991 | 141 |
| 92 | 3300005459 | Ga0068867_100224070 | Ga0068867_1002240703 | 141 |
| 93 | 3300005535 | Ga0070684_100605818 | Ga0070684_1006058182 | 141 |
| 94 | 3300005539 | Ga0068853_101147488 | Ga0068853_1011474882 | 141 |
| 95 | 3300005564 | Ga0070664_100060258 | Ga0070664_1000602583 | 141 |
| 96 | 3300005719 | Ga0068861_100192551 | Ga0068861_1001925512 | 141 |
| 97 | 3300005834 | Ga0068851_10565365 | Ga0068851_105653652 | 141 |
| 98 | 3300005937 | Ga0081455_10099757 | Ga0081455_100997572 | 141 |
| 99 | 3300006058 | Ga0075432_10133145 | Ga0075432_101331452 | 141 |
| 100 | 3300006173 | Ga0070716_100106063 | Ga0070716_1001060632 | 141 |
| 101 | 3300006175 | Ga0070712_100013203 | Ga0070712_1000132036 | 141 |
| 102 | 3300006844 | Ga0075428_100028774 | Ga0075428_1000287745 | 141 |
| 103 | 3300006846 | Ga0075430_100009898 | Ga0075430_1000098983 | 141 |
| 104 | 3300009098 | Ga0105245_10313345 | Ga0105245_103133452 | 141 |
| 105 | 3300009147 | Ga0114129_12487513 | Ga0114129_124875131 | 141 |
| 106 | 3300009148 | Ga0105243_10209962 | Ga0105243_102099622 | 141 |
| 107 | 3300009553 | Ga0105249_11021787 | Ga0105249_110217872 | 141 |
| 108 | 3300013297 | Ga0157378_11996859 | Ga0157378_119968591 | 141 |
| 109 | 3300014326 | Ga0157380_11520086 | Ga0157380_115200862 | 141 |
| 110 | 3300014745 | Ga0157377_10139331 | Ga0157377_101393312 | 141 |
| 111 | 3300025901 | Ga0207688_10722927 | Ga0207688_107229271 | 141 |
| 112 | 3300025906 | Ga0207699_10539800 | Ga0207699_105398002 | 141 |
| 113 | 3300025915 | Ga0207693_10017214 | Ga0207693_100172142 | 141 |
| 114 | 3300025919 | Ga0207657_10399549 | Ga0207657_103995493 | 141 |
| 115 | 3300025920 | Ga0207649_10962752 | Ga0207649_109627521 | 141 |
| 116 | 3300025923 | Ga0207681_10435077 | Ga0207681_104350771 | 141 |
| 117 | 3300025929 | Ga0207664_10980379 | Ga0207664_109803791 | 141 |
| 118 | 3300025932 | Ga0207690_10301112 | Ga0207690_103011122 | 141 |
| 119 | 3300025935 | Ga0207709_10329893 | Ga0207709_103298931 | 141 |
| 120 | 3300025939 | Ga0207665_10095892 | Ga0207665_100958922 | 141 |
| 121 | 3300025940 | Ga0207691_10942009 | Ga0207691_109420091 | 141 |
| 122 | 3300025944 | Ga0207661_10808523 | Ga0207661_108085232 | 141 |
| 123 | 3300025945 | Ga0207679_10042876 | Ga0207679_100428762 | 141 |
| 124 | 3300025945 | Ga0207679_10881164 | Ga0207679_108811641 | 141 |
| 125 | 3300026041 | Ga0207639_11151912 | Ga0207639_111519121 | 141 |
| 126 | 3300026089 | Ga0207648_10375681 | Ga0207648_103756811 | 141 |
| 127 | 3300026118 | Ga0207675_100244343 | Ga0207675_1002443432 | 141 |
| 128 | 3300028563 | Ga0265319_1070324 | Ga0265319_10703242 | 141 |
| 129 | 3300031731 | Ga0307405_10409326 | Ga0307405_104093261 | 141 |
| 130 | 3300031911 | Ga0307412_10686438 | Ga0307412_106864382 | 141 |
| 131 | 3300031995 | Ga0307409_100093628 | Ga0307409_1000936283 | 141 |
| 132 | 3300031995 | Ga0307409_100964232 | Ga0307409_1009642321 | 141 |
| 133 | 3300032002 | Ga0307416_100097604 | Ga0307416_1000976042 | 141 |
| 134 | 3300032002 | Ga0307416_100157621 | Ga0307416_1001576213 | 141 |
| 135 | 3300032002 | Ga0307416_100405191 | Ga0307416_1004051912 | 141 |
| 136 | 3300032004 | Ga0307414_10475724 | Ga0307414_104757243 | 141 |
| 137 | 3300032004 | Ga0307414_10923631 | Ga0307414_109236312 | 141 |
| 138 | 3300032005 | Ga0307411_10637127 | Ga0307411_106371273 | 141 |
| 139 | 3300032126 | Ga0307415_100004333 | Ga0307415_1000043336 | 141 |
| 140 | 3300032126 | Ga0307415_100286679 | Ga0307415_1002866792 | 141 |
| 141 | 3300032126 | Ga0307415_100646199 | Ga0307415_1006461992 | 141 |
| 142 | 3300037312 | Ga0395899_0014597 | Ga0395899_0014597_1034_1459 | 141 |
| 143 | 3300037418 | Ga0395900_0166985 | Ga0395900_0166985_16_441 | 141 |
| 144 | 3300037466 | Ga0395898_0001996 | Ga0395898_0001996_25060_25485 | 141 |
| 145 | 3300037471 | Ga0395905_0012030 | Ga0395905_0012030_1217_1642 | 141 |
| 146 | 3300037853 | Ga0436364_1340043 | Ga0436364_1340043_515_940 | 141 |
| 147 | 3300038443 | Ga0395901_0034351 | Ga0395901_0034351_969_1394 | 141 |
| 148 | 3300039437 | Ga0436365_1904503 | Ga0436365_1904503_70_495 | 141 |
| 149 | 3300039453 | Ga0436362_1260871 | Ga0436362_1260871_729_1154 | 141 |
| 150 | 3300041512 | Ga0451853_3583735 | Ga0451853_3583735_122_547 | 141 |
| 151 | 3300042136 | Ga0450900_026288 | Ga0450900_026288_373_798 | 141 |
| 152 | 3300042438 | Ga0439459_0081443 | Ga0439459_0081443_285_710 | 141 |
| 153 | 3300042439 | Ga0439464_0095572 | Ga0439464_0095572_201_626 | 141 |
| 154 | 3300044683 | Ga0466965_0068770 | Ga0466965_0068770_332_841 | 141 |
| 155 | 3300044683 | Ga0466965_0405103 | Ga0466965_0405103_269_697 | 141 |
| 156 | 3300044694 | Ga0466963_0040454 | Ga0466963_0040454_860_1369 | 141 |
| 157 | 3300044694 | Ga0466963_0324430 | Ga0466963_0324430_635_1060 | 141 |
| 158 | 3300044706 | Ga0466964_0172360 | Ga0466964_0172360_209_634 | 141 |
| 159 | 3300044719 | Ga0466971_0016134 | Ga0466971_0016134_1207_1716 | 141 |
| 160 | 3300044735 | Ga0466968_0392458 | Ga0466968_0392458_47_556 | 141 |
| 161 | 3300044765 | Ga0466970_0039150 | Ga0466970_0039150_862_1371 | 141 |
| 162 | 3300044842 | Ga0466957_0004676 | Ga0466957_0004676_5204_5713 | 141 |
| 163 | 3300045049 | Ga0466959_0034249 | Ga0466959_0034249_2164_2673 | 141 |
| 164 | 3300045836 | Ga0466958_0002339 | Ga0466958_0002339_1829_2338 | 141 |
| 165 | 3300045836 | Ga0466958_0029585 | Ga0466958_0029585_2504_2932 | 141 |
| 166 | 3300045836 | Ga0466958_0460257 | Ga0466958_0460257_262_690 | 141 |
| 167 | 3300045976 | Ga0466967_0056267 | Ga0466967_0056267_2040_2465 | 141 |
| 168 | 3300045976 | Ga0466967_2262623 | Ga0466967_2262623_72_497 | 141 |
| 169 | 3300046514 | Ga0495618_0007882 | Ga0495618_0007882_1894_2319 | 141 |
| 170 | 3300046516 | Ga0495628_0126513 | Ga0495628_0126513_702_1127 | 141 |
| 171 | 3300046543 | Ga0495645_0000088 | Ga0495645_0000088_48290_48715 | 141 |
| 172 | 3300046679 | Ga0495623_0230829 | Ga0495623_0230829_36_461 | 141 |
| 173 | 3300046680 | Ga0495646_0508939 | Ga0495646_0508939_16_441 | 141 |
| 174 | 3300048906 | Ga0496103_0093111 | Ga0496103_0093111_117_569 | 141 |
| 175 | 3300048918 | Ga0496115_0000034 | Ga0496115_0000034_2416_2859 | 141 |
| 176 | 3300048918 | Ga0496115_0000199 | Ga0496115_0000199_16473_16916 | 141 |
| 177 | 3300050507 | nmdc:mga05p37_1253453_c1 | nmdc:mga05p37_1253453_c1_258_683 | 141 |
| 178 | 3300050508 | nmdc:mga09592_1135534_c1 | nmdc:mga09592_1135534_c1_133_564 | 141 |
| 179 | 3300050509 | nmdc:mga0qj67_404678_c1 | nmdc:mga0qj67_404678_c1_43_468 | 141 |
| 180 | 3300050511 | nmdc:mga08y16_437469_c1 | nmdc:mga08y16_437469_c1_419_844 | 141 |
| 181 | 3300053078 | Ga0495612_0002233 | Ga0495612_0002233_2578_3003 | 141 |
| 182 | 3300061719 | Ga0466962_0135528 | Ga0466962_0135528_414_923 | 141 |
| 183 | 3300005330 | Ga0070690_100224293 | Ga0070690_1002242931 | 142 |
| 184 | 3300005338 | Ga0068868_100192095 | Ga0068868_1001920953 | 142 |
| 185 | 3300005353 | Ga0070669_100344091 | Ga0070669_1003440912 | 142 |
| 186 | 3300005364 | Ga0070673_100293591 | Ga0070673_1002935912 | 142 |
| 187 | 3300005435 | Ga0070714_100036362 | Ga0070714_1000363622 | 142 |
| 188 | 3300005439 | Ga0070711_100018198 | Ga0070711_1000181985 | 142 |
| 189 | 3300005441 | Ga0070700_101268362 | Ga0070700_1012683621 | 142 |
| 190 | 3300005456 | Ga0070678_100333495 | Ga0070678_1003334951 | 142 |
| 191 | 3300005459 | Ga0068867_100544601 | Ga0068867_1005446012 | 142 |
| 192 | 3300005544 | Ga0070686_100122372 | Ga0070686_1001223724 | 142 |
| 193 | 3300005548 | Ga0070665_100606321 | Ga0070665_1006063212 | 142 |
| 194 | 3300005614 | Ga0068856_100003669 | Ga0068856_10000366911 | 142 |
| 195 | 3300005614 | Ga0068856_101364076 | Ga0068856_1013640761 | 142 |
| 196 | 3300005617 | Ga0068859_100410570 | Ga0068859_1004105702 | 142 |
| 197 | 3300005842 | Ga0068858_100092118 | Ga0068858_1000921183 | 142 |
| 198 | 3300005937 | Ga0081455_10167912 | Ga0081455_101679122 | 142 |
| 199 | 3300006028 | Ga0070717_11749715 | Ga0070717_117497151 | 142 |
| 200 | 3300006038 | Ga0075365_10285626 | Ga0075365_102856262 | 142 |
| 201 | 3300006173 | Ga0070716_100179404 | Ga0070716_1001794042 | 142 |
| 202 | 3300006178 | Ga0075367_10256231 | Ga0075367_102562311 | 142 |
| 203 | 3300006881 | Ga0068865_100129502 | Ga0068865_1001295023 | 142 |
| 204 | 3300006931 | Ga0097620_100410554 | Ga0097620_1004105542 | 142 |
| 205 | 3300009098 | Ga0105245_10009000 | Ga0105245_1000900010 | 142 |
| 206 | 3300009101 | Ga0105247_11154295 | Ga0105247_111542951 | 142 |
| 207 | 3300009147 | Ga0114129_11335224 | Ga0114129_113352242 | 142 |
| 208 | 3300009148 | Ga0105243_10103282 | Ga0105243_101032823 | 142 |
| 209 | 3300009553 | Ga0105249_10610508 | Ga0105249_106105082 | 142 |
| 210 | 3300013306 | Ga0163162_12079337 | Ga0163162_120793371 | 142 |
| 211 | 3300013307 | Ga0157372_11702049 | Ga0157372_117020492 | 142 |
| 212 | 3300014326 | Ga0157380_10102618 | Ga0157380_101026183 | 142 |
| 213 | 3300014969 | Ga0157376_10427576 | Ga0157376_104275762 | 142 |
| 214 | 3300025901 | Ga0207688_10024164 | Ga0207688_100241644 | 142 |
| 215 | 3300025903 | Ga0207680_10088670 | Ga0207680_100886702 | 142 |
| 216 | 3300025904 | Ga0207647_10785994 | Ga0207647_107859941 | 142 |
| 217 | 3300025915 | Ga0207693_10044456 | Ga0207693_100444563 | 142 |
| 218 | 3300025927 | Ga0207687_10506881 | Ga0207687_105068812 | 142 |
| 219 | 3300025935 | Ga0207709_10143163 | Ga0207709_101431631 | 142 |
| 220 | 3300025936 | Ga0207670_10102412 | Ga0207670_101024122 | 142 |
| 221 | 3300025938 | Ga0207704_10028152 | Ga0207704_100281523 | 142 |
| 222 | 3300025939 | Ga0207665_10093657 | Ga0207665_100936572 | 142 |
| 223 | 3300025941 | Ga0207711_10517354 | Ga0207711_105173541 | 142 |
| 224 | 3300025960 | Ga0207651_10242430 | Ga0207651_102424302 | 142 |
| 225 | 3300025961 | Ga0207712_10528434 | Ga0207712_105284342 | 142 |
| 226 | 3300026023 | Ga0207677_10177042 | Ga0207677_101770423 | 142 |
| 227 | 3300026035 | Ga0207703_10083718 | Ga0207703_100837185 | 142 |
| 228 | 3300026067 | Ga0207678_10080828 | Ga0207678_100808282 | 142 |
| 229 | 3300026078 | Ga0207702_10000419 | Ga0207702_1000041935 | 142 |
| 230 | 3300026078 | Ga0207702_10621854 | Ga0207702_106218541 | 142 |
| 231 | 3300026089 | Ga0207648_10274512 | Ga0207648_102745122 | 142 |
| 232 | 3300026121 | Ga0207683_10340413 | Ga0207683_103404132 | 142 |
| 233 | 3300028379 | Ga0268266_11398313 | Ga0268266_113983132 | 142 |
| 234 | 3300035119 | Ga0373956_0601583 | Ga0373956_0601583_64_492 | 142 |
| 235 | 3300036401 | Ga0373937_0479421 | Ga0373937_0479421_180_608 | 142 |
| 236 | 3300037466 | Ga0395898_0442055 | Ga0395898_0442055_450_878 | 142 |
| 237 | 3300038443 | Ga0395901_0171605 | Ga0395901_0171605_989_1417 | 142 |
| 238 | 3300044684 | Ga0466966_0068613 | Ga0466966_0068613_972_1409 | 142 |
| 239 | 3300044693 | Ga0466961_0363200 | Ga0466961_0363200_150_587 | 142 |
| 240 | 3300044706 | Ga0466964_0334035 | Ga0466964_0334035_177_608 | 142 |
| 241 | 3300044706 | Ga0466964_0499550 | Ga0466964_0499550_159_593 | 142 |
| 242 | 3300045049 | Ga0466959_0381528 | Ga0466959_0381528_440_877 | 142 |
| 243 | 3300045976 | Ga0466967_0053245 | Ga0466967_0053245_2838_3269 | 142 |
| 244 | 3300045976 | Ga0466967_0304885 | Ga0466967_0304885_29_457 | 142 |
| 245 | 3300046461 | Ga0495641_0126663 | Ga0495641_0126663_153_581 | 142 |
| 246 | 3300046674 | Ga0495588_0000247 | Ga0495588_0000247_25534_25962 | 142 |
| 247 | 3300046674 | Ga0495588_0279375 | Ga0495588_0279375_167_595 | 142 |
| 248 | 3300047315 | Ga0495581_0328233 | Ga0495581_0328233_251_679 | 142 |
| 249 | 3300047321 | Ga0495676_0172123 | Ga0495676_0172123_1016_1444 | 142 |
| 250 | 3300047321 | Ga0495676_0528794 | Ga0495676_0528794_175_603 | 142 |
| 251 | 3300048903 | Ga0496100_0037684 | Ga0496100_0037684_1389_1817 | 142 |
| 252 | 3300048904 | Ga0496101_0012095 | Ga0496101_0012095_2574_3002 | 142 |
| 253 | 3300048905 | Ga0496102_0014250 | Ga0496102_0014250_4066_4494 | 142 |
| 254 | 3300048906 | Ga0496103_0012743 | Ga0496103_0012743_3230_3658 | 142 |
| 255 | 3300048907 | Ga0496104_0030147 | Ga0496104_0030147_3982_4410 | 142 |
| 256 | 3300048908 | Ga0496105_0023169 | Ga0496105_0023169_4376_4804 | 142 |
| 257 | 3300048909 | Ga0496106_0003859 | Ga0496106_0003859_1129_1557 | 142 |
| 258 | 3300048910 | Ga0496107_0036478 | Ga0496107_0036478_2007_2435 | 142 |
| 259 | 3300048911 | Ga0496108_0026391 | Ga0496108_0026391_1637_2065 | 142 |
| 260 | 3300048912 | Ga0496109_0023193 | Ga0496109_0023193_2674_3102 | 142 |
| 261 | 3300048912 | Ga0496109_0043003 | Ga0496109_0043003_2145_2573 | 142 |
| 262 | 3300048912 | Ga0496109_0659835 | Ga0496109_0659835_225_653 | 142 |
| 263 | 3300048913 | Ga0496110_0191812 | Ga0496110_0191812_227_655 | 142 |
| 264 | 3300048914 | Ga0496111_0008560 | Ga0496111_0008560_1981_2409 | 142 |
| 265 | 3300048915 | Ga0496112_0025758 | Ga0496112_0025758_1979_2413 | 142 |
| 266 | 3300048915 | Ga0496112_0266764 | Ga0496112_0266764_975_1403 | 142 |
| 267 | 3300048916 | Ga0496113_0000017 | Ga0496113_0000017_9834_10268 | 142 |
| 268 | 3300048916 | Ga0496113_0003639 | Ga0496113_0003639_1533_1961 | 142 |
| 269 | 3300048917 | Ga0496114_0003035 | Ga0496114_0003035_6915_7343 | 142 |
| 270 | 3300048918 | Ga0496115_0070027 | Ga0496115_0070027_598_1026 | 142 |
| 271 | 3300050492 | nmdc:mga0yw44_123529_c1 | nmdc:mga0yw44_123529_c1_664_1092 | 142 |
| 272 | 3300050507 | nmdc:mga05p37_1900666_c1 | nmdc:mga05p37_1900666_c1_56_484 | 142 |
| 273 | 3300053085 | Ga0495619_0086364 | Ga0495619_0086364_602_1030 | 142 |
| 274 | 3300005338 | Ga0068868_101302721 | Ga0068868_1013027212 | 143 |
| 275 | 3300005367 | Ga0070667_100002266 | Ga0070667_10000226610 | 143 |
| 276 | 3300005440 | Ga0070705_100296921 | Ga0070705_1002969212 | 143 |
| 277 | 3300005445 | Ga0070708_100891983 | Ga0070708_1008919831 | 143 |
| 278 | 3300005459 | Ga0068867_100200329 | Ga0068867_1002003292 | 143 |
| 279 | 3300005468 | Ga0070707_100265160 | Ga0070707_1002651601 | 143 |
| 280 | 3300005548 | Ga0070665_100216008 | Ga0070665_1002160082 | 143 |
| 281 | 3300005549 | Ga0070704_100128171 | Ga0070704_1001281712 | 143 |
| 282 | 3300005578 | Ga0068854_100000345 | Ga0068854_10000034521 | 143 |
| 283 | 3300005617 | Ga0068859_101822915 | Ga0068859_1018229151 | 143 |
| 284 | 3300005834 | Ga0068851_10005227 | Ga0068851_100052276 | 143 |
| 285 | 3300005842 | Ga0068858_100093347 | Ga0068858_1000933473 | 143 |
| 286 | 3300005937 | Ga0081455_10001231 | Ga0081455_100012313 | 143 |
| 287 | 3300005937 | Ga0081455_10186108 | Ga0081455_101861082 | 143 |
| 288 | 3300006038 | Ga0075365_10004155 | Ga0075365_100041555 | 143 |
| 289 | 3300006038 | Ga0075365_10080967 | Ga0075365_100809673 | 143 |
| 290 | 3300006051 | Ga0075364_10032023 | Ga0075364_100320233 | 143 |
| 291 | 3300006058 | Ga0075432_10031829 | Ga0075432_100318293 | 143 |
| 292 | 3300006175 | Ga0070712_100155843 | Ga0070712_1001558433 | 143 |
| 293 | 3300006178 | Ga0075367_10541370 | Ga0075367_105413702 | 143 |
| 294 | 3300006844 | Ga0075428_100104941 | Ga0075428_1001049412 | 143 |
| 295 | 3300006847 | Ga0075431_100024109 | Ga0075431_1000241098 | 143 |
| 296 | 3300006847 | Ga0075431_100125200 | Ga0075431_1001252002 | 143 |
| 297 | 3300006852 | Ga0075433_10410805 | Ga0075433_104108052 | 143 |
| 298 | 3300006881 | Ga0068865_100680500 | Ga0068865_1006805002 | 143 |
| 299 | 3300006914 | Ga0075436_100976752 | Ga0075436_1009767522 | 143 |
| 300 | 3300006931 | Ga0097620_101822758 | Ga0097620_1018227581 | 143 |
| 301 | 3300007076 | Ga0075435_100346269 | Ga0075435_1003462692 | 143 |
| 302 | 3300009094 | Ga0111539_10013057 | Ga0111539_1001305712 | 143 |
| 303 | 3300009094 | Ga0111539_10122100 | Ga0111539_101221002 | 143 |
| 304 | 3300009098 | Ga0105245_10943920 | Ga0105245_109439202 | 143 |
| 305 | 3300009147 | Ga0114129_10176418 | Ga0114129_101764183 | 143 |
| 306 | 3300009147 | Ga0114129_10672083 | Ga0114129_106720831 | 143 |
| 307 | 3300009148 | Ga0105243_10176167 | Ga0105243_101761673 | 143 |
| 308 | 3300009176 | Ga0105242_10072255 | Ga0105242_100722554 | 143 |
| 309 | 3300009176 | Ga0105242_13188490 | Ga0105242_131884901 | 143 |
| 310 | 3300009553 | Ga0105249_10446735 | Ga0105249_104467353 | 143 |
| 311 | 3300010375 | Ga0105239_10217724 | Ga0105239_102177243 | 143 |
| 312 | 3300010375 | Ga0105239_10536565 | Ga0105239_105365652 | 143 |
| 313 | 3300010375 | Ga0105239_11321591 | Ga0105239_113215912 | 143 |
| 314 | 3300013297 | Ga0157378_11157248 | Ga0157378_111572482 | 143 |
| 315 | 3300013307 | Ga0157372_10000284 | Ga0157372_1000028428 | 143 |
| 316 | 3300013308 | Ga0157375_10492995 | Ga0157375_104929952 | 143 |
| 317 | 3300014326 | Ga0157380_11692519 | Ga0157380_116925192 | 143 |
| 318 | 3300014745 | Ga0157377_10172065 | Ga0157377_101720652 | 143 |
| 319 | 3300014968 | Ga0157379_10024043 | Ga0157379_100240435 | 143 |
| 320 | 3300025321 | Ga0207656_10002224 | Ga0207656_100022247 | 143 |
| 321 | 3300025899 | Ga0207642_10294098 | Ga0207642_102940982 | 143 |
| 322 | 3300025918 | Ga0207662_11118252 | Ga0207662_111182521 | 143 |
| 323 | 3300025927 | Ga0207687_11102528 | Ga0207687_111025281 | 143 |
| 324 | 3300025931 | Ga0207644_11344200 | Ga0207644_113442002 | 143 |
| 325 | 3300025935 | Ga0207709_10515805 | Ga0207709_105158052 | 143 |
| 326 | 3300025938 | Ga0207704_10297883 | Ga0207704_102978832 | 143 |
| 327 | 3300025961 | Ga0207712_10007217 | Ga0207712_100072173 | 143 |
| 328 | 3300025961 | Ga0207712_11611902 | Ga0207712_116119022 | 143 |
| 329 | 3300025972 | Ga0207668_10080861 | Ga0207668_100808611 | 143 |
| 330 | 3300025981 | Ga0207640_10000077 | Ga0207640_1000007720 | 143 |
| 331 | 3300025986 | Ga0207658_10002876 | Ga0207658_100028763 | 143 |
| 332 | 3300026035 | Ga0207703_10067575 | Ga0207703_100675753 | 143 |
| 333 | 3300027907 | Ga0207428_10084372 | Ga0207428_100843723 | 143 |
| 334 | 3300028379 | Ga0268266_10210857 | Ga0268266_102108573 | 143 |
| 335 | 3300028381 | Ga0268264_10120385 | Ga0268264_101203853 | 143 |
| 336 | 3300031251 | Ga0265327_10378005 | Ga0265327_103780052 | 143 |
| 337 | 3300037418 | Ga0395900_1341804 | Ga0395900_1341804_138_572 | 143 |
| 338 | 3300037471 | Ga0395905_1638331 | Ga0395905_1638331_31_462 | 143 |
| 339 | 3300038443 | Ga0395901_0818887 | Ga0395901_0818887_207_638 | 143 |
| 340 | 3300044901 | Ga0466960_0126954 | Ga0466960_0126954_478_918 | 143 |
| 341 | 3300046514 | Ga0495618_0631267 | Ga0495618_0631267_40_477 | 143 |
| 342 | 3300047317 | Ga0495604_0281392 | Ga0495604_0281392_641_1078 | 143 |
| 343 | 3300048088 | Ga0495602_0001025 | Ga0495602_0001025_26730_27167 | 143 |
| 344 | 3300048088 | Ga0495602_0002781 | Ga0495602_0002781_17398_17853 | 143 |
| 345 | 3300048905 | Ga0496102_0275993 | Ga0496102_0275993_939_1370 | 143 |
| 346 | 3300048905 | Ga0496102_0290837 | Ga0496102_0290837_464_910 | 143 |
| 347 | 3300048906 | Ga0496103_0744977 | Ga0496103_0744977_21_452 | 143 |
| 348 | 3300048909 | Ga0496106_1527038 | Ga0496106_1527038_57_488 | 143 |
| 349 | 3300048912 | Ga0496109_1637181 | Ga0496109_1637181_15_464 | 143 |
| 350 | 3300049580 | Ga0501046_0287200 | Ga0501046_0287200_481_912 | 143 |
| 351 | 3300049582 | Ga0501048_0393113 | Ga0501048_0393113_108_539 | 143 |
| 352 | 3300049582 | Ga0501048_0394578 | Ga0501048_0394578_485_916 | 143 |
| 353 | 3300049584 | Ga0501068_1122107 | Ga0501068_1122107_71_502 | 143 |
| 354 | 3300049588 | Ga0501072_0286801 | Ga0501072_0286801_78_509 | 143 |
| 355 | 3300049592 | Ga0501076_0275944 | Ga0501076_0275944_300_731 | 143 |
| 356 | 3300049741 | Ga0501079_0245111 | Ga0501079_0245111_724_1155 | 143 |
| 357 | 3300049743 | Ga0501081_0246591 | Ga0501081_0246591_679_1110 | 143 |
| 358 | 3300050491 | nmdc:mga00v17_383594_c1 | nmdc:mga00v17_383594_c1_159_590 | 143 |
| 359 | 3300050491 | nmdc:mga00v17_515863_c1 | nmdc:mga00v17_515863_c1_242_673 | 143 |
| 360 | 3300050491 | nmdc:mga00v17_54328_c1 | nmdc:mga00v17_54328_c1_1306_1737 | 143 |
| 361 | 3300050492 | nmdc:mga0yw44_24246_c1 | nmdc:mga0yw44_24246_c1_37_468 | 143 |
| 362 | 3300050494 | nmdc:mga06z11_840551_c1 | nmdc:mga06z11_840551_c1_32_463 | 143 |
| 363 | 3300050507 | nmdc:mga05p37_43547_c1 | nmdc:mga05p37_43547_c1_3879_4310 | 143 |
| 364 | 3300050511 | nmdc:mga08y16_137651_c1 | nmdc:mga08y16_137651_c1_444_875 | 143 |
| 365 | 3300050511 | nmdc:mga08y16_88348_c1 | nmdc:mga08y16_88348_c1_360_791 | 143 |
| 366 | 3300050512 | nmdc:mga0n895_101711_c1 | nmdc:mga0n895_101711_c1_348_779 | 143 |
| 367 | 3300050512 | nmdc:mga0n895_25902_c1 | nmdc:mga0n895_25902_c1_2689_3120 | 143 |
| 368 | 3300050513 | nmdc:mga0rr50_97779_c1 | nmdc:mga0rr50_97779_c1_222_653 | 143 |
| 369 | 3300050514 | nmdc:mga08x19_214285_c1 | nmdc:mga08x19_214285_c1_22_453 | 143 |
| 370 | 3300050515 | nmdc:mga0a205_417571_c1 | nmdc:mga0a205_417571_c1_142_573 | 143 |
| 371 | 3300054114 | Ga0501084_0173867 | Ga0501084_0173867_542_973 | 143 |
| 372 | 3300061734 | Ga0530510_0300105 | Ga0530510_0300105_644_1075 | 143 |
| 373 | 3300001977 | JGI24746J21847_1001026 | JGI24746J21847_10010264 | 144 |
| 374 | 3300001979 | JGI24740J21852_10002767 | JGI24740J21852_100027672 | 144 |
| 375 | 3300002459 | JGI24751J29686_10070651 | JGI24751J29686_100706511 | 144 |
| 376 | 3300003203 | JGI25406J46586_10027831 | JGI25406J46586_100278314 | 144 |
| 377 | 3300005329 | Ga0070683_100008978 | Ga0070683_1000089783 | 144 |
| 378 | 3300005329 | Ga0070683_100010609 | Ga0070683_1000106093 | 144 |
| 379 | 3300005329 | Ga0070683_100015665 | Ga0070683_1000156653 | 144 |
| 380 | 3300005329 | Ga0070683_100126241 | Ga0070683_1001262413 | 144 |
| 381 | 3300005330 | Ga0070690_101423488 | Ga0070690_1014234881 | 144 |
| 382 | 3300005337 | Ga0070682_101047517 | Ga0070682_1010475172 | 144 |
| 383 | 3300005338 | Ga0068868_100000220 | Ga0068868_1000002209 | 144 |
| 384 | 3300005338 | Ga0068868_101828348 | Ga0068868_1018283481 | 144 |
| 385 | 3300005340 | Ga0070689_100071524 | Ga0070689_1000715243 | 144 |
| 386 | 3300005341 | Ga0070691_10000275 | Ga0070691_100002753 | 144 |
| 387 | 3300005341 | Ga0070691_10024493 | Ga0070691_100244933 | 144 |
| 388 | 3300005347 | Ga0070668_100119881 | Ga0070668_1001198813 | 144 |
| 389 | 3300005353 | Ga0070669_101269003 | Ga0070669_1012690031 | 144 |
| 390 | 3300005365 | Ga0070688_100000053 | Ga0070688_10000005336 | 144 |
| 391 | 3300005365 | Ga0070688_100471154 | Ga0070688_1004711542 | 144 |
| 392 | 3300005436 | Ga0070713_101416795 | Ga0070713_1014167951 | 144 |
| 393 | 3300005439 | Ga0070711_100245925 | Ga0070711_1002459252 | 144 |
| 394 | 3300005441 | Ga0070700_100005523 | Ga0070700_1000055236 | 144 |
| 395 | 3300005455 | Ga0070663_101124518 | Ga0070663_1011245181 | 144 |
| 396 | 3300005456 | Ga0070678_100003823 | Ga0070678_1000038238 | 144 |
| 397 | 3300005456 | Ga0070678_101134511 | Ga0070678_1011345112 | 144 |
| 398 | 3300005457 | Ga0070662_101080052 | Ga0070662_1010800522 | 144 |
| 399 | 3300005466 | Ga0070685_10000086 | Ga0070685_1000008624 | 144 |
| 400 | 3300005466 | Ga0070685_10029985 | Ga0070685_100299852 | 144 |
| 401 | 3300005468 | Ga0070707_100221165 | Ga0070707_1002211652 | 144 |
| 402 | 3300005535 | Ga0070684_100000300 | Ga0070684_10000030013 | 144 |
| 403 | 3300005535 | Ga0070684_100044980 | Ga0070684_1000449803 | 144 |
| 404 | 3300005535 | Ga0070684_100185513 | Ga0070684_1001855132 | 144 |
| 405 | 3300005535 | Ga0070684_101199600 | Ga0070684_1011996002 | 144 |
| 406 | 3300005545 | Ga0070695_100766268 | Ga0070695_1007662682 | 144 |
| 407 | 3300005548 | Ga0070665_100017640 | Ga0070665_1000176407 | 144 |
| 408 | 3300005548 | Ga0070665_101242907 | Ga0070665_1012429071 | 144 |
| 409 | 3300005549 | Ga0070704_100365985 | Ga0070704_1003659852 | 144 |
| 410 | 3300005564 | Ga0070664_100014728 | Ga0070664_1000147283 | 144 |
| 411 | 3300005564 | Ga0070664_100651091 | Ga0070664_1006510911 | 144 |
| 412 | 3300005577 | Ga0068857_100005209 | Ga0068857_1000052098 | 144 |
| 413 | 3300005577 | Ga0068857_101078277 | Ga0068857_1010782772 | 144 |
| 414 | 3300005578 | Ga0068854_100900680 | Ga0068854_1009006802 | 144 |
| 415 | 3300005615 | Ga0070702_100198963 | Ga0070702_1001989633 | 144 |
| 416 | 3300005616 | Ga0068852_100008636 | Ga0068852_1000086363 | 144 |
| 417 | 3300005617 | Ga0068859_101283685 | Ga0068859_1012836851 | 144 |
| 418 | 3300005834 | Ga0068851_10020425 | Ga0068851_100204251 | 144 |
| 419 | 3300005840 | Ga0068870_10142061 | Ga0068870_101420612 | 144 |
| 420 | 3300005841 | Ga0068863_100002888 | Ga0068863_1000028883 | 144 |
| 421 | 3300005842 | Ga0068858_100411920 | Ga0068858_1004119202 | 144 |
| 422 | 3300005983 | Ga0081540_1194534 | Ga0081540_11945341 | 144 |
| 423 | 3300005983 | Ga0081540_1218697 | Ga0081540_12186972 | 144 |
| 424 | 3300005985 | Ga0081539_10003833 | Ga0081539_1000383313 | 144 |
| 425 | 3300005985 | Ga0081539_10109602 | Ga0081539_101096022 | 144 |
| 426 | 3300005985 | Ga0081539_10234791 | Ga0081539_102347911 | 144 |
| 427 | 3300006048 | Ga0075363_100624927 | Ga0075363_1006249272 | 144 |
| 428 | 3300006051 | Ga0075364_10037846 | Ga0075364_100378462 | 144 |
| 429 | 3300006051 | Ga0075364_10293843 | Ga0075364_102938432 | 144 |
| 430 | 3300006846 | Ga0075430_100073707 | Ga0075430_1000737072 | 144 |
| 431 | 3300006847 | Ga0075431_100023129 | Ga0075431_1000231292 | 144 |
| 432 | 3300006852 | Ga0075433_10071303 | Ga0075433_100713032 | 144 |
| 433 | 3300006871 | Ga0075434_100001194 | Ga0075434_10000119417 | 144 |
| 434 | 3300006880 | Ga0075429_100004246 | Ga0075429_1000042469 | 144 |
| 435 | 3300006914 | Ga0075436_101417173 | Ga0075436_1014171731 | 144 |
| 436 | 3300006931 | Ga0097620_101283695 | Ga0097620_1012836952 | 144 |
| 437 | 3300007076 | Ga0075435_100032887 | Ga0075435_1000328873 | 144 |
| 438 | 3300009094 | Ga0111539_10036089 | Ga0111539_100360893 | 144 |
| 439 | 3300009094 | Ga0111539_10201867 | Ga0111539_102018674 | 144 |
| 440 | 3300009094 | Ga0111539_12323932 | Ga0111539_123239321 | 144 |
| 441 | 3300009098 | Ga0105245_10019398 | Ga0105245_100193986 | 144 |
| 442 | 3300009098 | Ga0105245_10114136 | Ga0105245_101141363 | 144 |
| 443 | 3300009101 | Ga0105247_10002606 | Ga0105247_1000260610 | 144 |
| 444 | 3300009147 | Ga0114129_10143929 | Ga0114129_101439294 | 144 |
| 445 | 3300009147 | Ga0114129_10340564 | Ga0114129_103405642 | 144 |
| 446 | 3300009147 | Ga0114129_10481931 | Ga0114129_104819312 | 144 |
| 447 | 3300009147 | Ga0114129_11419710 | Ga0114129_114197102 | 144 |
| 448 | 3300009147 | Ga0114129_12085584 | Ga0114129_120855842 | 144 |
| 449 | 3300009147 | Ga0114129_12769483 | Ga0114129_127694831 | 144 |
| 450 | 3300009148 | Ga0105243_10006390 | Ga0105243_100063902 | 144 |
| 451 | 3300009148 | Ga0105243_10094406 | Ga0105243_100944063 | 144 |
| 452 | 3300009148 | Ga0105243_11543260 | Ga0105243_115432602 | 144 |
| 453 | 3300009174 | Ga0105241_10124872 | Ga0105241_101248722 | 144 |
| 454 | 3300009174 | Ga0105241_10216916 | Ga0105241_102169162 | 144 |
| 455 | 3300009177 | Ga0105248_12757215 | Ga0105248_127572151 | 144 |
| 456 | 3300009553 | Ga0105249_10000054 | Ga0105249_1000005490 | 144 |
| 457 | 3300009553 | Ga0105249_11801559 | Ga0105249_118015591 | 144 |
| 458 | 3300010375 | Ga0105239_10332280 | Ga0105239_103322803 | 144 |
| 459 | 3300011119 | Ga0105246_10136309 | Ga0105246_101363092 | 144 |
| 460 | 3300012476 | Ga0157344_1026385 | Ga0157344_10263851 | 144 |
| 461 | 3300013104 | Ga0157370_10228969 | Ga0157370_102289692 | 144 |
| 462 | 3300013296 | Ga0157374_10694387 | Ga0157374_106943872 | 144 |
| 463 | 3300013297 | Ga0157378_10046947 | Ga0157378_100469473 | 144 |
| 464 | 3300013297 | Ga0157378_10052908 | Ga0157378_100529084 | 144 |
| 465 | 3300013308 | Ga0157375_12176095 | Ga0157375_121760952 | 144 |
| 466 | 3300014326 | Ga0157380_10089529 | Ga0157380_100895291 | 144 |
| 467 | 3300014745 | Ga0157377_10425882 | Ga0157377_104258822 | 144 |
| 468 | 3300014969 | Ga0157376_10111428 | Ga0157376_101114282 | 144 |
| 469 | 3300014969 | Ga0157376_10945793 | Ga0157376_109457932 | 144 |
| 470 | 3300020070 | Ga0206356_10206281 | Ga0206356_102062812 | 144 |
| 471 | 3300021358 | Ga0213873_10090042 | Ga0213873_100900422 | 144 |
| 472 | 3300021384 | Ga0213876_10086730 | Ga0213876_100867303 | 144 |
| 473 | 3300025321 | Ga0207656_10008896 | Ga0207656_100088961 | 144 |
| 474 | 3300025900 | Ga0207710_10000096 | Ga0207710_1000009670 | 144 |
| 475 | 3300025908 | Ga0207643_10125106 | Ga0207643_101251061 | 144 |
| 476 | 3300025911 | Ga0207654_10117527 | Ga0207654_101175273 | 144 |
| 477 | 3300025911 | Ga0207654_10165808 | Ga0207654_101658082 | 144 |
| 478 | 3300025912 | Ga0207707_10358422 | Ga0207707_103584222 | 144 |
| 479 | 3300025916 | Ga0207663_10230715 | Ga0207663_102307152 | 144 |
| 480 | 3300025927 | Ga0207687_10010977 | Ga0207687_100109773 | 144 |
| 481 | 3300025927 | Ga0207687_10110090 | Ga0207687_101100902 | 144 |
| 482 | 3300025927 | Ga0207687_11364414 | Ga0207687_113644141 | 144 |
| 483 | 3300025928 | Ga0207700_10487464 | Ga0207700_104874642 | 144 |
| 484 | 3300025934 | Ga0207686_10003508 | Ga0207686_100035086 | 144 |
| 485 | 3300025935 | Ga0207709_10019786 | Ga0207709_100197863 | 144 |
| 486 | 3300025935 | Ga0207709_11041765 | Ga0207709_110417652 | 144 |
| 487 | 3300025936 | Ga0207670_10088689 | Ga0207670_100886892 | 144 |
| 488 | 3300025936 | Ga0207670_10116398 | Ga0207670_101163982 | 144 |
| 489 | 3300025937 | Ga0207669_10742679 | Ga0207669_107426792 | 144 |
| 490 | 3300025939 | Ga0207665_10216950 | Ga0207665_102169502 | 144 |
| 491 | 3300025939 | Ga0207665_10349159 | Ga0207665_103491592 | 144 |
| 492 | 3300025944 | Ga0207661_10005756 | Ga0207661_100057563 | 144 |
| 493 | 3300025944 | Ga0207661_10005996 | Ga0207661_100059966 | 144 |
| 494 | 3300025944 | Ga0207661_10019548 | Ga0207661_100195486 | 144 |
| 495 | 3300025945 | Ga0207679_10013592 | Ga0207679_100135923 | 144 |
| 496 | 3300025945 | Ga0207679_10163335 | Ga0207679_101633353 | 144 |
| 497 | 3300025961 | Ga0207712_10000032 | Ga0207712_1000003275 | 144 |
| 498 | 3300025961 | Ga0207712_10204694 | Ga0207712_102046943 | 144 |
| 499 | 3300025972 | Ga0207668_10068403 | Ga0207668_100684034 | 144 |
| 500 | 3300025972 | Ga0207668_10995697 | Ga0207668_109956971 | 144 |
| 501 | 3300025981 | Ga0207640_10551317 | Ga0207640_105513172 | 144 |
| 502 | 3300025981 | Ga0207640_10607849 | Ga0207640_106078492 | 144 |
| 503 | 3300026075 | Ga0207708_10037813 | Ga0207708_100378132 | 144 |
| 504 | 3300026088 | Ga0207641_10002314 | Ga0207641_100023146 | 144 |
| 505 | 3300026088 | Ga0207641_11864409 | Ga0207641_118644092 | 144 |
| 506 | 3300026116 | Ga0207674_10001853 | Ga0207674_1000185326 | 144 |
| 507 | 3300026116 | Ga0207674_11026379 | Ga0207674_110263792 | 144 |
| 508 | 3300026121 | Ga0207683_10013197 | Ga0207683_100131974 | 144 |
| 509 | 3300026142 | Ga0207698_10008081 | Ga0207698_100080813 | 144 |
| 510 | 3300028379 | Ga0268266_10001186 | Ga0268266_100011867 | 144 |
| 511 | 3300028556 | Ga0265337_1002592 | Ga0265337_10025927 | 144 |
| 512 | 3300028558 | Ga0265326_10000056 | Ga0265326_1000005610 | 144 |
| 513 | 3300028563 | Ga0265319_1000010 | Ga0265319_1000010165 | 144 |
| 514 | 3300028654 | Ga0265322_10000017 | Ga0265322_1000001756 | 144 |
| 515 | 3300028800 | Ga0265338_10000051 | Ga0265338_1000005158 | 144 |
| 516 | 3300028800 | Ga0265338_10559285 | Ga0265338_105592851 | 144 |
| 517 | 3300029957 | Ga0265324_10001639 | Ga0265324_100016395 | 144 |
| 518 | 3300031239 | Ga0265328_10000258 | Ga0265328_1000025816 | 144 |
| 519 | 3300031240 | Ga0265320_10000068 | Ga0265320_1000006868 | 144 |
| 520 | 3300031241 | Ga0265325_10005471 | Ga0265325_100054714 | 144 |
| 521 | 3300031249 | Ga0265339_10023454 | Ga0265339_100234545 | 144 |
| 522 | 3300031250 | Ga0265331_10005995 | Ga0265331_100059955 | 144 |
| 523 | 3300031251 | Ga0265327_10000317 | Ga0265327_1000031768 | 144 |
| 524 | 3300031344 | Ga0265316_10127295 | Ga0265316_101272953 | 144 |
| 525 | 3300031711 | Ga0265314_10000973 | Ga0265314_1000097324 | 144 |
| 526 | 3300031712 | Ga0265342_10201265 | Ga0265342_102012652 | 144 |
| 527 | 3300031995 | Ga0307409_100363314 | Ga0307409_1003633143 | 144 |
| 528 | 3300032126 | Ga0307415_100020148 | Ga0307415_1000201481 | 144 |
| 529 | 3300035111 | Ga0373923_0078824 | Ga0373923_0078824_378_815 | 144 |
| 530 | 3300035111 | Ga0373923_0317786 | Ga0373923_0317786_267_704 | 144 |
| 531 | 3300035725 | Ga0373947_0450262 | Ga0373947_0450262_215_658 | 144 |
| 532 | 3300036401 | Ga0373937_0042838 | Ga0373937_0042838_1910_2344 | 144 |
| 533 | 3300036401 | Ga0373937_0106439 | Ga0373937_0106439_1206_1643 | 144 |
| 534 | 3300039437 | Ga0436365_0511075 | Ga0436365_0511075_559_993 | 144 |
| 535 | 3300039453 | Ga0436362_0671578 | Ga0436362_0671578_149_583 | 144 |
| 536 | 3300041451 | Ga0451791_0052506 | Ga0451791_0052506_266_706 | 144 |
| 537 | 3300041458 | Ga0451798_0544195 | Ga0451798_0544195_193_633 | 144 |
| 538 | 3300041486 | Ga0451807_0497514 | Ga0451807_0497514_731_1171 | 144 |
| 539 | 3300041486 | Ga0451807_1989586 | Ga0451807_1989586_518_958 | 144 |
| 540 | 3300041492 | Ga0451835_0152756 | Ga0451835_0152756_520_960 | 144 |
| 541 | 3300041496 | Ga0451839_1560512 | Ga0451839_1560512_188_628 | 144 |
| 542 | 3300044706 | Ga0466964_0774748 | Ga0466964_0774748_52_510 | 144 |
| 543 | 3300044901 | Ga0466960_0084385 | Ga0466960_0084385_520_978 | 144 |
| 544 | 3300045836 | Ga0466958_0074384 | Ga0466958_0074384_329_769 | 144 |
| 545 | 3300045976 | Ga0466967_0535772 | Ga0466967_0535772_415_858 | 144 |
| 546 | 3300045976 | Ga0466967_0844674 | Ga0466967_0844674_366_809 | 144 |
| 547 | 3300046454 | Ga0495592_0515500 | Ga0495592_0515500_286_726 | 144 |
| 548 | 3300046459 | Ga0495629_0000421 | Ga0495629_0000421_32846_33280 | 144 |
| 549 | 3300046461 | Ga0495641_0002767 | Ga0495641_0002767_11829_12266 | 144 |
| 550 | 3300046461 | Ga0495641_0346543 | Ga0495641_0346543_28_468 | 144 |
| 551 | 3300046500 | Ga0495596_0147691 | Ga0495596_0147691_148_585 | 144 |
| 552 | 3300046507 | Ga0495606_0000908 | Ga0495606_0000908_31433_31867 | 144 |
| 553 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_214585_215025 | 144 |
| 554 | 3300046512 | Ga0495610_0267800 | Ga0495610_0267800_149_589 | 144 |
| 555 | 3300046513 | Ga0495616_0026032 | Ga0495616_0026032_1254_1691 | 144 |
| 556 | 3300046516 | Ga0495628_0365515 | Ga0495628_0365515_591_1028 | 144 |
| 557 | 3300046518 | Ga0495631_0169815 | Ga0495631_0169815_43_480 | 144 |
| 558 | 3300046520 | Ga0495637_0062760 | Ga0495637_0062760_439_879 | 144 |
| 559 | 3300046526 | Ga0495666_0141567 | Ga0495666_0141567_439_882 | 144 |
| 560 | 3300046529 | Ga0495652_0000009 | Ga0495652_0000009_5505_5945 | 144 |
| 561 | 3300046529 | Ga0495652_0859306 | Ga0495652_0859306_65_508 | 144 |
| 562 | 3300046530 | Ga0495654_0192611 | Ga0495654_0192611_214_651 | 144 |
| 563 | 3300046533 | Ga0495640_0330949 | Ga0495640_0330949_171_611 | 144 |
| 564 | 3300046536 | Ga0495587_0011918 | Ga0495587_0011918_2773_3213 | 144 |
| 565 | 3300046536 | Ga0495587_0042253 | Ga0495587_0042253_114_554 | 144 |
| 566 | 3300046536 | Ga0495587_0168992 | Ga0495587_0168992_430_864 | 144 |
| 567 | 3300046559 | Ga0495667_0424127 | Ga0495667_0424127_194_628 | 144 |
| 568 | 3300046615 | Ga0495656_0001553 | Ga0495656_0001553_4637_5074 | 144 |
| 569 | 3300046663 | Ga0495635_0155602 | Ga0495635_0155602_319_753 | 144 |
| 570 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_265784_266224 | 144 |
| 571 | 3300046675 | Ga0495657_0003926 | Ga0495657_0003926_7487_7924 | 144 |
| 572 | 3300047317 | Ga0495604_0000527 | Ga0495604_0000527_30646_31086 | 144 |
| 573 | 3300047317 | Ga0495604_0177084 | Ga0495604_0177084_850_1284 | 144 |
| 574 | 3300047319 | Ga0495674_0000024 | Ga0495674_0000024_22255_22695 | 144 |
| 575 | 3300047321 | Ga0495676_0037312 | Ga0495676_0037312_2727_3170 | 144 |
| 576 | 3300047321 | Ga0495676_0043491 | Ga0495676_0043491_2423_2863 | 144 |
| 577 | 3300047322 | Ga0495680_0011541 | Ga0495680_0011541_4411_4848 | 144 |
| 578 | 3300047322 | Ga0495680_0160606 | Ga0495680_0160606_374_808 | 144 |
| 579 | 3300047322 | Ga0495680_0406497 | Ga0495680_0406497_338_775 | 144 |
| 580 | 3300047444 | Ga0495675_0000094 | Ga0495675_0000094_13457_13897 | 144 |
| 581 | 3300047444 | Ga0495675_0197185 | Ga0495675_0197185_364_798 | 144 |
| 582 | 3300047673 | Ga0495593_0048881 | Ga0495593_0048881_609_1049 | 144 |
| 583 | 3300048088 | Ga0495602_0245984 | Ga0495602_0245984_387_857 | 144 |
| 584 | 3300048088 | Ga0495602_0480554 | Ga0495602_0480554_342_785 | 144 |
| 585 | 3300048903 | Ga0496100_0000019 | Ga0496100_0000019_30666_31106 | 144 |
| 586 | 3300048904 | Ga0496101_0000005 | Ga0496101_0000005_30666_31106 | 144 |
| 587 | 3300048905 | Ga0496102_0000438 | Ga0496102_0000438_41807_42247 | 144 |
| 588 | 3300048905 | Ga0496102_1334753 | Ga0496102_1334753_186_620 | 144 |
| 589 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_637724_638164 | 144 |
| 590 | 3300048907 | Ga0496104_0015865 | Ga0496104_0015865_2467_2907 | 144 |
| 591 | 3300048907 | Ga0496104_0077504 | Ga0496104_0077504_525_965 | 144 |
| 592 | 3300048908 | Ga0496105_0000386 | Ga0496105_0000386_22953_23393 | 144 |
| 593 | 3300048909 | Ga0496106_0000156 | Ga0496106_0000156_30957_31397 | 144 |
| 594 | 3300048910 | Ga0496107_0000004 | Ga0496107_0000004_30883_31323 | 144 |
| 595 | 3300048911 | Ga0496108_0000349 | Ga0496108_0000349_11135_11575 | 144 |
| 596 | 3300048912 | Ga0496109_0000307 | Ga0496109_0000307_11126_11566 | 144 |
| 597 | 3300048912 | Ga0496109_0506353 | Ga0496109_0506353_20_460 | 144 |
| 598 | 3300048912 | Ga0496109_0774298 | Ga0496109_0774298_185_625 | 144 |
| 599 | 3300048914 | Ga0496111_0852053 | Ga0496111_0852053_191_631 | 144 |
| 600 | 3300048915 | Ga0496112_0189395 | Ga0496112_0189395_1073_1507 | 144 |
| 601 | 3300048918 | Ga0496115_0000022 | Ga0496115_0000022_83051_83506 | 144 |
| 602 | 3300049572 | Ga0501036_1251081 | Ga0501036_1251081_19_453 | 144 |
| 603 | 3300049576 | Ga0501040_0679531 | Ga0501040_0679531_156_590 | 144 |
| 604 | 3300049578 | Ga0501042_0659414 | Ga0501042_0659414_21_455 | 144 |
| 605 | 3300049582 | Ga0501048_0692050 | Ga0501048_0692050_35_487 | 144 |
| 606 | 3300049587 | Ga0501071_0348968 | Ga0501071_0348968_255_707 | 144 |
| 607 | 3300049587 | Ga0501071_1163669 | Ga0501071_1163669_45_500 | 144 |
| 608 | 3300049587 | Ga0501071_1390207 | Ga0501071_1390207_24_458 | 144 |
| 609 | 3300049591 | Ga0501075_0521517 | Ga0501075_0521517_401_835 | 144 |
| 610 | 3300049743 | Ga0501081_0072196 | Ga0501081_0072196_500_952 | 144 |
| 611 | 3300049743 | Ga0501081_0257752 | Ga0501081_0257752_159_593 | 144 |
| 612 | 3300049824 | Ga0501045_0344645 | Ga0501045_0344645_346_798 | 144 |
| 613 | 3300050490 | nmdc:mga03n38_774754_c1 | nmdc:mga03n38_774754_c1_75_509 | 144 |
| 614 | 3300050491 | nmdc:mga00v17_867896_c1 | nmdc:mga00v17_867896_c1_119_553 | 144 |
| 615 | 3300050507 | nmdc:mga05p37_135973_c1 | nmdc:mga05p37_135973_c1_121_567 | 144 |
| 616 | 3300050507 | nmdc:mga05p37_1493425_c1 | nmdc:mga05p37_1493425_c1_170_604 | 144 |
| 617 | 3300050507 | nmdc:mga05p37_483224_c1 | nmdc:mga05p37_483224_c1_131_565 | 144 |
| 618 | 3300050508 | nmdc:mga09592_9549_c1 | nmdc:mga09592_9549_c1_7098_7550 | 144 |
| 619 | 3300050509 | nmdc:mga0qj67_515869_c1 | nmdc:mga0qj67_515869_c1_119_562 | 144 |
| 620 | 3300050510 | nmdc:mga06r32_854578_c1 | nmdc:mga06r32_854578_c1_204_638 | 144 |
| 621 | 3300050511 | nmdc:mga08y16_75890_c1 | nmdc:mga08y16_75890_c1_3047_3481 | 144 |
| 622 | 3300050512 | nmdc:mga0n895_375319_c1 | nmdc:mga0n895_375319_c1_835_1278 | 144 |
| 623 | 3300050513 | nmdc:mga0rr50_50969_c1 | nmdc:mga0rr50_50969_c1_1878_2342 | 144 |
| 624 | 3300050515 | nmdc:mga0a205_7528_c1 | nmdc:mga0a205_7528_c1_2210_2674 | 144 |
| 625 | 3300053077 | Ga0495601_0000029 | Ga0495601_0000029_14906_15346 | 144 |
| 626 | 3300053077 | Ga0495601_0041695 | Ga0495601_0041695_1024_1464 | 144 |
| 627 | 3300053078 | Ga0495612_0020013 | Ga0495612_0020013_900_1340 | 144 |
| 628 | 3300053083 | Ga0495655_0000010 | Ga0495655_0000010_26457_26897 | 144 |
| 629 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_214608_215048 | 144 |
| 630 | 3300053085 | Ga0495619_0000233 | Ga0495619_0000233_16005_16445 | 144 |
| 631 | 3300053085 | Ga0495619_0001241 | Ga0495619_0001241_2810_3250 | 144 |
| 632 | 3300053085 | Ga0495619_0010884 | Ga0495619_0010884_37_477 | 144 |
| 633 | 3300053085 | Ga0495619_0071843 | Ga0495619_0071843_1353_1787 | 144 |
| 634 | 3300053129 | Ga0500628_000039 | Ga0500628_000039_17958_18398 | 144 |
| 635 | 3300054114 | Ga0501084_0200694 | Ga0501084_0200694_951_1403 | 144 |
| 636 | 3300054114 | Ga0501084_0653170 | Ga0501084_0653170_325_759 | 144 |
| 637 | 3300060353 | Ga0501082_0561117 | Ga0501082_0561117_79_519 | 144 |
| 638 | 3300061734 | Ga0530510_0082390 | Ga0530510_0082390_237_689 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6uae-assembly4.cif.gz_D | ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 | 0.903 | 12 | 129 |
| 6uad-assembly1.cif.gz_A | ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 | 0.8963 | 7 | 135 |
| 3nm2-assembly1.cif.gz_A-2 | crystal structure of ketosteroid isomerase d38ep39gv40gs42g from pseudomonas testosteroni (tksi) | 0.8938 | 1 | 135 |
| 3m8c-assembly1.cif.gz_A | crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi) with equilenin bound | 0.8872 | 7 | 135 |
| 3mki-assembly2.cif.gz_C | crystal structure of ketosteroid isomerase d38ed99n from pseudomonas testosteroni (tksi) | 0.8832 | 12 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O33273_3_104_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8773 | 12 | 128 | 3.10.450.50 |
| 2geyC00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.876 | 7 | 144 | 3.10.450.50 |
| 2geyD00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8693 | 7 | 144 | 3.10.450.50 |
| 4kvhA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8655 | 7 | 131 | 3.10.450.50 |
| 3ov4D00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8585 | 7 | 129 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538F1B6-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9998 | 2 | 144 |
GO:0030638
|
| AF-A0A7V9CB16-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9978 | 27 | 144 |
|
| AF-A0A538F1B6-F1-model_v4 | Nuclear transport factor 2 family protein | 0.986 | 2 | 144 |
GO:0030638
|
| AF-A0A538HX34-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9834 | 2 | 134 |
|
| AF-A0A7V9CB16-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9812 | 27 | 144 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar