F471536

General Info

Members Datasets Scaffolds Average Seq Length
638 302 638 144

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0068770|Ga0466965_0068770_332_841
Length 169
Sequence VKNRPPHEGGRPTGGADHANGANADRVDAIMSAEELHDAIAAYNEAWNAHDLERIRSLHAPDMVFENHTAGERAEGDEALAHIASIFDSWPDIAFTTRRLYVRDDLVVQEWTATATHVKPLSRGEIVAEPSGRRIEWEGMDIIPFEGGKVKRKDVYSDSVAILRQVGLL

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
195 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
198 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
201 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 8.15
Rhizosphere 86.52
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001026 3300001977 Bacteria 4381
2 JGI24740J21852_10002767 3300001979 Bacteria 7845
3 JGI24751J29686_10070651 3300002459 Bacteria 720
4 JGI25406J46586_10027831 3300003203 Bacteria 2161
5 Ga0070683_100008978 3300005329 Bacteria 8520
6 Ga0070683_100010609 3300005329 Bacteria 7919
7 Ga0070683_100015665 3300005329 Bacteria 6665
8 Ga0070683_100084594 3300005329 Bacteria 2972
9 Ga0070683_100110699 3300005329 Bacteria 2591
10 Ga0070683_100126241 3300005329 Bacteria 2419
11 Ga0070690_100224293 3300005330 Bacteria 1318
12 Ga0070690_101423488 3300005330 Bacteria 558
13 Ga0070680_101335934 3300005336 Bacteria 620
14 Ga0070682_101047517 3300005337 Bacteria 680
15 Ga0068868_100000220 3300005338 Bacteria 38739
16 Ga0068868_100192095 3300005338 Bacteria 1698
17 Ga0068868_101302721 3300005338 Bacteria 675
18 Ga0068868_101828348 3300005338 Bacteria 574
19 Ga0070689_100071524 3300005340 Bacteria 2710
20 Ga0070689_100954865 3300005340 Bacteria 761
21 Ga0070691_10000275 3300005341 Bacteria 17919
22 Ga0070691_10024493 3300005341 Unclassified 2805
23 Ga0070661_100047912 3300005344 Bacteria 3128
24 Ga0070668_100119881 3300005347 Bacteria 2102
25 Ga0070669_100344091 3300005353 Bacteria 1209
26 Ga0070669_101269003 3300005353 Bacteria 637
27 Ga0070675_102041212 3300005354 Bacteria 529
28 Ga0070673_100293591 3300005364 Bacteria 1429
29 Ga0070688_100000053 3300005365 Bacteria 55064
30 Ga0070688_100471154 3300005365 Bacteria 942
31 Ga0070659_100005945 3300005366 Bacteria 8800
32 Ga0070659_100150761 3300005366 Bacteria 1897
33 Ga0070659_101017130 3300005366 Bacteria 728
34 Ga0070667_100002266 3300005367 Bacteria 16947
35 Ga0070709_10513680 3300005434 Bacteria 912
36 Ga0070714_100036362 3300005435 Bacteria 4130
37 Ga0070713_100759399 3300005436 Bacteria 928
38 Ga0070713_101416795 3300005436 Unclassified 674
39 Ga0070711_100018198 3300005439 Bacteria 4481
40 Ga0070711_100245925 3300005439 Bacteria 1401
41 Ga0070705_100296921 3300005440 Bacteria 1156
42 Ga0070700_100005523 3300005441 Bacteria 6708
43 Ga0070700_100054790 3300005441 Bacteria 2493
44 Ga0070700_101268362 3300005441 Bacteria 618
45 Ga0070708_100891983 3300005445 Unclassified 835
46 Ga0070663_101124518 3300005455 Unclassified 687
47 Ga0070678_100003823 3300005456 Bacteria 8447
48 Ga0070678_100333495 3300005456 Bacteria 1299
49 Ga0070678_101134511 3300005456 Bacteria 723
50 Ga0070662_101080052 3300005457 Bacteria 688
51 Ga0070681_10614403 3300005458 Bacteria 1001
52 Ga0068867_100200329 3300005459 Bacteria 1598
53 Ga0068867_100224070 3300005459 Bacteria 1517
54 Ga0068867_100544601 3300005459 Bacteria 1004
55 Ga0068867_100702266 3300005459 Bacteria 893
56 Ga0070685_10000086 3300005466 Bacteria 57017
57 Ga0070685_10029985 3300005466 Bacteria 3026
58 Ga0070707_100221165 3300005468 Unclassified 1844
59 Ga0070707_100265160 3300005468 Bacteria 1670
60 Ga0070684_100000300 3300005535 Bacteria 34313
61 Ga0070684_100044980 3300005535 Bacteria 3821
62 Ga0070684_100185513 3300005535 Bacteria 1892
63 Ga0070684_100188225 3300005535 Bacteria 1877
64 Ga0070684_100605818 3300005535 Bacteria 1018
65 Ga0070684_101199600 3300005535 Bacteria 714
66 Ga0068853_101147488 3300005539 Bacteria 750
67 Ga0070686_100122372 3300005544 Bacteria 1788
68 Ga0070695_100766268 3300005545 Bacteria 771
69 Ga0070665_100017640 3300005548 Bacteria 7168
70 Ga0070665_100216008 3300005548 Unclassified 1918
71 Ga0070665_100606321 3300005548 Unclassified 1108
72 Ga0070665_100897632 3300005548 Unclassified 899
73 Ga0070665_101242907 3300005548 Bacteria 755
74 Ga0070704_100128171 3300005549 Unclassified 1962
75 Ga0070704_100365985 3300005549 Bacteria 1221
76 Ga0070664_100014728 3300005564 Bacteria 6386
77 Ga0070664_100060258 3300005564 Bacteria 3231
78 Ga0070664_100505543 3300005564 Bacteria 1114
79 Ga0070664_100651091 3300005564 Bacteria 979
80 Ga0070664_100831947 3300005564 Bacteria 864
81 Ga0068857_100005209 3300005577 Bacteria 11066
82 Ga0068857_100149525 3300005577 Bacteria 2115
83 Ga0068857_101078277 3300005577 Unclassified 775
84 Ga0068854_100000345 3300005578 Bacteria 29913
85 Ga0068854_100900680 3300005578 Bacteria 777
86 Ga0068856_100003669 3300005614 Bacteria 15395
87 Ga0068856_101364076 3300005614 Bacteria 724
88 Ga0070702_100198963 3300005615 Unclassified 1325
89 Ga0068852_100007831 3300005616 Bacteria 7820
90 Ga0068852_100008636 3300005616 Bacteria 7526
91 Ga0068859_100410570 3300005617 Bacteria 1450
92 Ga0068859_101283685 3300005617 Bacteria 807
93 Ga0068859_101822915 3300005617 Unclassified 672
94 Ga0068866_10237818 3300005718 Bacteria 1108
95 Ga0068861_100192551 3300005719 Unclassified 1706
96 Ga0068851_10005227 3300005834 Bacteria 5890
97 Ga0068851_10020425 3300005834 Bacteria 3208
98 Ga0068851_10132082 3300005834 Bacteria 1351
99 Ga0068851_10565365 3300005834 Bacteria 689
100 Ga0068870_10142061 3300005840 Unclassified 1406
101 Ga0068870_10183472 3300005840 Bacteria 1258
102 Ga0068863_100002888 3300005841 Bacteria 17015
103 Ga0068858_100092118 3300005842 Bacteria 2821
104 Ga0068858_100093347 3300005842 Bacteria 2802
105 Ga0068858_100411920 3300005842 Unclassified 1299
106 Ga0081455_10001231 3300005937 Bacteria 31996
107 Ga0081455_10099757 3300005937 Bacteria 2335
108 Ga0081455_10167912 3300005937 Unclassified 1675
109 Ga0081455_10186108 3300005937 Unclassified 1568
110 Ga0081540_1194534 3300005983 Unclassified 744
111 Ga0081540_1218697 3300005983 Unclassified 679
112 Ga0081539_10003833 3300005985 Bacteria 17661
113 Ga0081539_10109602 3300005985 Bacteria 1392
114 Ga0081539_10234791 3300005985 Unclassified 825
115 Ga0070717_11749715 3300006028 Bacteria 562
116 Ga0075365_10004155 3300006038 Bacteria 7619
117 Ga0075365_10080967 3300006038 Bacteria 2199
118 Ga0075365_10285626 3300006038 Bacteria 1161
119 Ga0075363_100004167 3300006048 Bacteria 6281
120 Ga0075363_100147607 3300006048 Bacteria 1326
121 Ga0075363_100624927 3300006048 Bacteria 647
122 Ga0075364_10032023 3300006051 Bacteria 3378
123 Ga0075364_10037846 3300006051 Bacteria 3126
124 Ga0075364_10226577 3300006051 Unclassified 1269
125 Ga0075364_10293843 3300006051 Bacteria 1106
126 Ga0075432_10031829 3300006058 Bacteria 1826
127 Ga0075432_10057527 3300006058 Bacteria 1380
128 Ga0075432_10133145 3300006058 Bacteria 943
129 Ga0070716_100106063 3300006173 Bacteria 1732
130 Ga0070716_100179404 3300006173 Bacteria 1389
131 Ga0070712_100013203 3300006175 Bacteria 5271
132 Ga0070712_100155843 3300006175 Bacteria 1759
133 Ga0075367_10019603 3300006178 Bacteria 3752
134 Ga0075367_10256231 3300006178 Bacteria 1098
135 Ga0075367_10298522 3300006178 Unclassified 1014
136 Ga0075367_10541370 3300006178 Bacteria 739
137 Ga0075428_100028774 3300006844 Bacteria 6149
138 Ga0075428_100104941 3300006844 Bacteria 3082
139 Ga0075430_100009898 3300006846 Bacteria 8063
140 Ga0075430_100073707 3300006846 Bacteria 2862
141 Ga0075431_100023129 3300006847 Bacteria 6354
142 Ga0075431_100024109 3300006847 Bacteria 6230
143 Ga0075431_100125200 3300006847 Bacteria 2652
144 Ga0075433_10071303 3300006852 Bacteria 3054
145 Ga0075433_10410805 3300006852 Bacteria 1194
146 Ga0075434_100001194 3300006871 Bacteria 21560
147 Ga0075429_100004246 3300006880 Bacteria 12283
148 Ga0068865_100129502 3300006881 Bacteria 1889
149 Ga0068865_100165762 3300006881 Bacteria 1690
150 Ga0068865_100680500 3300006881 Bacteria 877
151 Ga0075436_100976752 3300006914 Bacteria 635
152 Ga0075436_101417173 3300006914 Unclassified 527
153 Ga0097620_100410554 3300006931 Bacteria 1450
154 Ga0097620_101283695 3300006931 Bacteria 807
155 Ga0097620_101822758 3300006931 Unclassified 672
156 Ga0075435_100032887 3300007076 Bacteria 4098
157 Ga0075435_100346269 3300007076 Bacteria 1274
158 Ga0111539_10013057 3300009094 Bacteria 10393
159 Ga0111539_10036089 3300009094 Bacteria 5980
160 Ga0111539_10122100 3300009094 Bacteria 3053
161 Ga0111539_10201867 3300009094 Unclassified 2318
162 Ga0111539_10884775 3300009094 Bacteria 1039
163 Ga0111539_12323932 3300009094 Unclassified 622
164 Ga0105245_10007888 3300009098 Bacteria 9311
165 Ga0105245_10009000 3300009098 Bacteria 8708
166 Ga0105245_10019398 3300009098 Bacteria 5956
167 Ga0105245_10114136 3300009098 Bacteria 2516
168 Ga0105245_10313345 3300009098 Bacteria 1544
169 Ga0105245_10943920 3300009098 Bacteria 905
170 Ga0105245_11215220 3300009098 Bacteria 802
171 Ga0105247_10002606 3300009101 Bacteria 12180
172 Ga0105247_10134444 3300009101 Bacteria 1614
173 Ga0105247_11154295 3300009101 Unclassified 614
174 Ga0114129_10143929 3300009147 Bacteria 3266
175 Ga0114129_10176418 3300009147 Bacteria 2911
176 Ga0114129_10340564 3300009147 Bacteria 1989
177 Ga0114129_10481931 3300009147 Bacteria 1623
178 Ga0114129_10672083 3300009147 Bacteria 1334
179 Ga0114129_11335224 3300009147 Unclassified 887
180 Ga0114129_11419710 3300009147 Bacteria 856
181 Ga0114129_12085584 3300009147 Bacteria 684
182 Ga0114129_12487513 3300009147 Unclassified 619
183 Ga0114129_12769483 3300009147 Bacteria 583
184 Ga0105243_10006390 3300009148 Bacteria 9104
185 Ga0105243_10094406 3300009148 Bacteria 2470
186 Ga0105243_10103282 3300009148 Bacteria 2370
187 Ga0105243_10176167 3300009148 Bacteria 1856
188 Ga0105243_10209962 3300009148 Bacteria 1714
189 Ga0105243_11543260 3300009148 Bacteria 689
190 Ga0105241_10124872 3300009174 Bacteria 2077
191 Ga0105241_10216916 3300009174 Unclassified 1606
192 Ga0105242_10072255 3300009176 Bacteria 2865
193 Ga0105242_13188490 3300009176 Bacteria 509
194 Ga0105248_12757215 3300009177 Bacteria 560
195 Ga0105237_10041255 3300009545 Bacteria 4655
196 Ga0105237_12778055 3300009545 Bacteria 501
197 Ga0105238_10012331 3300009551 Bacteria 8620
198 Ga0105249_10000054 3300009553 Bacteria 162883
199 Ga0105249_10446735 3300009553 Bacteria 1331
200 Ga0105249_10610508 3300009553 Unclassified 1146
201 Ga0105249_11021787 3300009553 Unclassified 896
202 Ga0105249_11801559 3300009553 Unclassified 685
203 Ga0105239_10217724 3300010375 Bacteria 2141
204 Ga0105239_10332280 3300010375 Bacteria 1714
205 Ga0105239_10468075 3300010375 Bacteria 1431
206 Ga0105239_10536565 3300010375 Bacteria 1332
207 Ga0105239_11321591 3300010375 Unclassified 832
208 Ga0105246_10036422 3300011119 Bacteria 3296
209 Ga0105246_10136309 3300011119 Unclassified 1840
210 Ga0157344_1026385 3300012476 Bacteria 533
211 Ga0157370_10050656 3300013104 Bacteria 3968
212 Ga0157370_10228969 3300013104 Bacteria 1721
213 Ga0157374_10694387 3300013296 Unclassified 1030
214 Ga0157374_10921840 3300013296 Bacteria 892
215 Ga0157378_10046947 3300013297 Bacteria 3839
216 Ga0157378_10052908 3300013297 Bacteria 3613
217 Ga0157378_11157248 3300013297 Bacteria 812
218 Ga0157378_11996859 3300013297 Bacteria 630
219 Ga0163162_12079337 3300013306 Unclassified 651
220 Ga0157372_10000284 3300013307 Bacteria 56386
221 Ga0157372_10103617 3300013307 Bacteria 3251
222 Ga0157372_11702049 3300013307 Unclassified 726
223 Ga0157375_10492995 3300013308 Bacteria 1390
224 Ga0157375_12176095 3300013308 Unclassified 660
225 Ga0163163_10959432 3300014325 Unclassified 918
226 Ga0157380_10021138 3300014326 Bacteria 4878
227 Ga0157380_10089529 3300014326 Bacteria 2536
228 Ga0157380_10102618 3300014326 Bacteria 2385
229 Ga0157380_10141838 3300014326 Bacteria 2065
230 Ga0157380_11520086 3300014326 Bacteria 723
231 Ga0157380_11692519 3300014326 Bacteria 690
232 Ga0157377_10139331 3300014745 Bacteria 1489
233 Ga0157377_10172065 3300014745 Bacteria 1355
234 Ga0157377_10425882 3300014745 Bacteria 910
235 Ga0157379_10024043 3300014968 Bacteria 5407
236 Ga0157376_10111428 3300014969 Bacteria 2409
237 Ga0157376_10427576 3300014969 Bacteria 1286
238 Ga0157376_10945793 3300014969 Bacteria 882
239 Ga0206356_10206281 3300020070 Unclassified 1890
240 Ga0206353_10530369 3300020082 Bacteria 4320
241 Ga0213873_10090042 3300021358 Unclassified 870
242 Ga0213876_10086730 3300021384 Bacteria 1657
243 Ga0207656_10002224 3300025321 Bacteria 6496
244 Ga0207656_10008896 3300025321 Bacteria 3718
245 Ga0207642_10294098 3300025899 Unclassified 939
246 Ga0207710_10000096 3300025900 Bacteria 116063
247 Ga0207688_10024164 3300025901 Bacteria 3331
248 Ga0207688_10577124 3300025901 Bacteria 708
249 Ga0207688_10722927 3300025901 Bacteria 630
250 Ga0207680_10088670 3300025903 Unclassified 1962
251 Ga0207647_10785994 3300025904 Bacteria 513
252 Ga0207699_10539800 3300025906 Bacteria 845
253 Ga0207645_10638417 3300025907 Bacteria 723
254 Ga0207643_10035518 3300025908 Bacteria 2795
255 Ga0207643_10125106 3300025908 Unclassified 1526
256 Ga0207654_10117527 3300025911 Bacteria 1664
257 Ga0207654_10165808 3300025911 Unclassified 1430
258 Ga0207707_10282253 3300025912 Bacteria 1438
259 Ga0207707_10358422 3300025912 Unclassified 1256
260 Ga0207671_10088848 3300025914 Bacteria 2325
261 Ga0207693_10017214 3300025915 Bacteria 5764
262 Ga0207693_10044456 3300025915 Bacteria 3491
263 Ga0207663_10230715 3300025916 Bacteria 1352
264 Ga0207660_11116881 3300025917 Bacteria 642
265 Ga0207662_11118252 3300025918 Bacteria 560
266 Ga0207657_10015071 3300025919 Bacteria 7508
267 Ga0207657_10399549 3300025919 Bacteria 1081
268 Ga0207649_10097361 3300025920 Bacteria 1940
269 Ga0207649_10503233 3300025920 Bacteria 922
270 Ga0207649_10962752 3300025920 Bacteria 671
271 Ga0207652_10191658 3300025921 Bacteria 1839
272 Ga0207681_10435077 3300025923 Bacteria 1065
273 Ga0207694_10096787 3300025924 Bacteria 2335
274 Ga0207650_11501151 3300025925 Bacteria 573
275 Ga0207687_10010977 3300025927 Bacteria 5919
276 Ga0207687_10110090 3300025927 Bacteria 2042
277 Ga0207687_10506881 3300025927 Bacteria 1008
278 Ga0207687_11102528 3300025927 Bacteria 682
279 Ga0207687_11364414 3300025927 Bacteria 609
280 Ga0207700_10487464 3300025928 Bacteria 1090
281 Ga0207664_10980379 3300025929 Unclassified 758
282 Ga0207644_11344200 3300025931 Unclassified 600
283 Ga0207690_10299330 3300025932 Bacteria 1258
284 Ga0207690_10301112 3300025932 Bacteria 1255
285 Ga0207686_10003508 3300025934 Bacteria 8424
286 Ga0207709_10019786 3300025935 Bacteria 3789
287 Ga0207709_10143163 3300025935 Bacteria 1646
288 Ga0207709_10329893 3300025935 Bacteria 1145
289 Ga0207709_10515805 3300025935 Bacteria 935
290 Ga0207709_11041765 3300025935 Unclassified 670
291 Ga0207670_10088689 3300025936 Bacteria 2182
292 Ga0207670_10102412 3300025936 Bacteria 2047
293 Ga0207670_10116398 3300025936 Unclassified 1935
294 Ga0207669_10532357 3300025937 Bacteria 945
295 Ga0207669_10742679 3300025937 Bacteria 810
296 Ga0207704_10028152 3300025938 Bacteria 3113
297 Ga0207704_10297883 3300025938 Bacteria 1234
298 Ga0207665_10093657 3300025939 Bacteria 2086
299 Ga0207665_10095892 3300025939 Bacteria 2062
300 Ga0207665_10216950 3300025939 Bacteria 1400
301 Ga0207665_10349159 3300025939 Bacteria 1116
302 Ga0207665_10411516 3300025939 Bacteria 1031
303 Ga0207691_10942009 3300025940 Bacteria 722
304 Ga0207711_10517354 3300025941 Bacteria 1113
305 Ga0207661_10005756 3300025944 Bacteria 8739
306 Ga0207661_10005996 3300025944 Bacteria 8582
307 Ga0207661_10019548 3300025944 Bacteria 5053
308 Ga0207661_10093974 3300025944 Unclassified 2504
309 Ga0207661_10808523 3300025944 Bacteria 863
310 Ga0207679_10013592 3300025945 Bacteria 5336
311 Ga0207679_10042876 3300025945 Bacteria 3254
312 Ga0207679_10163335 3300025945 Unclassified 1826
313 Ga0207679_10881164 3300025945 Bacteria 818
314 Ga0207679_11374281 3300025945 Unclassified 648
315 Ga0207651_10242430 3300025960 Bacteria 1470
316 Ga0207712_10000032 3300025961 Bacteria 210628
317 Ga0207712_10007217 3300025961 Bacteria 7008
318 Ga0207712_10204694 3300025961 Bacteria 1567
319 Ga0207712_10528434 3300025961 Bacteria 1012
320 Ga0207712_11611902 3300025961 Unclassified 582
321 Ga0207668_10068403 3300025972 Bacteria 2525
322 Ga0207668_10080861 3300025972 Unclassified 2355
323 Ga0207668_10995697 3300025972 Bacteria 749
324 Ga0207640_10000077 3300025981 Bacteria 76155
325 Ga0207640_10551317 3300025981 Bacteria 969
326 Ga0207640_10607849 3300025981 Bacteria 926
327 Ga0207658_10002876 3300025986 Bacteria 12335
328 Ga0207677_10177042 3300026023 Bacteria 1674
329 Ga0207703_10067575 3300026035 Unclassified 2942
330 Ga0207703_10083718 3300026035 Bacteria 2666
331 Ga0207639_11151912 3300026041 Bacteria 728
332 Ga0207678_10080828 3300026067 Bacteria 2782
333 Ga0207708_10008033 3300026075 Bacteria 7823
334 Ga0207708_10037813 3300026075 Bacteria 3676
335 Ga0207702_10000419 3300026078 Bacteria 48574
336 Ga0207702_10621854 3300026078 Bacteria 1061
337 Ga0207641_10002314 3300026088 Bacteria 17689
338 Ga0207641_11864409 3300026088 Bacteria 603
339 Ga0207648_10153748 3300026089 Bacteria 2030
340 Ga0207648_10274512 3300026089 Bacteria 1507
341 Ga0207648_10375681 3300026089 Bacteria 1284
342 Ga0207674_10001853 3300026116 Bacteria 26957
343 Ga0207674_10226625 3300026116 Bacteria 1817
344 Ga0207674_10370061 3300026116 Unclassified 1385
345 Ga0207674_11026379 3300026116 Unclassified 794
346 Ga0207675_100244343 3300026118 Unclassified 1735
347 Ga0207675_102192839 3300026118 Unclassified 568
348 Ga0207683_10013197 3300026121 Bacteria 7048
349 Ga0207683_10340413 3300026121 Bacteria 1376
350 Ga0207698_10008081 3300026142 Bacteria 6635
351 Ga0207698_10262179 3300026142 Bacteria 1588
352 Ga0207428_10084372 3300027907 Bacteria 2476
353 Ga0268266_10001186 3300028379 Bacteria 32148
354 Ga0268266_10210857 3300028379 Unclassified 1781
355 Ga0268266_10550397 3300028379 Bacteria 1106
356 Ga0268266_11398313 3300028379 Unclassified 675
357 Ga0268264_10120385 3300028381 Bacteria 2313
358 Ga0265337_1002592 3300028556 Bacteria 8185
359 Ga0265326_10000056 3300028558 Bacteria 64840
360 Ga0265319_1000010 3300028563 Bacteria 188773
361 Ga0265319_1070324 3300028563 Bacteria 1123
362 Ga0265322_10000017 3300028654 Bacteria 114833
363 Ga0265338_10000051 3300028800 Bacteria 211202
364 Ga0265338_10559285 3300028800 Unclassified 800
365 Ga0265324_10001639 3300029957 Bacteria 12385
366 Ga0265328_10000258 3300031239 Bacteria 24453
367 Ga0265320_10000068 3300031240 Bacteria 91884
368 Ga0265325_10005471 3300031241 Bacteria 7835
369 Ga0265339_10023454 3300031249 Bacteria 3566
370 Ga0265331_10005995 3300031250 Bacteria 7252
371 Ga0265327_10000317 3300031251 Bacteria 92215
372 Ga0265327_10378005 3300031251 Bacteria 617
373 Ga0265316_10127295 3300031344 Unclassified 1920
374 Ga0265314_10000973 3300031711 Bacteria 33669
375 Ga0265342_10201265 3300031712 Bacteria 1082
376 Ga0307405_10409326 3300031731 Bacteria 1064
377 Ga0307412_10686438 3300031911 Bacteria 877
378 Ga0307409_100093628 3300031995 Bacteria 2470
379 Ga0307409_100363314 3300031995 Bacteria 1370
380 Ga0307409_100898684 3300031995 Bacteria 899
381 Ga0307409_100964232 3300031995 Bacteria 869
382 Ga0307416_100097604 3300032002 Bacteria 2545
383 Ga0307416_100157621 3300032002 Unclassified 2093
384 Ga0307416_100405191 3300032002 Bacteria 1403
385 Ga0307416_100838987 3300032002 Unclassified 1017
386 Ga0307414_10475724 3300032004 Bacteria 1101
387 Ga0307414_10923631 3300032004 Bacteria 801
388 Ga0307411_10637127 3300032005 Bacteria 921
389 Ga0307415_100004333 3300032126 Bacteria 7349
390 Ga0307415_100020148 3300032126 Bacteria 4066
391 Ga0307415_100286679 3300032126 Bacteria 1357
392 Ga0307415_100646199 3300032126 Unclassified 948
393 Ga0373923_0078824 3300035111 Archaea 1426
394 Ga0373923_0317786 3300035111 Bacteria 739
395 Ga0373956_0601583 3300035119 Bacteria 525
396 Ga0373947_0450262 3300035725 Unclassified 872
397 Ga0373937_0042838 3300036401 Unclassified 4131
398 Ga0373937_0106439 3300036401 Bacteria 2607
399 Ga0373937_0479421 3300036401 Unclassified 1182
400 Ga0395899_0014597 3300037312 Bacteria 5995
401 Ga0395900_0166985 3300037418 Unclassified 2242
402 Ga0395900_1341804 3300037418 Bacteria 629
403 Ga0395898_0001996 3300037466 Bacteria 25620
404 Ga0395898_0442055 3300037466 Bacteria 1239
405 Ga0395898_1089972 3300037466 Bacteria 732
406 Ga0395905_0012030 3300037471 Bacteria 8343
407 Ga0395905_1638331 3300037471 Unclassified 548
408 Ga0436364_1340043 3300037853 Bacteria 976
409 Ga0395901_0034351 3300038443 Bacteria 5236
410 Ga0395901_0171605 3300038443 Bacteria 2276
411 Ga0395901_0818887 3300038443 Bacteria 919
412 Ga0436365_0511075 3300039437 Bacteria 1527
413 Ga0436365_1904503 3300039437 Bacteria 1523
414 Ga0436362_0671578 3300039453 Unclassified 983
415 Ga0436362_1260871 3300039453 Bacteria 1884
416 Ga0451791_0052506 3300041451 Bacteria 1246
417 Ga0451798_0544195 3300041458 Bacteria 1052
418 Ga0451807_0497514 3300041486 Bacteria 2174
419 Ga0451807_1989586 3300041486 Bacteria 2026
420 Ga0451835_0152756 3300041492 Unclassified 1301
421 Ga0451839_1560512 3300041496 Archaea 1059
422 Ga0451853_3583735 3300041512 Bacteria 585
423 Ga0450900_026288 3300042136 Bacteria 832
424 Ga0439459_0081443 3300042438 Bacteria 765
425 Ga0439464_0095572 3300042439 Bacteria 899
426 Ga0439460_0110157 3300042461 Unclassified 893
427 Ga0466965_0068770 3300044683 Bacteria 1778
428 Ga0466965_0405103 3300044683 Unclassified 754
429 Ga0466966_0068613 3300044684 Bacteria 2226
430 Ga0466961_0363200 3300044693 Bacteria 880
431 Ga0466963_0040454 3300044694 Bacteria 3055
432 Ga0466963_0324430 3300044694 Bacteria 1084
433 Ga0466964_0172360 3300044706 Bacteria 1020
434 Ga0466964_0334035 3300044706 Bacteria 774
435 Ga0466964_0499550 3300044706 Bacteria 653
436 Ga0466964_0774748 3300044706 Bacteria 540
437 Ga0466971_0016134 3300044719 Bacteria 3291
438 Ga0466968_0288721 3300044735 Bacteria 787
439 Ga0466968_0392458 3300044735 Bacteria 679
440 Ga0466970_0039150 3300044765 Bacteria 2516
441 Ga0466957_0004676 3300044842 Bacteria 7654
442 Ga0466960_0084385 3300044901 Bacteria 1607
443 Ga0466960_0126954 3300044901 Bacteria 1342
444 Ga0466959_0034249 3300045049 Bacteria 3757
445 Ga0466959_0381528 3300045049 Bacteria 959
446 Ga0466958_0002339 3300045836 Bacteria 9475
447 Ga0466958_0029585 3300045836 Bacteria 3250
448 Ga0466958_0074384 3300045836 Unclassified 2082
449 Ga0466958_0460257 3300045836 Unclassified 824
450 Ga0466967_0053245 3300045976 Bacteria 3556
451 Ga0466967_0056267 3300045976 Bacteria 3467
452 Ga0466967_0304885 3300045976 Bacteria 1533
453 Ga0466967_0535772 3300045976 Bacteria 1151
454 Ga0466967_0844674 3300045976 Bacteria 910
455 Ga0466967_2262623 3300045976 Bacteria 539
456 Ga0495592_0515500 3300046454 Bacteria 740
457 Ga0495629_0000421 3300046459 Bacteria 35460
458 Ga0495641_0002767 3300046461 Bacteria 13588
459 Ga0495641_0126663 3300046461 Bacteria 1140
460 Ga0495641_0346543 3300046461 Bacteria 671
461 Ga0495596_0147691 3300046500 Unclassified 913
462 Ga0495606_0000908 3300046507 Bacteria 43982
463 Ga0495608_0000013 3300046511 Bacteria 228481
464 Ga0495610_0267800 3300046512 Unclassified 670
465 Ga0495616_0026032 3300046513 Bacteria 3118
466 Ga0495618_0007882 3300046514 Bacteria 6445
467 Ga0495618_0631267 3300046514 Unclassified 635
468 Ga0495628_0126513 3300046516 Bacteria 1958
469 Ga0495628_0365515 3300046516 Bacteria 1059
470 Ga0495631_0169815 3300046518 Unclassified 935
471 Ga0495637_0062760 3300046520 Bacteria 1520
472 Ga0495666_0141567 3300046526 Bacteria 1121
473 Ga0495652_0000009 3300046529 Bacteria 311000
474 Ga0495652_0859306 3300046529 Bacteria 601
475 Ga0495654_0192611 3300046530 Unclassified 877
476 Ga0495640_0330949 3300046533 Unclassified 942
477 Ga0495587_0011918 3300046536 Bacteria 5495
478 Ga0495587_0042253 3300046536 Bacteria 2719
479 Ga0495587_0168992 3300046536 Unclassified 1243
480 Ga0495645_0000088 3300046543 Bacteria 63785
481 Ga0495667_0424127 3300046559 Unclassified 837
482 Ga0495656_0001553 3300046615 Bacteria 7504
483 Ga0495635_0155602 3300046663 Unclassified 1556
484 Ga0495588_0000247 3300046674 Bacteria 45295
485 Ga0495588_0279375 3300046674 Bacteria 880
486 Ga0495657_0000003 3300046675 Bacteria 279680
487 Ga0495657_0003926 3300046675 Bacteria 11935
488 Ga0495623_0230829 3300046679 Unclassified 1050
489 Ga0495646_0508939 3300046680 Bacteria 618
490 Ga0495581_0328233 3300047315 Unclassified 894
491 Ga0495604_0000527 3300047317 Bacteria 33774
492 Ga0495604_0177084 3300047317 Unclassified 1494
493 Ga0495604_0281392 3300047317 Unclassified 1123
494 Ga0495674_0000024 3300047319 Bacteria 141746
495 Ga0495676_0037312 3300047321 Bacteria 4046
496 Ga0495676_0043491 3300047321 Bacteria 3674
497 Ga0495676_0172123 3300047321 Bacteria 1523
498 Ga0495676_0528794 3300047321 Bacteria 772
499 Ga0495680_0011541 3300047322 Bacteria 7816
500 Ga0495680_0160606 3300047322 Bacteria 1632
501 Ga0495680_0406497 3300047322 Unclassified 939
502 Ga0495675_0000094 3300047444 Bacteria 63338
503 Ga0495675_0197185 3300047444 Unclassified 1227
504 Ga0495593_0048881 3300047673 Unclassified 2247
505 Ga0495602_0001025 3300048088 Bacteria 27203
506 Ga0495602_0002781 3300048088 Bacteria 17886
507 Ga0495602_0245984 3300048088 Unclassified 1335
508 Ga0495602_0480554 3300048088 Bacteria 872
509 Ga0496100_0000019 3300048903 Bacteria 149995
510 Ga0496100_0037684 3300048903 Bacteria 3058
511 Ga0496101_0000005 3300048904 Bacteria 331455
512 Ga0496101_0012095 3300048904 Bacteria 5752
513 Ga0496102_0000438 3300048905 Bacteria 47526
514 Ga0496102_0014250 3300048905 Bacteria 6907
515 Ga0496102_0275993 3300048905 Bacteria 1584
516 Ga0496102_0290837 3300048905 Bacteria 1540
517 Ga0496102_0390136 3300048905 Bacteria 1310
518 Ga0496102_1334753 3300048905 Unclassified 636
519 Ga0496103_0000001 3300048906 Bacteria 643471
520 Ga0496103_0012743 3300048906 Bacteria 4987
521 Ga0496103_0093111 3300048906 Bacteria 1903
522 Ga0496103_0744977 3300048906 Bacteria 620
523 Ga0496104_0015865 3300048907 Bacteria 6834
524 Ga0496104_0030147 3300048907 Bacteria 5038
525 Ga0496104_0077504 3300048907 Bacteria 3167
526 Ga0496105_0000386 3300048908 Bacteria 28919
527 Ga0496105_0023169 3300048908 Bacteria 5034
528 Ga0496106_0000156 3300048909 Bacteria 50301
529 Ga0496106_0003859 3300048909 Bacteria 11174
530 Ga0496106_1527038 3300048909 Bacteria 513
531 Ga0496107_0000004 3300048910 Bacteria 297680
532 Ga0496107_0036478 3300048910 Bacteria 3526
533 Ga0496108_0000349 3300048911 Bacteria 39032
534 Ga0496108_0026391 3300048911 Bacteria 4791
535 Ga0496108_1469310 3300048911 Bacteria 568
536 Ga0496109_0000307 3300048912 Bacteria 46191
537 Ga0496109_0023193 3300048912 Bacteria 5506
538 Ga0496109_0043003 3300048912 Bacteria 4095
539 Ga0496109_0506353 3300048912 Viruses 1140
540 Ga0496109_0659835 3300048912 Bacteria 983
541 Ga0496109_0774298 3300048912 Unclassified 898
542 Ga0496109_1637181 3300048912 Bacteria 578
543 Ga0496110_0191812 3300048913 Unclassified 1855
544 Ga0496110_0424779 3300048913 Bacteria 1212
545 Ga0496111_0008560 3300048914 Bacteria 6778
546 Ga0496111_0852053 3300048914 Unclassified 658
547 Ga0496112_0025758 3300048915 Bacteria 5649
548 Ga0496112_0189395 3300048915 Bacteria 2020
549 Ga0496112_0266764 3300048915 Bacteria 1661
550 Ga0496113_0000017 3300048916 Bacteria 74327
551 Ga0496113_0003639 3300048916 Bacteria 9267
552 Ga0496114_0003035 3300048917 Bacteria 12860
553 Ga0496115_0000022 3300048918 Bacteria 164224
554 Ga0496115_0000034 3300048918 Bacteria 135380
555 Ga0496115_0000199 3300048918 Bacteria 56119
556 Ga0496115_0070027 3300048918 Bacteria 2842
557 Ga0501036_1251081 3300049572 Bacteria 604
558 Ga0501040_0451419 3300049576 Bacteria 925
559 Ga0501040_0679531 3300049576 Bacteria 744
560 Ga0501040_0933706 3300049576 Unclassified 629
561 Ga0501041_0934666 3300049577 Bacteria 557
562 Ga0501042_0240369 3300049578 Bacteria 1307
563 Ga0501042_0659414 3300049578 Bacteria 761
564 Ga0501046_0287200 3300049580 Bacteria 1204
565 Ga0501048_0393113 3300049582 Bacteria 991
566 Ga0501048_0394578 3300049582 Bacteria 989
567 Ga0501048_0692050 3300049582 Unclassified 732
568 Ga0501068_1122107 3300049584 Bacteria 520
569 Ga0501071_0348968 3300049587 Bacteria 1126
570 Ga0501071_1163669 3300049587 Unclassified 596
571 Ga0501071_1390207 3300049587 Bacteria 542
572 Ga0501072_0286801 3300049588 Bacteria 1309
573 Ga0501072_0902998 3300049588 Unclassified 690
574 Ga0501075_0521517 3300049591 Bacteria 907
575 Ga0501076_0275944 3300049592 Bacteria 1377
576 Ga0501079_0245111 3300049741 Bacteria 1400
577 Ga0501079_0298322 3300049741 Bacteria 1261
578 Ga0501081_0072196 3300049743 Bacteria 2407
579 Ga0501081_0246591 3300049743 Unclassified 1303
580 Ga0501081_0257752 3300049743 Bacteria 1274
581 Ga0501045_0344645 3300049824 Bacteria 1109
582 nmdc:mga03n38_125390_c1 3300050490 Bacteria 1267
583 nmdc:mga03n38_77330_c1 3300050490 Bacteria 1555
584 nmdc:mga03n38_774754_c1 3300050490 Bacteria 557
585 nmdc:mga00v17_383594_c1 3300050491 Bacteria 913
586 nmdc:mga00v17_515863_c1 3300050491 Bacteria 774
587 nmdc:mga00v17_54328_c1 3300050491 Bacteria 2443
588 nmdc:mga00v17_867896_c1 3300050491 Bacteria 572
589 nmdc:mga0yw44_123529_c1 3300050492 Bacteria 1669
590 nmdc:mga0yw44_24246_c1 3300050492 Bacteria 3431
591 nmdc:mga06z11_358425_c1 3300050494 Unclassified 874
592 nmdc:mga06z11_740793_c1 3300050494 Bacteria 599
593 nmdc:mga06z11_840551_c1 3300050494 Unclassified 559
594 nmdc:mga05p37_1253453_c1 3300050507 Unclassified 760
595 nmdc:mga05p37_135973_c1 3300050507 Bacteria 3014
596 nmdc:mga05p37_1493425_c1 3300050507 Bacteria 673
597 nmdc:mga05p37_1900666_c1 3300050507 Bacteria 568
598 nmdc:mga05p37_43547_c1 3300050507 Bacteria 5522
599 nmdc:mga05p37_483224_c1 3300050507 Bacteria 1426
600 nmdc:mga09592_1135534_c1 3300050508 Unclassified 648
601 nmdc:mga09592_9549_c1 3300050508 Bacteria 7883
602 nmdc:mga0qj67_404678_c1 3300050509 Bacteria 1101
603 nmdc:mga0qj67_515869_c1 3300050509 Unclassified 960
604 nmdc:mga06r32_854578_c1 3300050510 Bacteria 868
605 nmdc:mga08y16_137651_c1 3300050511 Unclassified 2538
606 nmdc:mga08y16_437469_c1 3300050511 Bacteria 1335
607 nmdc:mga08y16_75890_c1 3300050511 Bacteria 3503
608 nmdc:mga08y16_88348_c1 3300050511 Bacteria 3230
609 nmdc:mga0n895_101711_c1 3300050512 Bacteria 2884
610 nmdc:mga0n895_25902_c1 3300050512 Bacteria 5546
611 nmdc:mga0n895_375319_c1 3300050512 Bacteria 1439
612 nmdc:mga0rr50_50969_c1 3300050513 Bacteria 3069
613 nmdc:mga0rr50_97779_c1 3300050513 Bacteria 2299
614 nmdc:mga08x19_214285_c1 3300050514 Bacteria 1322
615 nmdc:mga0a205_417571_c1 3300050515 Bacteria 1204
616 nmdc:mga0a205_7528_c1 3300050515 Bacteria 9862
617 Ga0495601_0000029 3300053077 Bacteria 111437
618 Ga0495601_0041695 3300053077 Bacteria 2878
619 Ga0495612_0002233 3300053078 Bacteria 7962
620 Ga0495612_0020013 3300053078 Bacteria 2681
621 Ga0495655_0000010 3300053083 Bacteria 125615
622 Ga0495595_0000007 3300053084 Bacteria 228504
623 Ga0495619_0000233 3300053085 Bacteria 40638
624 Ga0495619_0001241 3300053085 Bacteria 16706
625 Ga0495619_0010884 3300053085 Bacteria 5724
626 Ga0495619_0071843 3300053085 Unclassified 2316
627 Ga0495619_0086364 3300053085 Unclassified 2120
628 Ga0500628_000039 3300053129 Bacteria 49907
629 Ga0501084_0173867 3300054114 Bacteria 1818
630 Ga0501084_0200694 3300054114 Bacteria 1683
631 Ga0501084_0653170 3300054114 Bacteria 888
632 Ga0501084_0910033 3300054114 Bacteria 740
633 Ga0501082_0561117 3300060353 Bacteria 999
634 Ga0501082_0946006 3300060353 Bacteria 753
635 Ga0466962_0135528 3300061719 Bacteria 1191
636 Ga0530510_0082390 3300061734 Bacteria 2343
637 Ga0530510_0300105 3300061734 Bacteria 1202
638 Ga0530510_1594159 3300061734 Bacteria 501

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10959432 Ga0163163_109594321 134
2 3300005336 Ga0070680_101335934 Ga0070680_1013359342 136
3 3300005344 Ga0070661_100047912 Ga0070661_1000479123 136
4 3300005366 Ga0070659_100005945 Ga0070659_1000059452 136
5 3300005458 Ga0070681_10614403 Ga0070681_106144032 136
6 3300005535 Ga0070684_100188225 Ga0070684_1001882253 136
7 3300005564 Ga0070664_100831947 Ga0070664_1008319472 136
8 3300005577 Ga0068857_100149525 Ga0068857_1001495254 136
9 3300005616 Ga0068852_100007831 Ga0068852_1000078318 136
10 3300009098 Ga0105245_11215220 Ga0105245_112152202 136
11 3300013307 Ga0157372_10103617 Ga0157372_101036173 136
12 3300020082 Ga0206353_10530369 Ga0206353_105303693 136
13 3300025912 Ga0207707_10282253 Ga0207707_102822534 136
14 3300025917 Ga0207660_11116881 Ga0207660_111168812 136
15 3300025920 Ga0207649_10097361 Ga0207649_100973613 136
16 3300025920 Ga0207649_10503233 Ga0207649_105032332 136
17 3300025921 Ga0207652_10191658 Ga0207652_101916583 136
18 3300025924 Ga0207694_10096787 Ga0207694_100967872 136
19 3300025932 Ga0207690_10299330 Ga0207690_102993302 136
20 3300025944 Ga0207661_10093974 Ga0207661_100939742 136
21 3300026116 Ga0207674_10226625 Ga0207674_102266253 136
22 3300026116 Ga0207674_10370061 Ga0207674_103700612 136
23 3300026142 Ga0207698_10262179 Ga0207698_102621791 136
24 3300048911 Ga0496108_1469310 Ga0496108_1469310_130_540 136
25 3300048913 Ga0496110_0424779 Ga0496110_0424779_340_750 136
26 3300049576 Ga0501040_0451419 Ga0501040_0451419_367_783 136
27 3300049577 Ga0501041_0934666 Ga0501041_0934666_90_506 136
28 3300049578 Ga0501042_0240369 Ga0501042_0240369_558_977 136
29 3300060353 Ga0501082_0946006 Ga0501082_0946006_42_458 136
30 3300061734 Ga0530510_1594159 Ga0530510_1594159_37_453 136
31 3300005329 Ga0070683_100084594 Ga0070683_1000845942 137
32 3300005834 Ga0068851_10132082 Ga0068851_101320822 137
33 3300009094 Ga0111539_10884775 Ga0111539_108847752 137
34 3300009545 Ga0105237_12778055 Ga0105237_127780551 137
35 3300025914 Ga0207671_10088848 Ga0207671_100888481 137
36 3300025919 Ga0207657_10015071 Ga0207657_1001507112 137
37 3300025939 Ga0207665_10411516 Ga0207665_104115162 137
38 3300044735 Ga0466968_0288721 Ga0466968_0288721_45_458 137
39 3300048905 Ga0496102_0390136 Ga0496102_0390136_495_908 137
40 3300005354 Ga0070675_102041212 Ga0070675_1020412121 138
41 3300005548 Ga0070665_100897632 Ga0070665_1008976322 138
42 3300006178 Ga0075367_10298522 Ga0075367_102985222 138
43 3300009101 Ga0105247_10134444 Ga0105247_101344441 138
44 3300009545 Ga0105237_10041255 Ga0105237_100412557 138
45 3300010375 Ga0105239_10468075 Ga0105239_104680753 138
46 3300013104 Ga0157370_10050656 Ga0157370_100506563 138
47 3300037466 Ga0395898_1089972 Ga0395898_1089972_48_464 138
48 3300042461 Ga0439460_0110157 Ga0439460_0110157_11_427 138
49 3300050494 nmdc:mga06z11_358425_c1 nmdc:mga06z11_358425_c1_242_661 138
50 3300005340 Ga0070689_100954865 Ga0070689_1009548652 139
51 3300005366 Ga0070659_100150761 Ga0070659_1001507613 139
52 3300005441 Ga0070700_100054790 Ga0070700_1000547903 139
53 3300005459 Ga0068867_100702266 Ga0068867_1007022662 139
54 3300005564 Ga0070664_100505543 Ga0070664_1005055432 139
55 3300005718 Ga0068866_10237818 Ga0068866_102378182 139
56 3300005840 Ga0068870_10183472 Ga0068870_101834722 139
57 3300006048 Ga0075363_100004167 Ga0075363_1000041677 139
58 3300006048 Ga0075363_100147607 Ga0075363_1001476072 139
59 3300006051 Ga0075364_10226577 Ga0075364_102265772 139
60 3300006058 Ga0075432_10057527 Ga0075432_100575272 139
61 3300006178 Ga0075367_10019603 Ga0075367_100196033 139
62 3300006881 Ga0068865_100165762 Ga0068865_1001657622 139
63 3300009098 Ga0105245_10007888 Ga0105245_1000788811 139
64 3300009551 Ga0105238_10012331 Ga0105238_100123312 139
65 3300011119 Ga0105246_10036422 Ga0105246_100364225 139
66 3300013296 Ga0157374_10921840 Ga0157374_109218402 139
67 3300014326 Ga0157380_10021138 Ga0157380_100211383 139
68 3300014326 Ga0157380_10141838 Ga0157380_101418382 139
69 3300025901 Ga0207688_10577124 Ga0207688_105771242 139
70 3300025907 Ga0207645_10638417 Ga0207645_106384172 139
71 3300025908 Ga0207643_10035518 Ga0207643_100355182 139
72 3300025925 Ga0207650_11501151 Ga0207650_115011511 139
73 3300025937 Ga0207669_10532357 Ga0207669_105323572 139
74 3300025945 Ga0207679_11374281 Ga0207679_113742811 139
75 3300026075 Ga0207708_10008033 Ga0207708_100080335 139
76 3300026089 Ga0207648_10153748 Ga0207648_101537482 139
77 3300026118 Ga0207675_102192839 Ga0207675_1021928392 139
78 3300028379 Ga0268266_10550397 Ga0268266_105503972 139
79 3300031995 Ga0307409_100898684 Ga0307409_1008986841 139
80 3300032002 Ga0307416_100838987 Ga0307416_1008389872 139
81 3300049576 Ga0501040_0933706 Ga0501040_0933706_160_582 139
82 3300049588 Ga0501072_0902998 Ga0501072_0902998_171_593 139
83 3300049741 Ga0501079_0298322 Ga0501079_0298322_161_583 139
84 3300050490 nmdc:mga03n38_125390_c1 nmdc:mga03n38_125390_c1_166_588 139
85 3300050490 nmdc:mga03n38_77330_c1 nmdc:mga03n38_77330_c1_491_913 139
86 3300050494 nmdc:mga06z11_740793_c1 nmdc:mga06z11_740793_c1_68_490 139
87 3300054114 Ga0501084_0910033 Ga0501084_0910033_147_569 139
88 3300005329 Ga0070683_100110699 Ga0070683_1001106993 141
89 3300005366 Ga0070659_101017130 Ga0070659_1010171302 141
90 3300005434 Ga0070709_10513680 Ga0070709_105136802 141
91 3300005436 Ga0070713_100759399 Ga0070713_1007593991 141
92 3300005459 Ga0068867_100224070 Ga0068867_1002240703 141
93 3300005535 Ga0070684_100605818 Ga0070684_1006058182 141
94 3300005539 Ga0068853_101147488 Ga0068853_1011474882 141
95 3300005564 Ga0070664_100060258 Ga0070664_1000602583 141
96 3300005719 Ga0068861_100192551 Ga0068861_1001925512 141
97 3300005834 Ga0068851_10565365 Ga0068851_105653652 141
98 3300005937 Ga0081455_10099757 Ga0081455_100997572 141
99 3300006058 Ga0075432_10133145 Ga0075432_101331452 141
100 3300006173 Ga0070716_100106063 Ga0070716_1001060632 141
101 3300006175 Ga0070712_100013203 Ga0070712_1000132036 141
102 3300006844 Ga0075428_100028774 Ga0075428_1000287745 141
103 3300006846 Ga0075430_100009898 Ga0075430_1000098983 141
104 3300009098 Ga0105245_10313345 Ga0105245_103133452 141
105 3300009147 Ga0114129_12487513 Ga0114129_124875131 141
106 3300009148 Ga0105243_10209962 Ga0105243_102099622 141
107 3300009553 Ga0105249_11021787 Ga0105249_110217872 141
108 3300013297 Ga0157378_11996859 Ga0157378_119968591 141
109 3300014326 Ga0157380_11520086 Ga0157380_115200862 141
110 3300014745 Ga0157377_10139331 Ga0157377_101393312 141
111 3300025901 Ga0207688_10722927 Ga0207688_107229271 141
112 3300025906 Ga0207699_10539800 Ga0207699_105398002 141
113 3300025915 Ga0207693_10017214 Ga0207693_100172142 141
114 3300025919 Ga0207657_10399549 Ga0207657_103995493 141
115 3300025920 Ga0207649_10962752 Ga0207649_109627521 141
116 3300025923 Ga0207681_10435077 Ga0207681_104350771 141
117 3300025929 Ga0207664_10980379 Ga0207664_109803791 141
118 3300025932 Ga0207690_10301112 Ga0207690_103011122 141
119 3300025935 Ga0207709_10329893 Ga0207709_103298931 141
120 3300025939 Ga0207665_10095892 Ga0207665_100958922 141
121 3300025940 Ga0207691_10942009 Ga0207691_109420091 141
122 3300025944 Ga0207661_10808523 Ga0207661_108085232 141
123 3300025945 Ga0207679_10042876 Ga0207679_100428762 141
124 3300025945 Ga0207679_10881164 Ga0207679_108811641 141
125 3300026041 Ga0207639_11151912 Ga0207639_111519121 141
126 3300026089 Ga0207648_10375681 Ga0207648_103756811 141
127 3300026118 Ga0207675_100244343 Ga0207675_1002443432 141
128 3300028563 Ga0265319_1070324 Ga0265319_10703242 141
129 3300031731 Ga0307405_10409326 Ga0307405_104093261 141
130 3300031911 Ga0307412_10686438 Ga0307412_106864382 141
131 3300031995 Ga0307409_100093628 Ga0307409_1000936283 141
132 3300031995 Ga0307409_100964232 Ga0307409_1009642321 141
133 3300032002 Ga0307416_100097604 Ga0307416_1000976042 141
134 3300032002 Ga0307416_100157621 Ga0307416_1001576213 141
135 3300032002 Ga0307416_100405191 Ga0307416_1004051912 141
136 3300032004 Ga0307414_10475724 Ga0307414_104757243 141
137 3300032004 Ga0307414_10923631 Ga0307414_109236312 141
138 3300032005 Ga0307411_10637127 Ga0307411_106371273 141
139 3300032126 Ga0307415_100004333 Ga0307415_1000043336 141
140 3300032126 Ga0307415_100286679 Ga0307415_1002866792 141
141 3300032126 Ga0307415_100646199 Ga0307415_1006461992 141
142 3300037312 Ga0395899_0014597 Ga0395899_0014597_1034_1459 141
143 3300037418 Ga0395900_0166985 Ga0395900_0166985_16_441 141
144 3300037466 Ga0395898_0001996 Ga0395898_0001996_25060_25485 141
145 3300037471 Ga0395905_0012030 Ga0395905_0012030_1217_1642 141
146 3300037853 Ga0436364_1340043 Ga0436364_1340043_515_940 141
147 3300038443 Ga0395901_0034351 Ga0395901_0034351_969_1394 141
148 3300039437 Ga0436365_1904503 Ga0436365_1904503_70_495 141
149 3300039453 Ga0436362_1260871 Ga0436362_1260871_729_1154 141
150 3300041512 Ga0451853_3583735 Ga0451853_3583735_122_547 141
151 3300042136 Ga0450900_026288 Ga0450900_026288_373_798 141
152 3300042438 Ga0439459_0081443 Ga0439459_0081443_285_710 141
153 3300042439 Ga0439464_0095572 Ga0439464_0095572_201_626 141
154 3300044683 Ga0466965_0068770 Ga0466965_0068770_332_841 141
155 3300044683 Ga0466965_0405103 Ga0466965_0405103_269_697 141
156 3300044694 Ga0466963_0040454 Ga0466963_0040454_860_1369 141
157 3300044694 Ga0466963_0324430 Ga0466963_0324430_635_1060 141
158 3300044706 Ga0466964_0172360 Ga0466964_0172360_209_634 141
159 3300044719 Ga0466971_0016134 Ga0466971_0016134_1207_1716 141
160 3300044735 Ga0466968_0392458 Ga0466968_0392458_47_556 141
161 3300044765 Ga0466970_0039150 Ga0466970_0039150_862_1371 141
162 3300044842 Ga0466957_0004676 Ga0466957_0004676_5204_5713 141
163 3300045049 Ga0466959_0034249 Ga0466959_0034249_2164_2673 141
164 3300045836 Ga0466958_0002339 Ga0466958_0002339_1829_2338 141
165 3300045836 Ga0466958_0029585 Ga0466958_0029585_2504_2932 141
166 3300045836 Ga0466958_0460257 Ga0466958_0460257_262_690 141
167 3300045976 Ga0466967_0056267 Ga0466967_0056267_2040_2465 141
168 3300045976 Ga0466967_2262623 Ga0466967_2262623_72_497 141
169 3300046514 Ga0495618_0007882 Ga0495618_0007882_1894_2319 141
170 3300046516 Ga0495628_0126513 Ga0495628_0126513_702_1127 141
171 3300046543 Ga0495645_0000088 Ga0495645_0000088_48290_48715 141
172 3300046679 Ga0495623_0230829 Ga0495623_0230829_36_461 141
173 3300046680 Ga0495646_0508939 Ga0495646_0508939_16_441 141
174 3300048906 Ga0496103_0093111 Ga0496103_0093111_117_569 141
175 3300048918 Ga0496115_0000034 Ga0496115_0000034_2416_2859 141
176 3300048918 Ga0496115_0000199 Ga0496115_0000199_16473_16916 141
177 3300050507 nmdc:mga05p37_1253453_c1 nmdc:mga05p37_1253453_c1_258_683 141
178 3300050508 nmdc:mga09592_1135534_c1 nmdc:mga09592_1135534_c1_133_564 141
179 3300050509 nmdc:mga0qj67_404678_c1 nmdc:mga0qj67_404678_c1_43_468 141
180 3300050511 nmdc:mga08y16_437469_c1 nmdc:mga08y16_437469_c1_419_844 141
181 3300053078 Ga0495612_0002233 Ga0495612_0002233_2578_3003 141
182 3300061719 Ga0466962_0135528 Ga0466962_0135528_414_923 141
183 3300005330 Ga0070690_100224293 Ga0070690_1002242931 142
184 3300005338 Ga0068868_100192095 Ga0068868_1001920953 142
185 3300005353 Ga0070669_100344091 Ga0070669_1003440912 142
186 3300005364 Ga0070673_100293591 Ga0070673_1002935912 142
187 3300005435 Ga0070714_100036362 Ga0070714_1000363622 142
188 3300005439 Ga0070711_100018198 Ga0070711_1000181985 142
189 3300005441 Ga0070700_101268362 Ga0070700_1012683621 142
190 3300005456 Ga0070678_100333495 Ga0070678_1003334951 142
191 3300005459 Ga0068867_100544601 Ga0068867_1005446012 142
192 3300005544 Ga0070686_100122372 Ga0070686_1001223724 142
193 3300005548 Ga0070665_100606321 Ga0070665_1006063212 142
194 3300005614 Ga0068856_100003669 Ga0068856_10000366911 142
195 3300005614 Ga0068856_101364076 Ga0068856_1013640761 142
196 3300005617 Ga0068859_100410570 Ga0068859_1004105702 142
197 3300005842 Ga0068858_100092118 Ga0068858_1000921183 142
198 3300005937 Ga0081455_10167912 Ga0081455_101679122 142
199 3300006028 Ga0070717_11749715 Ga0070717_117497151 142
200 3300006038 Ga0075365_10285626 Ga0075365_102856262 142
201 3300006173 Ga0070716_100179404 Ga0070716_1001794042 142
202 3300006178 Ga0075367_10256231 Ga0075367_102562311 142
203 3300006881 Ga0068865_100129502 Ga0068865_1001295023 142
204 3300006931 Ga0097620_100410554 Ga0097620_1004105542 142
205 3300009098 Ga0105245_10009000 Ga0105245_1000900010 142
206 3300009101 Ga0105247_11154295 Ga0105247_111542951 142
207 3300009147 Ga0114129_11335224 Ga0114129_113352242 142
208 3300009148 Ga0105243_10103282 Ga0105243_101032823 142
209 3300009553 Ga0105249_10610508 Ga0105249_106105082 142
210 3300013306 Ga0163162_12079337 Ga0163162_120793371 142
211 3300013307 Ga0157372_11702049 Ga0157372_117020492 142
212 3300014326 Ga0157380_10102618 Ga0157380_101026183 142
213 3300014969 Ga0157376_10427576 Ga0157376_104275762 142
214 3300025901 Ga0207688_10024164 Ga0207688_100241644 142
215 3300025903 Ga0207680_10088670 Ga0207680_100886702 142
216 3300025904 Ga0207647_10785994 Ga0207647_107859941 142
217 3300025915 Ga0207693_10044456 Ga0207693_100444563 142
218 3300025927 Ga0207687_10506881 Ga0207687_105068812 142
219 3300025935 Ga0207709_10143163 Ga0207709_101431631 142
220 3300025936 Ga0207670_10102412 Ga0207670_101024122 142
221 3300025938 Ga0207704_10028152 Ga0207704_100281523 142
222 3300025939 Ga0207665_10093657 Ga0207665_100936572 142
223 3300025941 Ga0207711_10517354 Ga0207711_105173541 142
224 3300025960 Ga0207651_10242430 Ga0207651_102424302 142
225 3300025961 Ga0207712_10528434 Ga0207712_105284342 142
226 3300026023 Ga0207677_10177042 Ga0207677_101770423 142
227 3300026035 Ga0207703_10083718 Ga0207703_100837185 142
228 3300026067 Ga0207678_10080828 Ga0207678_100808282 142
229 3300026078 Ga0207702_10000419 Ga0207702_1000041935 142
230 3300026078 Ga0207702_10621854 Ga0207702_106218541 142
231 3300026089 Ga0207648_10274512 Ga0207648_102745122 142
232 3300026121 Ga0207683_10340413 Ga0207683_103404132 142
233 3300028379 Ga0268266_11398313 Ga0268266_113983132 142
234 3300035119 Ga0373956_0601583 Ga0373956_0601583_64_492 142
235 3300036401 Ga0373937_0479421 Ga0373937_0479421_180_608 142
236 3300037466 Ga0395898_0442055 Ga0395898_0442055_450_878 142
237 3300038443 Ga0395901_0171605 Ga0395901_0171605_989_1417 142
238 3300044684 Ga0466966_0068613 Ga0466966_0068613_972_1409 142
239 3300044693 Ga0466961_0363200 Ga0466961_0363200_150_587 142
240 3300044706 Ga0466964_0334035 Ga0466964_0334035_177_608 142
241 3300044706 Ga0466964_0499550 Ga0466964_0499550_159_593 142
242 3300045049 Ga0466959_0381528 Ga0466959_0381528_440_877 142
243 3300045976 Ga0466967_0053245 Ga0466967_0053245_2838_3269 142
244 3300045976 Ga0466967_0304885 Ga0466967_0304885_29_457 142
245 3300046461 Ga0495641_0126663 Ga0495641_0126663_153_581 142
246 3300046674 Ga0495588_0000247 Ga0495588_0000247_25534_25962 142
247 3300046674 Ga0495588_0279375 Ga0495588_0279375_167_595 142
248 3300047315 Ga0495581_0328233 Ga0495581_0328233_251_679 142
249 3300047321 Ga0495676_0172123 Ga0495676_0172123_1016_1444 142
250 3300047321 Ga0495676_0528794 Ga0495676_0528794_175_603 142
251 3300048903 Ga0496100_0037684 Ga0496100_0037684_1389_1817 142
252 3300048904 Ga0496101_0012095 Ga0496101_0012095_2574_3002 142
253 3300048905 Ga0496102_0014250 Ga0496102_0014250_4066_4494 142
254 3300048906 Ga0496103_0012743 Ga0496103_0012743_3230_3658 142
255 3300048907 Ga0496104_0030147 Ga0496104_0030147_3982_4410 142
256 3300048908 Ga0496105_0023169 Ga0496105_0023169_4376_4804 142
257 3300048909 Ga0496106_0003859 Ga0496106_0003859_1129_1557 142
258 3300048910 Ga0496107_0036478 Ga0496107_0036478_2007_2435 142
259 3300048911 Ga0496108_0026391 Ga0496108_0026391_1637_2065 142
260 3300048912 Ga0496109_0023193 Ga0496109_0023193_2674_3102 142
261 3300048912 Ga0496109_0043003 Ga0496109_0043003_2145_2573 142
262 3300048912 Ga0496109_0659835 Ga0496109_0659835_225_653 142
263 3300048913 Ga0496110_0191812 Ga0496110_0191812_227_655 142
264 3300048914 Ga0496111_0008560 Ga0496111_0008560_1981_2409 142
265 3300048915 Ga0496112_0025758 Ga0496112_0025758_1979_2413 142
266 3300048915 Ga0496112_0266764 Ga0496112_0266764_975_1403 142
267 3300048916 Ga0496113_0000017 Ga0496113_0000017_9834_10268 142
268 3300048916 Ga0496113_0003639 Ga0496113_0003639_1533_1961 142
269 3300048917 Ga0496114_0003035 Ga0496114_0003035_6915_7343 142
270 3300048918 Ga0496115_0070027 Ga0496115_0070027_598_1026 142
271 3300050492 nmdc:mga0yw44_123529_c1 nmdc:mga0yw44_123529_c1_664_1092 142
272 3300050507 nmdc:mga05p37_1900666_c1 nmdc:mga05p37_1900666_c1_56_484 142
273 3300053085 Ga0495619_0086364 Ga0495619_0086364_602_1030 142
274 3300005338 Ga0068868_101302721 Ga0068868_1013027212 143
275 3300005367 Ga0070667_100002266 Ga0070667_10000226610 143
276 3300005440 Ga0070705_100296921 Ga0070705_1002969212 143
277 3300005445 Ga0070708_100891983 Ga0070708_1008919831 143
278 3300005459 Ga0068867_100200329 Ga0068867_1002003292 143
279 3300005468 Ga0070707_100265160 Ga0070707_1002651601 143
280 3300005548 Ga0070665_100216008 Ga0070665_1002160082 143
281 3300005549 Ga0070704_100128171 Ga0070704_1001281712 143
282 3300005578 Ga0068854_100000345 Ga0068854_10000034521 143
283 3300005617 Ga0068859_101822915 Ga0068859_1018229151 143
284 3300005834 Ga0068851_10005227 Ga0068851_100052276 143
285 3300005842 Ga0068858_100093347 Ga0068858_1000933473 143
286 3300005937 Ga0081455_10001231 Ga0081455_100012313 143
287 3300005937 Ga0081455_10186108 Ga0081455_101861082 143
288 3300006038 Ga0075365_10004155 Ga0075365_100041555 143
289 3300006038 Ga0075365_10080967 Ga0075365_100809673 143
290 3300006051 Ga0075364_10032023 Ga0075364_100320233 143
291 3300006058 Ga0075432_10031829 Ga0075432_100318293 143
292 3300006175 Ga0070712_100155843 Ga0070712_1001558433 143
293 3300006178 Ga0075367_10541370 Ga0075367_105413702 143
294 3300006844 Ga0075428_100104941 Ga0075428_1001049412 143
295 3300006847 Ga0075431_100024109 Ga0075431_1000241098 143
296 3300006847 Ga0075431_100125200 Ga0075431_1001252002 143
297 3300006852 Ga0075433_10410805 Ga0075433_104108052 143
298 3300006881 Ga0068865_100680500 Ga0068865_1006805002 143
299 3300006914 Ga0075436_100976752 Ga0075436_1009767522 143
300 3300006931 Ga0097620_101822758 Ga0097620_1018227581 143
301 3300007076 Ga0075435_100346269 Ga0075435_1003462692 143
302 3300009094 Ga0111539_10013057 Ga0111539_1001305712 143
303 3300009094 Ga0111539_10122100 Ga0111539_101221002 143
304 3300009098 Ga0105245_10943920 Ga0105245_109439202 143
305 3300009147 Ga0114129_10176418 Ga0114129_101764183 143
306 3300009147 Ga0114129_10672083 Ga0114129_106720831 143
307 3300009148 Ga0105243_10176167 Ga0105243_101761673 143
308 3300009176 Ga0105242_10072255 Ga0105242_100722554 143
309 3300009176 Ga0105242_13188490 Ga0105242_131884901 143
310 3300009553 Ga0105249_10446735 Ga0105249_104467353 143
311 3300010375 Ga0105239_10217724 Ga0105239_102177243 143
312 3300010375 Ga0105239_10536565 Ga0105239_105365652 143
313 3300010375 Ga0105239_11321591 Ga0105239_113215912 143
314 3300013297 Ga0157378_11157248 Ga0157378_111572482 143
315 3300013307 Ga0157372_10000284 Ga0157372_1000028428 143
316 3300013308 Ga0157375_10492995 Ga0157375_104929952 143
317 3300014326 Ga0157380_11692519 Ga0157380_116925192 143
318 3300014745 Ga0157377_10172065 Ga0157377_101720652 143
319 3300014968 Ga0157379_10024043 Ga0157379_100240435 143
320 3300025321 Ga0207656_10002224 Ga0207656_100022247 143
321 3300025899 Ga0207642_10294098 Ga0207642_102940982 143
322 3300025918 Ga0207662_11118252 Ga0207662_111182521 143
323 3300025927 Ga0207687_11102528 Ga0207687_111025281 143
324 3300025931 Ga0207644_11344200 Ga0207644_113442002 143
325 3300025935 Ga0207709_10515805 Ga0207709_105158052 143
326 3300025938 Ga0207704_10297883 Ga0207704_102978832 143
327 3300025961 Ga0207712_10007217 Ga0207712_100072173 143
328 3300025961 Ga0207712_11611902 Ga0207712_116119022 143
329 3300025972 Ga0207668_10080861 Ga0207668_100808611 143
330 3300025981 Ga0207640_10000077 Ga0207640_1000007720 143
331 3300025986 Ga0207658_10002876 Ga0207658_100028763 143
332 3300026035 Ga0207703_10067575 Ga0207703_100675753 143
333 3300027907 Ga0207428_10084372 Ga0207428_100843723 143
334 3300028379 Ga0268266_10210857 Ga0268266_102108573 143
335 3300028381 Ga0268264_10120385 Ga0268264_101203853 143
336 3300031251 Ga0265327_10378005 Ga0265327_103780052 143
337 3300037418 Ga0395900_1341804 Ga0395900_1341804_138_572 143
338 3300037471 Ga0395905_1638331 Ga0395905_1638331_31_462 143
339 3300038443 Ga0395901_0818887 Ga0395901_0818887_207_638 143
340 3300044901 Ga0466960_0126954 Ga0466960_0126954_478_918 143
341 3300046514 Ga0495618_0631267 Ga0495618_0631267_40_477 143
342 3300047317 Ga0495604_0281392 Ga0495604_0281392_641_1078 143
343 3300048088 Ga0495602_0001025 Ga0495602_0001025_26730_27167 143
344 3300048088 Ga0495602_0002781 Ga0495602_0002781_17398_17853 143
345 3300048905 Ga0496102_0275993 Ga0496102_0275993_939_1370 143
346 3300048905 Ga0496102_0290837 Ga0496102_0290837_464_910 143
347 3300048906 Ga0496103_0744977 Ga0496103_0744977_21_452 143
348 3300048909 Ga0496106_1527038 Ga0496106_1527038_57_488 143
349 3300048912 Ga0496109_1637181 Ga0496109_1637181_15_464 143
350 3300049580 Ga0501046_0287200 Ga0501046_0287200_481_912 143
351 3300049582 Ga0501048_0393113 Ga0501048_0393113_108_539 143
352 3300049582 Ga0501048_0394578 Ga0501048_0394578_485_916 143
353 3300049584 Ga0501068_1122107 Ga0501068_1122107_71_502 143
354 3300049588 Ga0501072_0286801 Ga0501072_0286801_78_509 143
355 3300049592 Ga0501076_0275944 Ga0501076_0275944_300_731 143
356 3300049741 Ga0501079_0245111 Ga0501079_0245111_724_1155 143
357 3300049743 Ga0501081_0246591 Ga0501081_0246591_679_1110 143
358 3300050491 nmdc:mga00v17_383594_c1 nmdc:mga00v17_383594_c1_159_590 143
359 3300050491 nmdc:mga00v17_515863_c1 nmdc:mga00v17_515863_c1_242_673 143
360 3300050491 nmdc:mga00v17_54328_c1 nmdc:mga00v17_54328_c1_1306_1737 143
361 3300050492 nmdc:mga0yw44_24246_c1 nmdc:mga0yw44_24246_c1_37_468 143
362 3300050494 nmdc:mga06z11_840551_c1 nmdc:mga06z11_840551_c1_32_463 143
363 3300050507 nmdc:mga05p37_43547_c1 nmdc:mga05p37_43547_c1_3879_4310 143
364 3300050511 nmdc:mga08y16_137651_c1 nmdc:mga08y16_137651_c1_444_875 143
365 3300050511 nmdc:mga08y16_88348_c1 nmdc:mga08y16_88348_c1_360_791 143
366 3300050512 nmdc:mga0n895_101711_c1 nmdc:mga0n895_101711_c1_348_779 143
367 3300050512 nmdc:mga0n895_25902_c1 nmdc:mga0n895_25902_c1_2689_3120 143
368 3300050513 nmdc:mga0rr50_97779_c1 nmdc:mga0rr50_97779_c1_222_653 143
369 3300050514 nmdc:mga08x19_214285_c1 nmdc:mga08x19_214285_c1_22_453 143
370 3300050515 nmdc:mga0a205_417571_c1 nmdc:mga0a205_417571_c1_142_573 143
371 3300054114 Ga0501084_0173867 Ga0501084_0173867_542_973 143
372 3300061734 Ga0530510_0300105 Ga0530510_0300105_644_1075 143
373 3300001977 JGI24746J21847_1001026 JGI24746J21847_10010264 144
374 3300001979 JGI24740J21852_10002767 JGI24740J21852_100027672 144
375 3300002459 JGI24751J29686_10070651 JGI24751J29686_100706511 144
376 3300003203 JGI25406J46586_10027831 JGI25406J46586_100278314 144
377 3300005329 Ga0070683_100008978 Ga0070683_1000089783 144
378 3300005329 Ga0070683_100010609 Ga0070683_1000106093 144
379 3300005329 Ga0070683_100015665 Ga0070683_1000156653 144
380 3300005329 Ga0070683_100126241 Ga0070683_1001262413 144
381 3300005330 Ga0070690_101423488 Ga0070690_1014234881 144
382 3300005337 Ga0070682_101047517 Ga0070682_1010475172 144
383 3300005338 Ga0068868_100000220 Ga0068868_1000002209 144
384 3300005338 Ga0068868_101828348 Ga0068868_1018283481 144
385 3300005340 Ga0070689_100071524 Ga0070689_1000715243 144
386 3300005341 Ga0070691_10000275 Ga0070691_100002753 144
387 3300005341 Ga0070691_10024493 Ga0070691_100244933 144
388 3300005347 Ga0070668_100119881 Ga0070668_1001198813 144
389 3300005353 Ga0070669_101269003 Ga0070669_1012690031 144
390 3300005365 Ga0070688_100000053 Ga0070688_10000005336 144
391 3300005365 Ga0070688_100471154 Ga0070688_1004711542 144
392 3300005436 Ga0070713_101416795 Ga0070713_1014167951 144
393 3300005439 Ga0070711_100245925 Ga0070711_1002459252 144
394 3300005441 Ga0070700_100005523 Ga0070700_1000055236 144
395 3300005455 Ga0070663_101124518 Ga0070663_1011245181 144
396 3300005456 Ga0070678_100003823 Ga0070678_1000038238 144
397 3300005456 Ga0070678_101134511 Ga0070678_1011345112 144
398 3300005457 Ga0070662_101080052 Ga0070662_1010800522 144
399 3300005466 Ga0070685_10000086 Ga0070685_1000008624 144
400 3300005466 Ga0070685_10029985 Ga0070685_100299852 144
401 3300005468 Ga0070707_100221165 Ga0070707_1002211652 144
402 3300005535 Ga0070684_100000300 Ga0070684_10000030013 144
403 3300005535 Ga0070684_100044980 Ga0070684_1000449803 144
404 3300005535 Ga0070684_100185513 Ga0070684_1001855132 144
405 3300005535 Ga0070684_101199600 Ga0070684_1011996002 144
406 3300005545 Ga0070695_100766268 Ga0070695_1007662682 144
407 3300005548 Ga0070665_100017640 Ga0070665_1000176407 144
408 3300005548 Ga0070665_101242907 Ga0070665_1012429071 144
409 3300005549 Ga0070704_100365985 Ga0070704_1003659852 144
410 3300005564 Ga0070664_100014728 Ga0070664_1000147283 144
411 3300005564 Ga0070664_100651091 Ga0070664_1006510911 144
412 3300005577 Ga0068857_100005209 Ga0068857_1000052098 144
413 3300005577 Ga0068857_101078277 Ga0068857_1010782772 144
414 3300005578 Ga0068854_100900680 Ga0068854_1009006802 144
415 3300005615 Ga0070702_100198963 Ga0070702_1001989633 144
416 3300005616 Ga0068852_100008636 Ga0068852_1000086363 144
417 3300005617 Ga0068859_101283685 Ga0068859_1012836851 144
418 3300005834 Ga0068851_10020425 Ga0068851_100204251 144
419 3300005840 Ga0068870_10142061 Ga0068870_101420612 144
420 3300005841 Ga0068863_100002888 Ga0068863_1000028883 144
421 3300005842 Ga0068858_100411920 Ga0068858_1004119202 144
422 3300005983 Ga0081540_1194534 Ga0081540_11945341 144
423 3300005983 Ga0081540_1218697 Ga0081540_12186972 144
424 3300005985 Ga0081539_10003833 Ga0081539_1000383313 144
425 3300005985 Ga0081539_10109602 Ga0081539_101096022 144
426 3300005985 Ga0081539_10234791 Ga0081539_102347911 144
427 3300006048 Ga0075363_100624927 Ga0075363_1006249272 144
428 3300006051 Ga0075364_10037846 Ga0075364_100378462 144
429 3300006051 Ga0075364_10293843 Ga0075364_102938432 144
430 3300006846 Ga0075430_100073707 Ga0075430_1000737072 144
431 3300006847 Ga0075431_100023129 Ga0075431_1000231292 144
432 3300006852 Ga0075433_10071303 Ga0075433_100713032 144
433 3300006871 Ga0075434_100001194 Ga0075434_10000119417 144
434 3300006880 Ga0075429_100004246 Ga0075429_1000042469 144
435 3300006914 Ga0075436_101417173 Ga0075436_1014171731 144
436 3300006931 Ga0097620_101283695 Ga0097620_1012836952 144
437 3300007076 Ga0075435_100032887 Ga0075435_1000328873 144
438 3300009094 Ga0111539_10036089 Ga0111539_100360893 144
439 3300009094 Ga0111539_10201867 Ga0111539_102018674 144
440 3300009094 Ga0111539_12323932 Ga0111539_123239321 144
441 3300009098 Ga0105245_10019398 Ga0105245_100193986 144
442 3300009098 Ga0105245_10114136 Ga0105245_101141363 144
443 3300009101 Ga0105247_10002606 Ga0105247_1000260610 144
444 3300009147 Ga0114129_10143929 Ga0114129_101439294 144
445 3300009147 Ga0114129_10340564 Ga0114129_103405642 144
446 3300009147 Ga0114129_10481931 Ga0114129_104819312 144
447 3300009147 Ga0114129_11419710 Ga0114129_114197102 144
448 3300009147 Ga0114129_12085584 Ga0114129_120855842 144
449 3300009147 Ga0114129_12769483 Ga0114129_127694831 144
450 3300009148 Ga0105243_10006390 Ga0105243_100063902 144
451 3300009148 Ga0105243_10094406 Ga0105243_100944063 144
452 3300009148 Ga0105243_11543260 Ga0105243_115432602 144
453 3300009174 Ga0105241_10124872 Ga0105241_101248722 144
454 3300009174 Ga0105241_10216916 Ga0105241_102169162 144
455 3300009177 Ga0105248_12757215 Ga0105248_127572151 144
456 3300009553 Ga0105249_10000054 Ga0105249_1000005490 144
457 3300009553 Ga0105249_11801559 Ga0105249_118015591 144
458 3300010375 Ga0105239_10332280 Ga0105239_103322803 144
459 3300011119 Ga0105246_10136309 Ga0105246_101363092 144
460 3300012476 Ga0157344_1026385 Ga0157344_10263851 144
461 3300013104 Ga0157370_10228969 Ga0157370_102289692 144
462 3300013296 Ga0157374_10694387 Ga0157374_106943872 144
463 3300013297 Ga0157378_10046947 Ga0157378_100469473 144
464 3300013297 Ga0157378_10052908 Ga0157378_100529084 144
465 3300013308 Ga0157375_12176095 Ga0157375_121760952 144
466 3300014326 Ga0157380_10089529 Ga0157380_100895291 144
467 3300014745 Ga0157377_10425882 Ga0157377_104258822 144
468 3300014969 Ga0157376_10111428 Ga0157376_101114282 144
469 3300014969 Ga0157376_10945793 Ga0157376_109457932 144
470 3300020070 Ga0206356_10206281 Ga0206356_102062812 144
471 3300021358 Ga0213873_10090042 Ga0213873_100900422 144
472 3300021384 Ga0213876_10086730 Ga0213876_100867303 144
473 3300025321 Ga0207656_10008896 Ga0207656_100088961 144
474 3300025900 Ga0207710_10000096 Ga0207710_1000009670 144
475 3300025908 Ga0207643_10125106 Ga0207643_101251061 144
476 3300025911 Ga0207654_10117527 Ga0207654_101175273 144
477 3300025911 Ga0207654_10165808 Ga0207654_101658082 144
478 3300025912 Ga0207707_10358422 Ga0207707_103584222 144
479 3300025916 Ga0207663_10230715 Ga0207663_102307152 144
480 3300025927 Ga0207687_10010977 Ga0207687_100109773 144
481 3300025927 Ga0207687_10110090 Ga0207687_101100902 144
482 3300025927 Ga0207687_11364414 Ga0207687_113644141 144
483 3300025928 Ga0207700_10487464 Ga0207700_104874642 144
484 3300025934 Ga0207686_10003508 Ga0207686_100035086 144
485 3300025935 Ga0207709_10019786 Ga0207709_100197863 144
486 3300025935 Ga0207709_11041765 Ga0207709_110417652 144
487 3300025936 Ga0207670_10088689 Ga0207670_100886892 144
488 3300025936 Ga0207670_10116398 Ga0207670_101163982 144
489 3300025937 Ga0207669_10742679 Ga0207669_107426792 144
490 3300025939 Ga0207665_10216950 Ga0207665_102169502 144
491 3300025939 Ga0207665_10349159 Ga0207665_103491592 144
492 3300025944 Ga0207661_10005756 Ga0207661_100057563 144
493 3300025944 Ga0207661_10005996 Ga0207661_100059966 144
494 3300025944 Ga0207661_10019548 Ga0207661_100195486 144
495 3300025945 Ga0207679_10013592 Ga0207679_100135923 144
496 3300025945 Ga0207679_10163335 Ga0207679_101633353 144
497 3300025961 Ga0207712_10000032 Ga0207712_1000003275 144
498 3300025961 Ga0207712_10204694 Ga0207712_102046943 144
499 3300025972 Ga0207668_10068403 Ga0207668_100684034 144
500 3300025972 Ga0207668_10995697 Ga0207668_109956971 144
501 3300025981 Ga0207640_10551317 Ga0207640_105513172 144
502 3300025981 Ga0207640_10607849 Ga0207640_106078492 144
503 3300026075 Ga0207708_10037813 Ga0207708_100378132 144
504 3300026088 Ga0207641_10002314 Ga0207641_100023146 144
505 3300026088 Ga0207641_11864409 Ga0207641_118644092 144
506 3300026116 Ga0207674_10001853 Ga0207674_1000185326 144
507 3300026116 Ga0207674_11026379 Ga0207674_110263792 144
508 3300026121 Ga0207683_10013197 Ga0207683_100131974 144
509 3300026142 Ga0207698_10008081 Ga0207698_100080813 144
510 3300028379 Ga0268266_10001186 Ga0268266_100011867 144
511 3300028556 Ga0265337_1002592 Ga0265337_10025927 144
512 3300028558 Ga0265326_10000056 Ga0265326_1000005610 144
513 3300028563 Ga0265319_1000010 Ga0265319_1000010165 144
514 3300028654 Ga0265322_10000017 Ga0265322_1000001756 144
515 3300028800 Ga0265338_10000051 Ga0265338_1000005158 144
516 3300028800 Ga0265338_10559285 Ga0265338_105592851 144
517 3300029957 Ga0265324_10001639 Ga0265324_100016395 144
518 3300031239 Ga0265328_10000258 Ga0265328_1000025816 144
519 3300031240 Ga0265320_10000068 Ga0265320_1000006868 144
520 3300031241 Ga0265325_10005471 Ga0265325_100054714 144
521 3300031249 Ga0265339_10023454 Ga0265339_100234545 144
522 3300031250 Ga0265331_10005995 Ga0265331_100059955 144
523 3300031251 Ga0265327_10000317 Ga0265327_1000031768 144
524 3300031344 Ga0265316_10127295 Ga0265316_101272953 144
525 3300031711 Ga0265314_10000973 Ga0265314_1000097324 144
526 3300031712 Ga0265342_10201265 Ga0265342_102012652 144
527 3300031995 Ga0307409_100363314 Ga0307409_1003633143 144
528 3300032126 Ga0307415_100020148 Ga0307415_1000201481 144
529 3300035111 Ga0373923_0078824 Ga0373923_0078824_378_815 144
530 3300035111 Ga0373923_0317786 Ga0373923_0317786_267_704 144
531 3300035725 Ga0373947_0450262 Ga0373947_0450262_215_658 144
532 3300036401 Ga0373937_0042838 Ga0373937_0042838_1910_2344 144
533 3300036401 Ga0373937_0106439 Ga0373937_0106439_1206_1643 144
534 3300039437 Ga0436365_0511075 Ga0436365_0511075_559_993 144
535 3300039453 Ga0436362_0671578 Ga0436362_0671578_149_583 144
536 3300041451 Ga0451791_0052506 Ga0451791_0052506_266_706 144
537 3300041458 Ga0451798_0544195 Ga0451798_0544195_193_633 144
538 3300041486 Ga0451807_0497514 Ga0451807_0497514_731_1171 144
539 3300041486 Ga0451807_1989586 Ga0451807_1989586_518_958 144
540 3300041492 Ga0451835_0152756 Ga0451835_0152756_520_960 144
541 3300041496 Ga0451839_1560512 Ga0451839_1560512_188_628 144
542 3300044706 Ga0466964_0774748 Ga0466964_0774748_52_510 144
543 3300044901 Ga0466960_0084385 Ga0466960_0084385_520_978 144
544 3300045836 Ga0466958_0074384 Ga0466958_0074384_329_769 144
545 3300045976 Ga0466967_0535772 Ga0466967_0535772_415_858 144
546 3300045976 Ga0466967_0844674 Ga0466967_0844674_366_809 144
547 3300046454 Ga0495592_0515500 Ga0495592_0515500_286_726 144
548 3300046459 Ga0495629_0000421 Ga0495629_0000421_32846_33280 144
549 3300046461 Ga0495641_0002767 Ga0495641_0002767_11829_12266 144
550 3300046461 Ga0495641_0346543 Ga0495641_0346543_28_468 144
551 3300046500 Ga0495596_0147691 Ga0495596_0147691_148_585 144
552 3300046507 Ga0495606_0000908 Ga0495606_0000908_31433_31867 144
553 3300046511 Ga0495608_0000013 Ga0495608_0000013_214585_215025 144
554 3300046512 Ga0495610_0267800 Ga0495610_0267800_149_589 144
555 3300046513 Ga0495616_0026032 Ga0495616_0026032_1254_1691 144
556 3300046516 Ga0495628_0365515 Ga0495628_0365515_591_1028 144
557 3300046518 Ga0495631_0169815 Ga0495631_0169815_43_480 144
558 3300046520 Ga0495637_0062760 Ga0495637_0062760_439_879 144
559 3300046526 Ga0495666_0141567 Ga0495666_0141567_439_882 144
560 3300046529 Ga0495652_0000009 Ga0495652_0000009_5505_5945 144
561 3300046529 Ga0495652_0859306 Ga0495652_0859306_65_508 144
562 3300046530 Ga0495654_0192611 Ga0495654_0192611_214_651 144
563 3300046533 Ga0495640_0330949 Ga0495640_0330949_171_611 144
564 3300046536 Ga0495587_0011918 Ga0495587_0011918_2773_3213 144
565 3300046536 Ga0495587_0042253 Ga0495587_0042253_114_554 144
566 3300046536 Ga0495587_0168992 Ga0495587_0168992_430_864 144
567 3300046559 Ga0495667_0424127 Ga0495667_0424127_194_628 144
568 3300046615 Ga0495656_0001553 Ga0495656_0001553_4637_5074 144
569 3300046663 Ga0495635_0155602 Ga0495635_0155602_319_753 144
570 3300046675 Ga0495657_0000003 Ga0495657_0000003_265784_266224 144
571 3300046675 Ga0495657_0003926 Ga0495657_0003926_7487_7924 144
572 3300047317 Ga0495604_0000527 Ga0495604_0000527_30646_31086 144
573 3300047317 Ga0495604_0177084 Ga0495604_0177084_850_1284 144
574 3300047319 Ga0495674_0000024 Ga0495674_0000024_22255_22695 144
575 3300047321 Ga0495676_0037312 Ga0495676_0037312_2727_3170 144
576 3300047321 Ga0495676_0043491 Ga0495676_0043491_2423_2863 144
577 3300047322 Ga0495680_0011541 Ga0495680_0011541_4411_4848 144
578 3300047322 Ga0495680_0160606 Ga0495680_0160606_374_808 144
579 3300047322 Ga0495680_0406497 Ga0495680_0406497_338_775 144
580 3300047444 Ga0495675_0000094 Ga0495675_0000094_13457_13897 144
581 3300047444 Ga0495675_0197185 Ga0495675_0197185_364_798 144
582 3300047673 Ga0495593_0048881 Ga0495593_0048881_609_1049 144
583 3300048088 Ga0495602_0245984 Ga0495602_0245984_387_857 144
584 3300048088 Ga0495602_0480554 Ga0495602_0480554_342_785 144
585 3300048903 Ga0496100_0000019 Ga0496100_0000019_30666_31106 144
586 3300048904 Ga0496101_0000005 Ga0496101_0000005_30666_31106 144
587 3300048905 Ga0496102_0000438 Ga0496102_0000438_41807_42247 144
588 3300048905 Ga0496102_1334753 Ga0496102_1334753_186_620 144
589 3300048906 Ga0496103_0000001 Ga0496103_0000001_637724_638164 144
590 3300048907 Ga0496104_0015865 Ga0496104_0015865_2467_2907 144
591 3300048907 Ga0496104_0077504 Ga0496104_0077504_525_965 144
592 3300048908 Ga0496105_0000386 Ga0496105_0000386_22953_23393 144
593 3300048909 Ga0496106_0000156 Ga0496106_0000156_30957_31397 144
594 3300048910 Ga0496107_0000004 Ga0496107_0000004_30883_31323 144
595 3300048911 Ga0496108_0000349 Ga0496108_0000349_11135_11575 144
596 3300048912 Ga0496109_0000307 Ga0496109_0000307_11126_11566 144
597 3300048912 Ga0496109_0506353 Ga0496109_0506353_20_460 144
598 3300048912 Ga0496109_0774298 Ga0496109_0774298_185_625 144
599 3300048914 Ga0496111_0852053 Ga0496111_0852053_191_631 144
600 3300048915 Ga0496112_0189395 Ga0496112_0189395_1073_1507 144
601 3300048918 Ga0496115_0000022 Ga0496115_0000022_83051_83506 144
602 3300049572 Ga0501036_1251081 Ga0501036_1251081_19_453 144
603 3300049576 Ga0501040_0679531 Ga0501040_0679531_156_590 144
604 3300049578 Ga0501042_0659414 Ga0501042_0659414_21_455 144
605 3300049582 Ga0501048_0692050 Ga0501048_0692050_35_487 144
606 3300049587 Ga0501071_0348968 Ga0501071_0348968_255_707 144
607 3300049587 Ga0501071_1163669 Ga0501071_1163669_45_500 144
608 3300049587 Ga0501071_1390207 Ga0501071_1390207_24_458 144
609 3300049591 Ga0501075_0521517 Ga0501075_0521517_401_835 144
610 3300049743 Ga0501081_0072196 Ga0501081_0072196_500_952 144
611 3300049743 Ga0501081_0257752 Ga0501081_0257752_159_593 144
612 3300049824 Ga0501045_0344645 Ga0501045_0344645_346_798 144
613 3300050490 nmdc:mga03n38_774754_c1 nmdc:mga03n38_774754_c1_75_509 144
614 3300050491 nmdc:mga00v17_867896_c1 nmdc:mga00v17_867896_c1_119_553 144
615 3300050507 nmdc:mga05p37_135973_c1 nmdc:mga05p37_135973_c1_121_567 144
616 3300050507 nmdc:mga05p37_1493425_c1 nmdc:mga05p37_1493425_c1_170_604 144
617 3300050507 nmdc:mga05p37_483224_c1 nmdc:mga05p37_483224_c1_131_565 144
618 3300050508 nmdc:mga09592_9549_c1 nmdc:mga09592_9549_c1_7098_7550 144
619 3300050509 nmdc:mga0qj67_515869_c1 nmdc:mga0qj67_515869_c1_119_562 144
620 3300050510 nmdc:mga06r32_854578_c1 nmdc:mga06r32_854578_c1_204_638 144
621 3300050511 nmdc:mga08y16_75890_c1 nmdc:mga08y16_75890_c1_3047_3481 144
622 3300050512 nmdc:mga0n895_375319_c1 nmdc:mga0n895_375319_c1_835_1278 144
623 3300050513 nmdc:mga0rr50_50969_c1 nmdc:mga0rr50_50969_c1_1878_2342 144
624 3300050515 nmdc:mga0a205_7528_c1 nmdc:mga0a205_7528_c1_2210_2674 144
625 3300053077 Ga0495601_0000029 Ga0495601_0000029_14906_15346 144
626 3300053077 Ga0495601_0041695 Ga0495601_0041695_1024_1464 144
627 3300053078 Ga0495612_0020013 Ga0495612_0020013_900_1340 144
628 3300053083 Ga0495655_0000010 Ga0495655_0000010_26457_26897 144
629 3300053084 Ga0495595_0000007 Ga0495595_0000007_214608_215048 144
630 3300053085 Ga0495619_0000233 Ga0495619_0000233_16005_16445 144
631 3300053085 Ga0495619_0001241 Ga0495619_0001241_2810_3250 144
632 3300053085 Ga0495619_0010884 Ga0495619_0010884_37_477 144
633 3300053085 Ga0495619_0071843 Ga0495619_0071843_1353_1787 144
634 3300053129 Ga0500628_000039 Ga0500628_000039_17958_18398 144
635 3300054114 Ga0501084_0200694 Ga0501084_0200694_951_1403 144
636 3300054114 Ga0501084_0653170 Ga0501084_0653170_325_759 144
637 3300060353 Ga0501082_0561117 Ga0501082_0561117_79_519 144
638 3300061734 Ga0530510_0082390 Ga0530510_0082390_237_689 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

40

153

0.96

PF07366

SnoaL

SnoaL-like polyketide cyclase

37

166

0.94

PF14534

DUF4440

Domain of unknown function (DUF4440)

36

135

0.9

PF13474

SnoaL_3

SnoaL-like domain

36

126

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uae-assembly4.cif.gz_D ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.903 12 129
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8963 7 135
3nm2-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38ep39gv40gs42g from pseudomonas testosteroni (tksi) 0.8938 1 135
3m8c-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi) with equilenin bound 0.8872 7 135
3mki-assembly2.cif.gz_C crystal structure of ketosteroid isomerase d38ed99n from pseudomonas testosteroni (tksi) 0.8832 12 135
ID Description Score Start End Superfamily
af_O33273_3_104_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8773 12 128 3.10.450.50
2geyC00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.876 7 144 3.10.450.50
2geyD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8693 7 144 3.10.450.50
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8655 7 131 3.10.450.50
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8585 7 129 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A538F1B6-F1-model_v4 Nuclear transport factor 2 family protein 0.9998 2 144 GO:0030638
AF-A0A7V9CB16-F1-model_v4 Nuclear transport factor 2 family protein 0.9978 27 144
AF-A0A538F1B6-F1-model_v4 Nuclear transport factor 2 family protein 0.986 2 144 GO:0030638
AF-A0A538HX34-F1-model_v4 Nuclear transport factor 2 family protein 0.9834 2 134
AF-A0A7V9CB16-F1-model_v4 Nuclear transport factor 2 family protein 0.9812 27 144

Feature Viewer

pLDDT pTM Quality
96.11 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map