F471509

General Info

Members Datasets Scaffolds Average Seq Length
638 332 638 112

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_12030499|Ga0105242_120304991
Length 134
Sequence LEYCRLAIEAQAVGGRARRRKGISMERAVFVYTTYPSVVEAERAGRALVEQRLCACVNILPGMISHYWWQGVLDRGEETVMIIKTRSSLTGPVSTAVKEMHSYATPAILVIPIESVDRDYLDWLMAETAPAAKA

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
123 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 7.84
Rhizosphere 88.4
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1048827 3300001976 Unclassified 573
2 JGI24737J22298_10126440 3300001990 Bacteria 755
3 JGI24743J22301_10028635 3300001991 Bacteria 1091
4 JGI24750J21931_1015787 3300002070 Bacteria 1022
5 JGI24738J21930_10083859 3300002075 Unclassified 669
6 JGI25404J52841_10088525 3300003659 Bacteria 647
7 JGI25405J52794_10020696 3300003911 Bacteria 1326
8 Ga0070676_10061128 3300005328 Bacteria 2239
9 Ga0070676_10920784 3300005328 Bacteria 652
10 Ga0070683_100808506 3300005329 Bacteria 899
11 Ga0070690_100094769 3300005330 Bacteria 1970
12 Ga0070690_100524414 3300005330 Unclassified 889
13 Ga0070670_100006065 3300005331 Bacteria 10225
14 Ga0070670_100009667 3300005331 Bacteria 8230
15 Ga0070670_100099690 3300005331 Bacteria 2500
16 Ga0070677_10402072 3300005333 Bacteria 722
17 Ga0068869_100043423 3300005334 Bacteria 3228
18 Ga0068869_100313588 3300005334 Bacteria 1270
19 Ga0070682_100415099 3300005337 Bacteria 1021
20 Ga0068868_100528535 3300005338 Bacteria 1037
21 Ga0070660_100643420 3300005339 Bacteria 888
22 Ga0070689_100029652 3300005340 Bacteria 4144
23 Ga0070691_10034541 3300005341 Bacteria 2380
24 Ga0070687_100091255 3300005343 Bacteria 1685
25 Ga0070687_100164163 3300005343 Bacteria 1316
26 Ga0070692_10076173 3300005345 Bacteria 1797
27 Ga0070668_100176747 3300005347 Bacteria 1741
28 Ga0070669_100078799 3300005353 Bacteria 2449
29 Ga0070675_100613915 3300005354 Bacteria 987
30 Ga0070675_100616294 3300005354 Bacteria 985
31 Ga0070675_101064566 3300005354 Bacteria 743
32 Ga0070671_100003913 3300005355 Bacteria 11715
33 Ga0070671_100307216 3300005355 Bacteria 1351
34 Ga0070671_100918418 3300005355 Unclassified 765
35 Ga0070674_100122177 3300005356 Bacteria 1929
36 Ga0070674_100422325 3300005356 Bacteria 1094
37 Ga0070673_100003043 3300005364 Bacteria 10371
38 Ga0070673_100678921 3300005364 Bacteria 945
39 Ga0070673_101326518 3300005364 Bacteria 676
40 Ga0070688_100092695 3300005365 Bacteria 1976
41 Ga0070659_100105626 3300005366 Bacteria 2269
42 Ga0070659_100227497 3300005366 Bacteria 1541
43 Ga0070667_100028679 3300005367 Bacteria 4635
44 Ga0070667_100790535 3300005367 Bacteria 881
45 Ga0070709_10066528 3300005434 Bacteria 2312
46 Ga0070709_10426590 3300005434 Bacteria 995
47 Ga0070714_100043181 3300005435 Bacteria 3811
48 Ga0070714_100691655 3300005435 Bacteria 983
49 Ga0070714_101307985 3300005435 Bacteria 708
50 Ga0070714_101410217 3300005435 Bacteria 680
51 Ga0070714_101564329 3300005435 Bacteria 644
52 Ga0070714_101671527 3300005435 Bacteria 622
53 Ga0070714_102121020 3300005435 Unclassified 548
54 Ga0070713_100043972 3300005436 Bacteria 3654
55 Ga0070713_100136697 3300005436 Bacteria 2166
56 Ga0070713_100627113 3300005436 Bacteria 1023
57 Ga0070713_100710247 3300005436 Unclassified 960
58 Ga0070710_10016561 3300005437 Bacteria 3754
59 Ga0070710_10088851 3300005437 Bacteria 1819
60 Ga0070710_10270612 3300005437 Bacteria 1098
61 Ga0070710_10803775 3300005437 Bacteria 672
62 Ga0070701_10015207 3300005438 Bacteria 3547
63 Ga0070711_100010256 3300005439 Bacteria 5795
64 Ga0070711_100075944 3300005439 Bacteria 2381
65 Ga0070711_100135471 3300005439 Bacteria 1840
66 Ga0070711_100320627 3300005439 Bacteria 1238
67 Ga0070711_101502312 3300005439 Unclassified 588
68 Ga0070711_101857610 3300005439 Bacteria 529
69 Ga0070700_100016035 3300005441 Bacteria 4260
70 Ga0070694_100172876 3300005444 Bacteria 1593
71 Ga0070694_100209186 3300005444 Bacteria 1458
72 Ga0070708_100338691 3300005445 Bacteria 1417
73 Ga0070678_100071005 3300005456 Bacteria 2605
74 Ga0070678_100867894 3300005456 Bacteria 823
75 Ga0070662_100018453 3300005457 Bacteria 4719
76 Ga0070662_100994181 3300005457 Bacteria 718
77 Ga0070662_101340874 3300005457 Bacteria 616
78 Ga0068867_100026541 3300005459 Bacteria 4159
79 Ga0070685_10400288 3300005466 Bacteria 951
80 Ga0070706_100625975 3300005467 Bacteria 999
81 Ga0070706_101010710 3300005467 Unclassified 767
82 Ga0070699_100003835 3300005518 Bacteria 13283
83 Ga0070684_100316243 3300005535 Bacteria 1434
84 Ga0070684_100826829 3300005535 Bacteria 866
85 Ga0070697_101003233 3300005536 Bacteria 742
86 Ga0070697_101487948 3300005536 Bacteria 605
87 Ga0068853_101435594 3300005539 Bacteria 668
88 Ga0070672_100059208 3300005543 Bacteria 3013
89 Ga0070686_100203823 3300005544 Bacteria 1420
90 Ga0070695_100252182 3300005545 Bacteria 1285
91 Ga0070696_100545893 3300005546 Bacteria 928
92 Ga0070665_100358778 3300005548 Bacteria 1463
93 Ga0070704_100058330 3300005549 Bacteria 2749
94 Ga0070704_100196352 3300005549 Bacteria 1626
95 Ga0070704_100280070 3300005549 Bacteria 1381
96 Ga0070704_101519474 3300005549 Bacteria 616
97 Ga0070664_100559888 3300005564 Bacteria 1058
98 Ga0068854_102053911 3300005578 Unclassified 527
99 Ga0068856_100519709 3300005614 Bacteria 1212
100 Ga0070702_100026311 3300005615 Bacteria 3125
101 Ga0070702_100928869 3300005615 Bacteria 683
102 Ga0070702_101177261 3300005615 Unclassified 617
103 Ga0068852_100510313 3300005616 Bacteria 1198
104 Ga0068859_100673676 3300005617 Bacteria 1126
105 Ga0068864_100084294 3300005618 Bacteria 2792
106 Ga0068861_100114323 3300005719 Bacteria 2167
107 Ga0068861_100496336 3300005719 Bacteria 1102
108 Ga0068851_10106126 3300005834 Bacteria 1495
109 Ga0068870_10117558 3300005840 Bacteria 1527
110 Ga0068863_100030734 3300005841 Bacteria 5128
111 Ga0068858_100035884 3300005842 Bacteria 4598
112 Ga0068858_100079754 3300005842 Bacteria 3041
113 Ga0068860_100005826 3300005843 Bacteria 12405
114 Ga0068862_100092258 3300005844 Bacteria 2640
115 Ga0081455_10001050 3300005937 Bacteria 34770
116 Ga0081455_10031856 3300005937 Bacteria 4761
117 Ga0081455_10036607 3300005937 Bacteria 4367
118 Ga0081455_10757094 3300005937 Bacteria 613
119 Ga0081538_10016926 3300005981 Bacteria 5561
120 Ga0081538_10116180 3300005981 Bacteria 1299
121 Ga0081540_1008191 3300005983 Bacteria 7321
122 Ga0070717_10007808 3300006028 Bacteria 7960
123 Ga0070717_10056132 3300006028 Bacteria 3253
124 Ga0070717_10082576 3300006028 Bacteria 2701
125 Ga0070717_10092317 3300006028 Bacteria 2558
126 Ga0070717_10128140 3300006028 Bacteria 2180
127 Ga0070717_10367293 3300006028 Bacteria 1289
128 Ga0070717_10402023 3300006028 Bacteria 1231
129 Ga0070717_11509956 3300006028 Unclassified 609
130 Ga0075365_10036002 3300006038 Bacteria 3206
131 Ga0075365_10076788 3300006038 Bacteria 2256
132 Ga0075365_10266999 3300006038 Bacteria 1203
133 Ga0075365_10869090 3300006038 Bacteria 636
134 Ga0075365_11076423 3300006038 Bacteria 566
135 Ga0075363_100903323 3300006048 Unclassified 541
136 Ga0075364_10140744 3300006051 Bacteria 1623
137 Ga0070715_10001812 3300006163 Bacteria 6372
138 Ga0070715_10043541 3300006163 Bacteria 1893
139 Ga0070715_10598220 3300006163 Bacteria 646
140 Ga0070716_100178179 3300006173 Bacteria 1393
141 Ga0070716_100202019 3300006173 Bacteria 1322
142 Ga0070716_100803925 3300006173 Bacteria 728
143 Ga0070716_100843629 3300006173 Bacteria 713
144 Ga0070712_100002532 3300006175 Bacteria 11286
145 Ga0070712_100117576 3300006175 Bacteria 1995
146 Ga0070712_100193994 3300006175 Bacteria 1591
147 Ga0070712_101519877 3300006175 Unclassified 585
148 Ga0075362_10048763 3300006177 Bacteria 1890
149 Ga0075367_10138723 3300006178 Bacteria 1505
150 Ga0097621_100025691 3300006237 Bacteria 4610
151 Ga0097621_100347890 3300006237 Bacteria 1317
152 Ga0068871_100005812 3300006358 Bacteria 8667
153 Ga0068871_100463965 3300006358 Bacteria 1137
154 Ga0075428_100696028 3300006844 Bacteria 1083
155 Ga0075430_100000039 3300006846 Bacteria 68229
156 Ga0075431_100028614 3300006847 Bacteria 5728
157 Ga0075431_100313239 3300006847 Bacteria 1584
158 Ga0075431_100664210 3300006847 Bacteria 1022
159 Ga0075433_10091548 3300006852 Bacteria 2689
160 Ga0075433_10321892 3300006852 Bacteria 1368
161 Ga0075434_100020016 3300006871 Bacteria 6482
162 Ga0075434_100276677 3300006871 Bacteria 1698
163 Ga0075434_101643372 3300006871 Bacteria 651
164 Ga0075429_100295656 3300006880 Bacteria 1418
165 Ga0068865_100323405 3300006881 Bacteria 1241
166 Ga0068865_100596214 3300006881 Bacteria 933
167 Ga0075436_100172172 3300006914 Bacteria 1529
168 Ga0097620_100673670 3300006931 Bacteria 1126
169 Ga0075435_100229392 3300007076 Unclassified 1577
170 Ga0075435_101350281 3300007076 Bacteria 624
171 Ga0075435_101383038 3300007076 Bacteria 617
172 Ga0099794_10027634 3300007265 Bacteria 2632
173 Ga0099795_10001705 3300007788 Bacteria 4889
174 Ga0099795_10120224 3300007788 Bacteria 1049
175 Ga0105251_10383070 3300009011 Unclassified 645
176 Ga0105250_10185307 3300009092 Bacteria 874
177 Ga0111539_10058430 3300009094 Bacteria 4576
178 Ga0111539_10345688 3300009094 Bacteria 1731
179 Ga0111539_10413885 3300009094 Bacteria 1570
180 Ga0111539_10759691 3300009094 Bacteria 1128
181 Ga0111539_11514860 3300009094 Bacteria 778
182 Ga0111539_12333532 3300009094 Bacteria 621
183 Ga0105245_10003663 3300009098 Bacteria 13721
184 Ga0105245_10020462 3300009098 Bacteria 5804
185 Ga0105245_10064297 3300009098 Bacteria 3315
186 Ga0105245_11111932 3300009098 Unclassified 837
187 Ga0105245_11933016 3300009098 Bacteria 643
188 Ga0105247_10009951 3300009101 Bacteria 5759
189 Ga0105247_10334935 3300009101 Bacteria 1060
190 Ga0105247_10921349 3300009101 Bacteria 676
191 Ga0105247_11321689 3300009101 Bacteria 580
192 Ga0114129_10002765 3300009147 Bacteria 24439
193 Ga0114129_10444493 3300009147 Bacteria 1701
194 Ga0114129_10622678 3300009147 Bacteria 1396
195 Ga0114129_10978388 3300009147 Bacteria 1067
196 Ga0114129_12389429 3300009147 Bacteria 633
197 Ga0105243_10043710 3300009148 Bacteria 3511
198 Ga0105243_10047260 3300009148 Bacteria 3387
199 Ga0105243_10469776 3300009148 Unclassified 1185
200 Ga0105243_10820117 3300009148 Bacteria 919
201 Ga0105241_11212192 3300009174 Bacteria 715
202 Ga0105242_10084073 3300009176 Bacteria 2666
203 Ga0105242_10893987 3300009176 Unclassified 887
204 Ga0105242_12030499 3300009176 Bacteria 618
205 Ga0105242_12875067 3300009176 Unclassified 532
206 Ga0105248_10091528 3300009177 Bacteria 3425
207 Ga0105248_10763499 3300009177 Bacteria 1091
208 Ga0105249_10068118 3300009553 Bacteria 3281
209 Ga0105249_10693943 3300009553 Bacteria 1078
210 Ga0099796_10002657 3300010159 Bacteria 3977
211 Ga0105239_10043720 3300010375 Bacteria 4912
212 Ga0105239_10127756 3300010375 Bacteria 2826
213 Ga0105239_11403724 3300010375 Bacteria 806
214 Ga0105246_10047575 3300011119 Bacteria 2930
215 Ga0105246_10097416 3300011119 Bacteria 2134
216 Ga0105246_10158672 3300011119 Bacteria 1721
217 Ga0105246_12502838 3300011119 Bacteria 508
218 Ga0157369_11653364 3300013105 Unclassified 651
219 Ga0157374_10052111 3300013296 Bacteria 3810
220 Ga0157374_10123817 3300013296 Unclassified 2497
221 Ga0157374_10757708 3300013296 Bacteria 986
222 Ga0157378_10345717 3300013297 Bacteria 1452
223 Ga0163162_10970434 3300013306 Bacteria 960
224 Ga0163162_11194776 3300013306 Bacteria 863
225 Ga0163162_11347829 3300013306 Bacteria 811
226 Ga0157375_10135295 3300013308 Bacteria 2587
227 Ga0163163_10081068 3300014325 Bacteria 3246
228 Ga0163163_10601423 3300014325 Bacteria 1163
229 Ga0163163_12323049 3300014325 Bacteria 595
230 Ga0157380_10307389 3300014326 Bacteria 1463
231 Ga0157380_12487736 3300014326 Unclassified 583
232 Ga0157377_10324174 3300014745 Bacteria 1024
233 Ga0157379_10080414 3300014968 Bacteria 2919
234 Ga0157376_10809569 3300014969 Bacteria 950
235 Ga0157376_11755973 3300014969 Unclassified 656
236 Ga0163161_10052402 3300017792 Bacteria 2957
237 Ga0213872_10082248 3300021361 Bacteria 1446
238 Ga0213874_10014735 3300021377 Bacteria 2050
239 Ga0213876_10216793 3300021384 Bacteria 1018
240 Ga0224572_1036531 3300024225 Bacteria 931
241 Ga0228598_1000228 3300024227 Bacteria 10658
242 Ga0228598_1017155 3300024227 Bacteria 1428
243 Ga0207697_10084111 3300025315 Bacteria 1343
244 Ga0207656_10051821 3300025321 Bacteria 1775
245 Ga0207692_11214296 3300025898 Bacteria 501
246 Ga0207710_10009117 3300025900 Bacteria 4176
247 Ga0207688_10000528 3300025901 Bacteria 18519
248 Ga0207680_10176044 3300025903 Bacteria 1444
249 Ga0207647_10161748 3300025904 Bacteria 1306
250 Ga0207685_10015951 3300025905 Bacteria 2393
251 Ga0207699_10087816 3300025906 Bacteria 1945
252 Ga0207699_10689668 3300025906 Bacteria 747
253 Ga0207699_10810008 3300025906 Bacteria 689
254 Ga0207684_10018238 3300025910 Bacteria 6010
255 Ga0207684_10369160 3300025910 Bacteria 1235
256 Ga0207654_10569638 3300025911 Bacteria 806
257 Ga0207671_10452173 3300025914 Bacteria 1023
258 Ga0207693_10004530 3300025915 Bacteria 11744
259 Ga0207693_10010765 3300025915 Bacteria 7426
260 Ga0207693_10045969 3300025915 Bacteria 3430
261 Ga0207693_10145733 3300025915 Bacteria 1862
262 Ga0207693_10218530 3300025915 Bacteria 1497
263 Ga0207663_10100684 3300025916 Bacteria 1940
264 Ga0207663_10193064 3300025916 Bacteria 1463
265 Ga0207663_10758700 3300025916 Bacteria 771
266 Ga0207663_11311183 3300025916 Unclassified 583
267 Ga0207662_10024468 3300025918 Bacteria 3474
268 Ga0207657_10073936 3300025919 Bacteria 2879
269 Ga0207649_10148584 3300025920 Bacteria 1611
270 Ga0207646_10443594 3300025922 Bacteria 1171
271 Ga0207681_10104561 3300025923 Bacteria 2049
272 Ga0207650_10002055 3300025925 Bacteria 14070
273 Ga0207650_10035565 3300025925 Bacteria 3618
274 Ga0207659_10138330 3300025926 Bacteria 1888
275 Ga0207659_10952127 3300025926 Bacteria 738
276 Ga0207659_11488751 3300025926 Unclassified 579
277 Ga0207687_10304804 3300025927 Bacteria 1284
278 Ga0207700_10032531 3300025928 Bacteria 3721
279 Ga0207700_10204810 3300025928 Bacteria 1664
280 Ga0207700_10220634 3300025928 Bacteria 1607
281 Ga0207700_10253925 3300025928 Bacteria 1503
282 Ga0207664_10421146 3300025929 Bacteria 1189
283 Ga0207664_10940083 3300025929 Unclassified 776
284 Ga0207644_10016666 3300025931 Bacteria 4947
285 Ga0207644_10305312 3300025931 Bacteria 1283
286 Ga0207644_10370633 3300025931 Bacteria 1166
287 Ga0207690_11027122 3300025932 Bacteria 686
288 Ga0207706_10005066 3300025933 Bacteria 12302
289 Ga0207706_11031716 3300025933 Bacteria 690
290 Ga0207686_10526657 3300025934 Bacteria 921
291 Ga0207686_10548648 3300025934 Bacteria 903
292 Ga0207709_10228008 3300025935 Bacteria 1348
293 Ga0207670_10030515 3300025936 Bacteria 3444
294 Ga0207670_10124786 3300025936 Bacteria 1877
295 Ga0207669_10610586 3300025937 Unclassified 887
296 Ga0207704_10853766 3300025938 Bacteria 763
297 Ga0207665_10002938 3300025939 Bacteria 11417
298 Ga0207665_10601333 3300025939 Bacteria 859
299 Ga0207691_10011323 3300025940 Bacteria 8558
300 Ga0207691_10163271 3300025940 Bacteria 1953
301 Ga0207689_10006443 3300025942 Bacteria 10381
302 Ga0207661_10433613 3300025944 Bacteria 1195
303 Ga0207679_10590121 3300025945 Bacteria 1000
304 Ga0207712_10056046 3300025961 Bacteria 2776
305 Ga0207712_10396083 3300025961 Bacteria 1159
306 Ga0207668_10090173 3300025972 Bacteria 2249
307 Ga0207640_11831007 3300025981 Unclassified 549
308 Ga0207658_10297954 3300025986 Bacteria 1388
309 Ga0207677_10866247 3300026023 Unclassified 812
310 Ga0207703_10660860 3300026035 Bacteria 992
311 Ga0207639_10879180 3300026041 Bacteria 837
312 Ga0207639_11577870 3300026041 Unclassified 616
313 Ga0207678_10022498 3300026067 Bacteria 5520
314 Ga0207678_10512161 3300026067 Bacteria 1047
315 Ga0207708_10024764 3300026075 Bacteria 4540
316 Ga0207641_10453756 3300026088 Bacteria 1239
317 Ga0207648_10023078 3300026089 Bacteria 5580
318 Ga0207676_10814658 3300026095 Bacteria 911
319 Ga0207676_12562197 3300026095 Unclassified 506
320 Ga0207674_10196776 3300026116 Bacteria 1965
321 Ga0207675_100017638 3300026118 Bacteria 6658
322 Ga0207675_100214759 3300026118 Bacteria 1852
323 Ga0207683_10091494 3300026121 Bacteria 2710
324 Ga0207683_12080914 3300026121 Unclassified 516
325 Ga0207698_10844744 3300026142 Bacteria 920
326 Ga0209179_1003699 3300027512 Bacteria 2233
327 Ga0207428_10039150 3300027907 Bacteria 3848
328 Ga0268266_10189851 3300028379 Bacteria 1875
329 Ga0268265_10250938 3300028380 Bacteria 1567
330 Ga0268264_11144026 3300028381 Unclassified 787
331 Ga0265763_1020462 3300030763 Bacteria 692
332 Ga0265770_1027491 3300030878 Bacteria 936
333 Ga0265773_1002977 3300031018 Bacteria 1076
334 Ga0265760_10023618 3300031090 Bacteria 1787
335 Ga0265760_10054588 3300031090 Bacteria 1207
336 Ga0265760_10387492 3300031090 Unclassified 503
337 Ga0373926_0019891 3300035083 Bacteria 2317
338 Ga0373934_0208864 3300035086 Bacteria 804
339 Ga0373944_0057696 3300035089 Bacteria 1238
340 Ga0373952_0300650 3300035092 Unclassified 500
341 Ga0373923_0000479 3300035111 Bacteria 9559
342 Ga0373932_0019664 3300035112 Bacteria 1763
343 Ga0373936_0006290 3300035113 Bacteria 4477
344 Ga0373936_0087368 3300035113 Bacteria 1304
345 Ga0373941_0204683 3300035115 Unclassified 752
346 Ga0373945_0019539 3300035116 Bacteria 2314
347 Ga0373945_0020534 3300035116 Bacteria 2262
348 Ga0373953_0006080 3300035117 Bacteria 3958
349 Ga0373953_0020404 3300035117 Bacteria 2476
350 Ga0373954_0013416 3300035118 Bacteria 3651
351 Ga0373954_0029261 3300035118 Bacteria 2536
352 Ga0373956_0063464 3300035119 Bacteria 1675
353 Ga0373956_0211162 3300035119 Bacteria 921
354 Ga0373956_0246313 3300035119 Bacteria 849
355 Ga0373957_0051167 3300035120 Bacteria 1580
356 Ga0373943_0063037 3300035170 Bacteria 1857
357 Ga0373943_0145805 3300035170 Bacteria 1279
358 Ga0373943_0224694 3300035170 Bacteria 1047
359 Ga0373946_0028163 3300035171 Bacteria 2227
360 Ga0373946_0041761 3300035171 Bacteria 1882
361 Ga0373955_0001971 3300035172 Bacteria 8840
362 Ga0373924_0000313 3300035410 Bacteria 14908
363 Ga0373924_0032081 3300035410 Bacteria 2115
364 Ga0373931_0154642 3300035691 Bacteria 1340
365 Ga0373935_0000756 3300035692 Bacteria 17208
366 Ga0373935_0042672 3300035692 Bacteria 2853
367 Ga0373927_0004701 3300035695 Bacteria 9519
368 Ga0373927_0027458 3300035695 Bacteria 3716
369 Ga0373927_0088057 3300035695 Bacteria 2015
370 Ga0373927_0296286 3300035695 Bacteria 1064
371 Ga0373927_0525610 3300035695 Bacteria 782
372 Ga0373927_0713734 3300035695 Bacteria 662
373 Ga0373933_0001225 3300035724 Bacteria 15180
374 Ga0373933_0391716 3300035724 Bacteria 906
375 Ga0373947_0017026 3300035725 Bacteria 4178
376 Ga0373947_0209273 3300035725 Bacteria 1279
377 Ga0373937_0000271 3300036401 Bacteria 49749
378 Ga0373937_0001973 3300036401 Bacteria 17162
379 Ga0373925_0000557 3300037068 Bacteria 36526
380 Ga0373925_0104160 3300037068 Bacteria 2184
381 Ga0373925_0373950 3300037068 Bacteria 1160
382 Ga0395905_0214941 3300037471 Bacteria 1801
383 Ga0436364_1268188 3300037853 Unclassified 548
384 Ga0395901_0479131 3300038443 Bacteria 1269
385 Ga0436365_1702936 3300039437 Bacteria 1130
386 Ga0436361_0639384 3300039447 Bacteria 11225
387 Ga0436363_1532208 3300039450 Bacteria 2124
388 Ga0451845_0831721 3300041501 Unclassified 554
389 Ga0451853_3488713 3300041512 Bacteria 538
390 Ga0466963_0042249 3300044694 Bacteria 2993
391 Ga0466968_0237339 3300044735 Bacteria 863
392 Ga0466968_0444356 3300044735 Bacteria 640
393 Ga0466967_0251728 3300045976 Bacteria 1688
394 Ga0495592_0000001 3300046454 Bacteria 305819
395 Ga0495592_0004076 3300046454 Bacteria 10624
396 Ga0495603_0051374 3300046455 Bacteria 2450
397 Ga0495603_0383388 3300046455 Bacteria 806
398 Ga0495629_0001945 3300046459 Bacteria 16099
399 Ga0495629_0036846 3300046459 Bacteria 3450
400 Ga0495629_0141734 3300046459 Bacteria 1672
401 Ga0495641_0041672 3300046461 Bacteria 2132
402 Ga0495641_0185015 3300046461 Bacteria 933
403 Ga0495651_0000596 3300046462 Bacteria 27994
404 Ga0495651_0001437 3300046462 Bacteria 18451
405 Ga0495651_0528729 3300046462 Unclassified 752
406 Ga0495653_0000092 3300046463 Bacteria 74868
407 Ga0495653_0017442 3300046463 Bacteria 5839
408 Ga0495582_0018977 3300046473 Bacteria 3763
409 Ga0495582_0041606 3300046473 Bacteria 2532
410 Ga0495582_0051730 3300046473 Bacteria 2265
411 Ga0495582_0335910 3300046473 Bacteria 870
412 Ga0495605_0452495 3300046474 Unclassified 529
413 Ga0495639_0381869 3300046475 Bacteria 710
414 Ga0495662_0017258 3300046476 Bacteria 3493
415 Ga0495664_0000001 3300046477 Bacteria 757730
416 Ga0495664_0125156 3300046477 Bacteria 1555
417 Ga0495584_0090047 3300046491 Bacteria 1547
418 Ga0495584_0117253 3300046491 Bacteria 1348
419 Ga0495594_0747733 3300046499 Bacteria 552
420 Ga0495608_0000109 3300046511 Bacteria 59207
421 Ga0495608_0007124 3300046511 Bacteria 7911
422 Ga0495618_0000064 3300046514 Bacteria 77194
423 Ga0495618_0011966 3300046514 Bacteria 5265
424 Ga0495618_0278763 3300046514 Bacteria 1043
425 Ga0495620_0161149 3300046515 Bacteria 872
426 Ga0495628_0000003 3300046516 Bacteria 470339
427 Ga0495628_0022697 3300046516 Bacteria 5154
428 Ga0495628_0066244 3300046516 Bacteria 2823
429 Ga0495630_0000920 3300046517 Bacteria 20504
430 Ga0495630_0058084 3300046517 Bacteria 2900
431 Ga0495630_0349614 3300046517 Bacteria 1131
432 Ga0495632_0068499 3300046519 Bacteria 1710
433 Ga0495637_0147662 3300046520 Bacteria 889
434 Ga0495642_0194048 3300046528 Bacteria 885
435 Ga0495652_0000001 3300046529 Bacteria 1045081
436 Ga0495652_0028625 3300046529 Bacteria 4900
437 Ga0495652_0288669 3300046529 Bacteria 1198
438 Ga0495640_0000012 3300046533 Bacteria 194692
439 Ga0495640_0004066 3300046533 Bacteria 11705
440 Ga0495640_0132755 3300046533 Bacteria 1610
441 Ga0495640_0243700 3300046533 Bacteria 1127
442 Ga0495586_0226476 3300046535 Bacteria 1063
443 Ga0495587_0000028 3300046536 Bacteria 138663
444 Ga0495587_0003805 3300046536 Bacteria 10013
445 Ga0495587_0466033 3300046536 Bacteria 699
446 Ga0495598_0051214 3300046537 Bacteria 1243
447 Ga0495609_0273624 3300046538 Bacteria 692
448 Ga0495645_0000004 3300046543 Bacteria 532661
449 Ga0495645_0098081 3300046543 Bacteria 2086
450 Ga0495645_0460547 3300046543 Unclassified 801
451 Ga0495622_0096739 3300046557 Bacteria 1355
452 Ga0495633_0267895 3300046558 Unclassified 778
453 Ga0495667_0000001 3300046559 Bacteria 834831
454 Ga0495667_0001772 3300046559 Bacteria 14330
455 Ga0495667_0583292 3300046559 Bacteria 697
456 Ga0495656_0173484 3300046615 Bacteria 1056
457 Ga0495668_0129758 3300046616 Bacteria 1380
458 Ga0495634_0000075 3300046642 Bacteria 77824
459 Ga0495634_0003759 3300046642 Bacteria 12074
460 Ga0495634_0306084 3300046642 Bacteria 960
461 Ga0495635_0000015 3300046663 Bacteria 215468
462 Ga0495635_0013128 3300046663 Bacteria 5799
463 Ga0495635_0692687 3300046663 Bacteria 661
464 Ga0495659_0261827 3300046664 Bacteria 723
465 Ga0495588_0772055 3300046674 Bacteria 502
466 Ga0495657_0000155 3300046675 Bacteria 62116
467 Ga0495657_0070588 3300046675 Bacteria 2282
468 Ga0495599_0000029 3300046678 Bacteria 113803
469 Ga0495599_0028522 3300046678 Bacteria 3499
470 Ga0495623_0000012 3300046679 Bacteria 120267
471 Ga0495623_0016640 3300046679 Bacteria 4749
472 Ga0495646_0000006 3300046680 Bacteria 258496
473 Ga0495646_0048619 3300046680 Bacteria 2575
474 Ga0495646_0261383 3300046680 Bacteria 925
475 Ga0495647_0093683 3300046681 Bacteria 1235
476 Ga0495647_0162975 3300046681 Bacteria 962
477 Ga0495658_0021927 3300046683 Bacteria 3373
478 Ga0495658_0065237 3300046683 Bacteria 2100
479 Ga0495658_0089234 3300046683 Bacteria 1823
480 Ga0495658_0338492 3300046683 Bacteria 955
481 Ga0495658_0429734 3300046683 Bacteria 843
482 Ga0495669_0060058 3300046684 Bacteria 1718
483 Ga0495613_0012194 3300046689 Bacteria 6388
484 Ga0495613_0124178 3300046689 Bacteria 1852
485 Ga0495613_0466158 3300046689 Bacteria 854
486 Ga0495624_0014887 3300046690 Bacteria 5268
487 Ga0495624_0034557 3300046690 Bacteria 3269
488 Ga0495624_0107093 3300046690 Bacteria 1719
489 Ga0495624_0427297 3300046690 Bacteria 794
490 Ga0495670_0358020 3300046691 Bacteria 786
491 Ga0495671_0250068 3300046692 Bacteria 855
492 Ga0495589_0120418 3300046794 Bacteria 1264
493 Ga0495600_0000081 3300046809 Bacteria 52285
494 Ga0495660_0140379 3300046810 Bacteria 1203
495 Ga0495581_0001934 3300047315 Bacteria 11616
496 Ga0495581_0120374 3300047315 Bacteria 1528
497 Ga0495604_0000091 3300047317 Bacteria 77216
498 Ga0495604_0006197 3300047317 Bacteria 9493
499 Ga0495674_0000001 3300047319 Bacteria 778665
500 Ga0495674_0003999 3300047319 Bacteria 14278
501 Ga0495674_1264996 3300047319 Bacteria 555
502 Ga0495672_0153136 3300047320 Bacteria 1194
503 Ga0495676_0249294 3300047321 Bacteria 1212
504 Ga0495676_0289852 3300047321 Bacteria 1106
505 Ga0495680_0001331 3300047322 Bacteria 26943
506 Ga0495680_0003944 3300047322 Bacteria 14346
507 Ga0495680_0115221 3300047322 Bacteria 1989
508 Ga0495680_0619742 3300047322 Bacteria 722
509 Ga0495675_0000113 3300047444 Bacteria 58250
510 Ga0495675_0030948 3300047444 Bacteria 3415
511 Ga0495677_0210726 3300047445 Bacteria 756
512 Ga0495681_0283853 3300047470 Unclassified 645
513 Ga0495684_0000055 3300047471 Bacteria 79796
514 Ga0495684_0086796 3300047471 Bacteria 2371
515 Ga0495593_0000990 3300047673 Bacteria 16699
516 Ga0495593_0420510 3300047673 Bacteria 668
517 Ga0495602_0000002 3300048088 Bacteria 422216
518 Ga0495602_0017584 3300048088 Bacteria 7163
519 Ga0495602_0932037 3300048088 Unclassified 576
520 Ga0495615_0088278 3300048090 Bacteria 860
521 Ga0496100_0069482 3300048903 Bacteria 2346
522 Ga0496101_0012045 3300048904 Bacteria 5761
523 Ga0496101_0463044 3300048904 Bacteria 1000
524 Ga0496102_0020204 3300048905 Bacteria 5882
525 Ga0496102_0055176 3300048905 Bacteria 3624
526 Ga0496102_0160511 3300048905 Bacteria 2114
527 Ga0496102_0259321 3300048905 Bacteria 1639
528 Ga0496102_0425603 3300048905 Bacteria 1247
529 Ga0496102_1265889 3300048905 Bacteria 657
530 Ga0496103_0033206 3300048906 Bacteria 3152
531 Ga0496103_0137446 3300048906 Bacteria 1562
532 Ga0496104_0010954 3300048907 Bacteria 8113
533 Ga0496104_0148231 3300048907 Bacteria 2253
534 Ga0496105_0025914 3300048908 Bacteria 4777
535 Ga0496105_0215875 3300048908 Bacteria 1562
536 Ga0496106_0023831 3300048909 Bacteria 4549
537 Ga0496106_0565967 3300048909 Bacteria 911
538 Ga0496106_0644718 3300048909 Bacteria 846
539 Ga0496106_0931473 3300048909 Bacteria 685
540 Ga0496106_1335613 3300048909 Unclassified 556
541 Ga0496107_0076503 3300048910 Bacteria 2437
542 Ga0496107_0447594 3300048910 Bacteria 959
543 Ga0496108_0030831 3300048911 Bacteria 4443
544 Ga0496108_0241429 3300048911 Bacteria 1571
545 Ga0496109_0002836 3300048912 Bacteria 14521
546 Ga0496109_0234485 3300048912 Bacteria 1727
547 Ga0496109_0784951 3300048912 Bacteria 890
548 Ga0496109_1192752 3300048912 Unclassified 698
549 Ga0496110_0001434 3300048913 Bacteria 17245
550 Ga0496110_0225258 3300048913 Bacteria 1705
551 Ga0496110_0286904 3300048913 Unclassified 1499
552 Ga0496110_0520041 3300048913 Bacteria 1082
553 Ga0496110_0827846 3300048913 Bacteria 830
554 Ga0496111_0007669 3300048914 Bacteria 7096
555 Ga0496111_0057596 3300048914 Bacteria 2813
556 Ga0496111_0154954 3300048914 Bacteria 1700
557 Ga0496111_0404421 3300048914 Bacteria 1009
558 Ga0496112_0012499 3300048915 Bacteria 7801
559 Ga0496112_0075069 3300048915 Bacteria 3343
560 Ga0496112_0155583 3300048915 Bacteria 2253
561 Ga0496112_0876329 3300048915 Bacteria 820
562 Ga0496113_0000104 3300048916 Bacteria 35682
563 Ga0496113_0366825 3300048916 Bacteria 1155
564 Ga0496114_0004545 3300048917 Bacteria 10773
565 Ga0496114_0100387 3300048917 Bacteria 2470
566 Ga0496114_0432591 3300048917 Bacteria 1165
567 Ga0496114_1038463 3300048917 Bacteria 703
568 Ga0496115_0100820 3300048918 Bacteria 2367
569 Ga0496115_0301613 3300048918 Bacteria 1313
570 Ga0496115_0354054 3300048918 Unclassified 1197
571 Ga0501031_0257218 3300049568 Bacteria 1135
572 Ga0501036_1494659 3300049572 Unclassified 547
573 Ga0501039_1112595 3300049575 Bacteria 612
574 Ga0501040_0339248 3300049576 Bacteria 1076
575 Ga0501041_0299390 3300049577 Unclassified 1013
576 Ga0501068_0659874 3300049584 Bacteria 683
577 Ga0501072_0333895 3300049588 Bacteria 1204
578 Ga0501076_0941998 3300049592 Bacteria 712
579 Ga0501076_1119386 3300049592 Bacteria 648
580 Ga0501076_1133844 3300049592 Bacteria 644
581 Ga0501077_0845165 3300049593 Bacteria 589
582 Ga0501079_0047501 3300049741 Bacteria 3312
583 Ga0501081_0827523 3300049743 Bacteria 697
584 Ga0501083_0005509 3300049744 Bacteria 8970
585 Ga0501045_0108584 3300049824 Bacteria 2057
586 Ga0501045_1063910 3300049824 Unclassified 592
587 Ga0501045_1129993 3300049824 Unclassified 573
588 nmdc:mga03683_12738_c1 3300050489 Bacteria 3078
589 nmdc:mga03683_45400_c1 3300050489 Bacteria 1818
590 nmdc:mga00v17_388229_c1 3300050491 Bacteria 907
591 nmdc:mga0yw44_1062210_c1 3300050492 Bacteria 547
592 nmdc:mga0yw44_151434_c1 3300050492 Bacteria 1513
593 nmdc:mga0yw44_80976_c1 3300050492 Bacteria 2035
594 nmdc:mga06z11_595934_c1 3300050494 Bacteria 672
595 nmdc:mga07m45_669211_c1 3300050496 Unclassified 598
596 nmdc:mga05p37_1099605_c1 3300050507 Bacteria 832
597 nmdc:mga05p37_569007_c1 3300050507 Bacteria 1286
598 nmdc:mga05p37_6074_c1 3300050507 Bacteria 14220
599 nmdc:mga09592_1300430_c1 3300050508 Bacteria 598
600 nmdc:mga09592_219979_c1 3300050508 Bacteria 1645
601 nmdc:mga09592_794934_c1 3300050508 Unclassified 800
602 nmdc:mga0qj67_58_c1 3300050509 Bacteria 81362
603 nmdc:mga06r32_127399_c1 3300050510 Bacteria 2515
604 nmdc:mga06r32_327054_c1 3300050510 Unclassified 1518
605 nmdc:mga08y16_1156074_c1 3300050511 Bacteria 746
606 nmdc:mga08y16_261648_c1 3300050511 Bacteria 1786
607 nmdc:mga08y16_46773_c1 3300050511 Bacteria 4529
608 nmdc:mga08y16_55660_c1 3300050511 Bacteria 4132
609 nmdc:mga08y16_687704_c1 3300050511 Bacteria 1024
610 nmdc:mga0n895_266369_c1 3300050512 Bacteria 1738
611 nmdc:mga0n895_54484_c1 3300050512 Bacteria 3934
612 nmdc:mga0rr50_1206659_c1 3300050513 Bacteria 643
613 nmdc:mga0rr50_138991_c1 3300050513 Bacteria 1952
614 nmdc:mga0rr50_260982_c1 3300050513 Bacteria 1441
615 nmdc:mga0rr50_422020_c1 3300050513 Bacteria 1128
616 nmdc:mga0a205_308638_c1 3300050515 Bacteria 1454
617 nmdc:mga0a205_728394_c1 3300050515 Bacteria 841
618 nmdc:mga0a205_852219_c1 3300050515 Unclassified 758
619 Ga0495601_0000006 3300053077 Bacteria 373770
620 Ga0495601_0020294 3300053077 Bacteria 4058
621 Ga0495601_0053340 3300053077 Bacteria 2555
622 Ga0495601_0056897 3300053077 Bacteria 2477
623 Ga0495612_0000007 3300053078 Bacteria 253300
624 Ga0495612_0022643 3300053078 Bacteria 2517
625 Ga0495612_0029298 3300053078 Bacteria 2217
626 Ga0495595_0000051 3300053084 Bacteria 60041
627 Ga0495595_0000580 3300053084 Bacteria 14001
628 Ga0495595_0574395 3300053084 Unclassified 576
629 Ga0495619_0000027 3300053085 Bacteria 165001
630 Ga0495619_0026800 3300053085 Bacteria 3710
631 Ga0495619_0028774 3300053085 Bacteria 3586
632 Ga0495619_0363575 3300053085 Bacteria 1000
633 Ga0495619_0579995 3300053085 Bacteria 768
634 Ga0501084_0479025 3300054114 Bacteria 1052
635 Ga0501084_0588277 3300054114 Bacteria 940
636 Ga0501084_1368825 3300054114 Unclassified 593
637 Ga0530510_0106019 3300061734 Bacteria 2057
638 Ga0530510_0168227 3300061734 Bacteria 1623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0941998 Ga0501076_0941998_165_491 106
2 3300005333 Ga0070677_10402072 Ga0070677_104020722 107
3 3300006028 Ga0070717_10402023 Ga0070717_104020232 107
4 3300006175 Ga0070712_101519877 Ga0070712_1015198772 107
5 3300009147 Ga0114129_12389429 Ga0114129_123894292 107
6 3300024227 Ga0228598_1000228 Ga0228598_10002284 107
7 3300025903 Ga0207680_10176044 Ga0207680_101760443 107
8 3300025915 Ga0207693_10218530 Ga0207693_102185302 107
9 3300035695 Ga0373927_0713734 Ga0373927_0713734_208_540 107
10 3300044735 Ga0466968_0237339 Ga0466968_0237339_402_737 107
11 3300046473 Ga0495582_0335910 Ga0495582_0335910_221_553 107
12 3300046516 Ga0495628_0066244 Ga0495628_0066244_2422_2799 107
13 3300046533 Ga0495640_0243700 Ga0495640_0243700_121_498 107
14 3300046536 Ga0495587_0466033 Ga0495587_0466033_122_499 107
15 3300046680 Ga0495646_0261383 Ga0495646_0261383_244_621 107
16 3300046683 Ga0495658_0429734 Ga0495658_0429734_178_510 107
17 3300047322 Ga0495680_0115221 Ga0495680_0115221_47_424 107
18 3300053077 Ga0495601_0020294 Ga0495601_0020294_1696_2073 107
19 3300053078 Ga0495612_0029298 Ga0495612_0029298_1276_1653 107
20 3300005328 Ga0070676_10920784 Ga0070676_109207842 108
21 3300005334 Ga0068869_100313588 Ga0068869_1003135882 108
22 3300005354 Ga0070675_101064566 Ga0070675_1010645662 108
23 3300005355 Ga0070671_100918418 Ga0070671_1009184182 108
24 3300005356 Ga0070674_100422325 Ga0070674_1004223252 108
25 3300005364 Ga0070673_101326518 Ga0070673_1013265182 108
26 3300005434 Ga0070709_10426590 Ga0070709_104265902 108
27 3300005435 Ga0070714_100691655 Ga0070714_1006916552 108
28 3300005435 Ga0070714_101307985 Ga0070714_1013079851 108
29 3300005435 Ga0070714_101410217 Ga0070714_1014102171 108
30 3300005436 Ga0070713_100710247 Ga0070713_1007102472 108
31 3300005437 Ga0070710_10803775 Ga0070710_108037752 108
32 3300005439 Ga0070711_101502312 Ga0070711_1015023121 108
33 3300005456 Ga0070678_100867894 Ga0070678_1008678941 108
34 3300005457 Ga0070662_100994181 Ga0070662_1009941811 108
35 3300005615 Ga0070702_100928869 Ga0070702_1009288692 108
36 3300005719 Ga0068861_100114323 Ga0068861_1001143233 108
37 3300005842 Ga0068858_100035884 Ga0068858_1000358843 108
38 3300006028 Ga0070717_10092317 Ga0070717_100923174 108
39 3300006173 Ga0070716_100803925 Ga0070716_1008039252 108
40 3300006237 Ga0097621_100025691 Ga0097621_1000256915 108
41 3300006881 Ga0068865_100596214 Ga0068865_1005962142 108
42 3300009094 Ga0111539_10058430 Ga0111539_100584303 108
43 3300009098 Ga0105245_10003663 Ga0105245_1000366311 108
44 3300009098 Ga0105245_11111932 Ga0105245_111119322 108
45 3300009101 Ga0105247_10921349 Ga0105247_109213492 108
46 3300009148 Ga0105243_10047260 Ga0105243_100472604 108
47 3300009174 Ga0105241_11212192 Ga0105241_112121922 108
48 3300009176 Ga0105242_12875067 Ga0105242_128750671 108
49 3300009177 Ga0105248_10091528 Ga0105248_100915284 108
50 3300011119 Ga0105246_10097416 Ga0105246_100974163 108
51 3300013296 Ga0157374_10757708 Ga0157374_107577082 108
52 3300013306 Ga0163162_11347829 Ga0163162_113478292 108
53 3300021384 Ga0213876_10216793 Ga0213876_102167932 108
54 3300024225 Ga0224572_1036531 Ga0224572_10365312 108
55 3300024227 Ga0228598_1017155 Ga0228598_10171551 108
56 3300025898 Ga0207692_11214296 Ga0207692_112142961 108
57 3300025926 Ga0207659_10952127 Ga0207659_109521271 108
58 3300025928 Ga0207700_10253925 Ga0207700_102539252 108
59 3300025929 Ga0207664_10421146 Ga0207664_104211462 108
60 3300026041 Ga0207639_11577870 Ga0207639_115778702 108
61 3300026118 Ga0207675_100214759 Ga0207675_1002147592 108
62 3300026121 Ga0207683_12080914 Ga0207683_120809141 108
63 3300030763 Ga0265763_1020462 Ga0265763_10204621 108
64 3300030878 Ga0265770_1027491 Ga0265770_10274912 108
65 3300031018 Ga0265773_1002977 Ga0265773_10029772 108
66 3300031090 Ga0265760_10023618 Ga0265760_100236183 108
67 3300031090 Ga0265760_10054588 Ga0265760_100545882 108
68 3300031090 Ga0265760_10387492 Ga0265760_103874921 108
69 3300035117 Ga0373953_0020404 Ga0373953_0020404_582_911 108
70 3300035118 Ga0373954_0029261 Ga0373954_0029261_256_585 108
71 3300035119 Ga0373956_0246313 Ga0373956_0246313_76_405 108
72 3300035120 Ga0373957_0051167 Ga0373957_0051167_94_423 108
73 3300035171 Ga0373946_0028163 Ga0373946_0028163_728_1057 108
74 3300035410 Ga0373924_0032081 Ga0373924_0032081_855_1184 108
75 3300035692 Ga0373935_0042672 Ga0373935_0042672_2084_2413 108
76 3300035695 Ga0373927_0027458 Ga0373927_0027458_861_1190 108
77 3300035724 Ga0373933_0001225 Ga0373933_0001225_10933_11262 108
78 3300035725 Ga0373947_0017026 Ga0373947_0017026_1702_2031 108
79 3300036401 Ga0373937_0001973 Ga0373937_0001973_4323_4652 108
80 3300037853 Ga0436364_1268188 Ga0436364_1268188_112_441 108
81 3300039437 Ga0436365_1702936 Ga0436365_1702936_520_852 108
82 3300044694 Ga0466963_0042249 Ga0466963_0042249_55_387 108
83 3300044735 Ga0466968_0444356 Ga0466968_0444356_32_361 108
84 3300045976 Ga0466967_0251728 Ga0466967_0251728_656_988 108
85 3300046454 Ga0495592_0004076 Ga0495592_0004076_5665_5994 108
86 3300046459 Ga0495629_0001945 Ga0495629_0001945_2416_2745 108
87 3300046462 Ga0495651_0001437 Ga0495651_0001437_13355_13684 108
88 3300046463 Ga0495653_0017442 Ga0495653_0017442_2085_2414 108
89 3300046473 Ga0495582_0018977 Ga0495582_0018977_1885_2214 108
90 3300046477 Ga0495664_0125156 Ga0495664_0125156_1158_1487 108
91 3300046491 Ga0495584_0090047 Ga0495584_0090047_1156_1488 108
92 3300046511 Ga0495608_0007124 Ga0495608_0007124_632_961 108
93 3300046514 Ga0495618_0011966 Ga0495618_0011966_3101_3430 108
94 3300046516 Ga0495628_0022697 Ga0495628_0022697_415_744 108
95 3300046517 Ga0495630_0058084 Ga0495630_0058084_550_879 108
96 3300046529 Ga0495652_0028625 Ga0495652_0028625_4347_4676 108
97 3300046533 Ga0495640_0004066 Ga0495640_0004066_7519_7848 108
98 3300046536 Ga0495587_0003805 Ga0495587_0003805_4952_5281 108
99 3300046543 Ga0495645_0098081 Ga0495645_0098081_900_1229 108
100 3300046559 Ga0495667_0001772 Ga0495667_0001772_1152_1481 108
101 3300046642 Ga0495634_0003759 Ga0495634_0003759_7335_7664 108
102 3300046663 Ga0495635_0013128 Ga0495635_0013128_564_893 108
103 3300046675 Ga0495657_0070588 Ga0495657_0070588_1726_2055 108
104 3300046678 Ga0495599_0028522 Ga0495599_0028522_48_377 108
105 3300046679 Ga0495623_0016640 Ga0495623_0016640_213_542 108
106 3300046680 Ga0495646_0048619 Ga0495646_0048619_1535_1864 108
107 3300046683 Ga0495658_0021927 Ga0495658_0021927_1590_1919 108
108 3300046690 Ga0495624_0107093 Ga0495624_0107093_1113_1442 108
109 3300047317 Ga0495604_0006197 Ga0495604_0006197_7208_7537 108
110 3300047319 Ga0495674_0003999 Ga0495674_0003999_9369_9698 108
111 3300047321 Ga0495676_0289852 Ga0495676_0289852_149_478 108
112 3300047322 Ga0495680_0003944 Ga0495680_0003944_1462_1791 108
113 3300047444 Ga0495675_0030948 Ga0495675_0030948_1109_1438 108
114 3300047471 Ga0495684_0086796 Ga0495684_0086796_1314_1643 108
115 3300048088 Ga0495602_0017584 Ga0495602_0017584_4275_4604 108
116 3300048905 Ga0496102_1265889 Ga0496102_1265889_78_407 108
117 3300048909 Ga0496106_0931473 Ga0496106_0931473_262_591 108
118 3300048915 Ga0496112_0155583 Ga0496112_0155583_1812_2141 108
119 3300049584 Ga0501068_0659874 Ga0501068_0659874_284_616 108
120 3300049592 Ga0501076_1133844 Ga0501076_1133844_15_344 108
121 3300049593 Ga0501077_0845165 Ga0501077_0845165_13_342 108
122 3300049744 Ga0501083_0005509 Ga0501083_0005509_7603_7929 108
123 3300050511 nmdc:mga08y16_46773_c1 nmdc:mga08y16_46773_c1_667_996 108
124 3300053077 Ga0495601_0053340 Ga0495601_0053340_2007_2336 108
125 3300053078 Ga0495612_0022643 Ga0495612_0022643_219_548 108
126 3300053084 Ga0495595_0000580 Ga0495595_0000580_4314_4643 108
127 3300053085 Ga0495619_0028774 Ga0495619_0028774_1745_2074 108
128 3300054114 Ga0501084_0588277 Ga0501084_0588277_226_552 108
129 3300061734 Ga0530510_0106019 Ga0530510_0106019_862_1188 108
130 3300005330 Ga0070690_100094769 Ga0070690_1000947692 109
131 3300005331 Ga0070670_100009667 Ga0070670_1000096673 109
132 3300005340 Ga0070689_100029652 Ga0070689_1000296525 109
133 3300005354 Ga0070675_100613915 Ga0070675_1006139152 109
134 3300005355 Ga0070671_100003913 Ga0070671_10000391314 109
135 3300005364 Ga0070673_100003043 Ga0070673_1000030436 109
136 3300005366 Ga0070659_100227497 Ga0070659_1002274972 109
137 3300005434 Ga0070709_10066528 Ga0070709_100665283 109
138 3300005435 Ga0070714_101671527 Ga0070714_1016715271 109
139 3300005435 Ga0070714_102121020 Ga0070714_1021210201 109
140 3300005436 Ga0070713_100627113 Ga0070713_1006271132 109
141 3300005439 Ga0070711_100075944 Ga0070711_1000759441 109
142 3300005545 Ga0070695_100252182 Ga0070695_1002521821 109
143 3300005549 Ga0070704_101519474 Ga0070704_1015194742 109
144 3300005578 Ga0068854_102053911 Ga0068854_1020539111 109
145 3300005614 Ga0068856_100519709 Ga0068856_1005197091 109
146 3300006028 Ga0070717_10056132 Ga0070717_100561323 109
147 3300006173 Ga0070716_100202019 Ga0070716_1002020192 109
148 3300006173 Ga0070716_100843629 Ga0070716_1008436292 109
149 3300006175 Ga0070712_100193994 Ga0070712_1001939943 109
150 3300006852 Ga0075433_10321892 Ga0075433_103218921 109
151 3300006871 Ga0075434_100276677 Ga0075434_1002766772 109
152 3300007788 Ga0099795_10001705 Ga0099795_100017053 109
153 3300007788 Ga0099795_10120224 Ga0099795_101202241 109
154 3300009098 Ga0105245_10064297 Ga0105245_100642973 109
155 3300009098 Ga0105245_11933016 Ga0105245_119330161 109
156 3300009101 Ga0105247_10334935 Ga0105247_103349351 109
157 3300009148 Ga0105243_10469776 Ga0105243_104697762 109
158 3300009176 Ga0105242_10893987 Ga0105242_108939872 109
159 3300010159 Ga0099796_10002657 Ga0099796_100026573 109
160 3300010375 Ga0105239_11403724 Ga0105239_114037242 109
161 3300011119 Ga0105246_10158672 Ga0105246_101586722 109
162 3300013296 Ga0157374_10123817 Ga0157374_101238172 109
163 3300014325 Ga0163163_10081068 Ga0163163_100810684 109
164 3300014326 Ga0157380_10307389 Ga0157380_103073892 109
165 3300014969 Ga0157376_11755973 Ga0157376_117559731 109
166 3300025906 Ga0207699_10087816 Ga0207699_100878163 109
167 3300025906 Ga0207699_10689668 Ga0207699_106896682 109
168 3300025915 Ga0207693_10145733 Ga0207693_101457332 109
169 3300025916 Ga0207663_11311183 Ga0207663_113111831 109
170 3300025923 Ga0207681_10104561 Ga0207681_101045613 109
171 3300025925 Ga0207650_10035565 Ga0207650_100355652 109
172 3300025926 Ga0207659_11488751 Ga0207659_114887511 109
173 3300025927 Ga0207687_10304804 Ga0207687_103048042 109
174 3300025929 Ga0207664_10940083 Ga0207664_109400831 109
175 3300025931 Ga0207644_10016666 Ga0207644_100166666 109
176 3300025932 Ga0207690_11027122 Ga0207690_110271221 109
177 3300025934 Ga0207686_10526657 Ga0207686_105266572 109
178 3300025936 Ga0207670_10030515 Ga0207670_100305155 109
179 3300025939 Ga0207665_10601333 Ga0207665_106013332 109
180 3300025940 Ga0207691_10163271 Ga0207691_101632711 109
181 3300025981 Ga0207640_11831007 Ga0207640_118310072 109
182 3300026035 Ga0207703_10660860 Ga0207703_106608601 109
183 3300027512 Ga0209179_1003699 Ga0209179_10036993 109
184 3300035083 Ga0373926_0019891 Ga0373926_0019891_1176_1526 109
185 3300035086 Ga0373934_0208864 Ga0373934_0208864_433_783 109
186 3300035089 Ga0373944_0057696 Ga0373944_0057696_219_569 109
187 3300035092 Ga0373952_0300650 Ga0373952_0300650_41_382 109
188 3300035111 Ga0373923_0000479 Ga0373923_0000479_1411_1761 109
189 3300035113 Ga0373936_0006290 Ga0373936_0006290_2110_2460 109
190 3300035117 Ga0373953_0006080 Ga0373953_0006080_2654_3004 109
191 3300035118 Ga0373954_0013416 Ga0373954_0013416_1963_2313 109
192 3300035119 Ga0373956_0063464 Ga0373956_0063464_1231_1581 109
193 3300035170 Ga0373943_0063037 Ga0373943_0063037_895_1245 109
194 3300035170 Ga0373943_0145805 Ga0373943_0145805_104_436 109
195 3300035171 Ga0373946_0041761 Ga0373946_0041761_1411_1761 109
196 3300035172 Ga0373955_0001971 Ga0373955_0001971_1212_1562 109
197 3300035410 Ga0373924_0000313 Ga0373924_0000313_1301_1651 109
198 3300035692 Ga0373935_0000756 Ga0373935_0000756_4138_4488 109
199 3300035695 Ga0373927_0004701 Ga0373927_0004701_6944_7294 109
200 3300035695 Ga0373927_0525610 Ga0373927_0525610_61_393 109
201 3300035724 Ga0373933_0391716 Ga0373933_0391716_520_870 109
202 3300036401 Ga0373937_0000271 Ga0373937_0000271_25839_26189 109
203 3300037068 Ga0373925_0000557 Ga0373925_0000557_30111_30461 109
204 3300046454 Ga0495592_0000001 Ga0495592_0000001_3857_4207 109
205 3300046455 Ga0495603_0383388 Ga0495603_0383388_80_409 109
206 3300046459 Ga0495629_0036846 Ga0495629_0036846_97_447 109
207 3300046461 Ga0495641_0185015 Ga0495641_0185015_381_731 109
208 3300046462 Ga0495651_0000596 Ga0495651_0000596_12171_12521 109
209 3300046462 Ga0495651_0528729 Ga0495651_0528729_310_645 109
210 3300046463 Ga0495653_0000092 Ga0495653_0000092_18856_19206 109
211 3300046473 Ga0495582_0041606 Ga0495582_0041606_1226_1576 109
212 3300046476 Ga0495662_0017258 Ga0495662_0017258_2647_2997 109
213 3300046477 Ga0495664_0000001 Ga0495664_0000001_312154_312504 109
214 3300046511 Ga0495608_0000109 Ga0495608_0000109_37578_37928 109
215 3300046514 Ga0495618_0000064 Ga0495618_0000064_55576_55926 109
216 3300046516 Ga0495628_0000003 Ga0495628_0000003_143211_143561 109
217 3300046517 Ga0495630_0000920 Ga0495630_0000920_17633_17983 109
218 3300046529 Ga0495652_0000001 Ga0495652_0000001_514661_515011 109
219 3300046533 Ga0495640_0000012 Ga0495640_0000012_156953_157303 109
220 3300046533 Ga0495640_0132755 Ga0495640_0132755_1117_1449 109
221 3300046535 Ga0495586_0226476 Ga0495586_0226476_642_992 109
222 3300046536 Ga0495587_0000028 Ga0495587_0000028_21274_21624 109
223 3300046543 Ga0495645_0000004 Ga0495645_0000004_205660_206010 109
224 3300046559 Ga0495667_0000001 Ga0495667_0000001_354653_355003 109
225 3300046642 Ga0495634_0000075 Ga0495634_0000075_34035_34385 109
226 3300046663 Ga0495635_0000015 Ga0495635_0000015_157145_157495 109
227 3300046675 Ga0495657_0000155 Ga0495657_0000155_6141_6491 109
228 3300046678 Ga0495599_0000029 Ga0495599_0000029_55605_55955 109
229 3300046679 Ga0495623_0000012 Ga0495623_0000012_37390_37740 109
230 3300046680 Ga0495646_0000006 Ga0495646_0000006_202547_202897 109
231 3300046683 Ga0495658_0338492 Ga0495658_0338492_66_416 109
232 3300046689 Ga0495613_0012194 Ga0495613_0012194_5101_5451 109
233 3300046690 Ga0495624_0014887 Ga0495624_0014887_4527_4877 109
234 3300046809 Ga0495600_0000081 Ga0495600_0000081_21058_21408 109
235 3300047315 Ga0495581_0001934 Ga0495581_0001934_6516_6866 109
236 3300047317 Ga0495604_0000091 Ga0495604_0000091_55672_56022 109
237 3300047319 Ga0495674_0000001 Ga0495674_0000001_512091_512441 109
238 3300047320 Ga0495672_0153136 Ga0495672_0153136_323_658 109
239 3300047321 Ga0495676_0249294 Ga0495676_0249294_715_1065 109
240 3300047322 Ga0495680_0001331 Ga0495680_0001331_21069_21419 109
241 3300047444 Ga0495675_0000113 Ga0495675_0000113_36751_37101 109
242 3300047471 Ga0495684_0000055 Ga0495684_0000055_21339_21689 109
243 3300047673 Ga0495593_0000990 Ga0495593_0000990_4149_4499 109
244 3300048088 Ga0495602_0000002 Ga0495602_0000002_55634_55984 109
245 3300048088 Ga0495602_0932037 Ga0495602_0932037_172_525 109
246 3300048905 Ga0496102_0259321 Ga0496102_0259321_339_680 109
247 3300048905 Ga0496102_0425603 Ga0496102_0425603_532_867 109
248 3300048907 Ga0496104_0148231 Ga0496104_0148231_801_1142 109
249 3300048909 Ga0496106_1335613 Ga0496106_1335613_135_476 109
250 3300048912 Ga0496109_0234485 Ga0496109_0234485_712_1053 109
251 3300048912 Ga0496109_1192752 Ga0496109_1192752_351_686 109
252 3300048913 Ga0496110_0225258 Ga0496110_0225258_316_657 109
253 3300048915 Ga0496112_0075069 Ga0496112_0075069_142_483 109
254 3300048915 Ga0496112_0876329 Ga0496112_0876329_471_806 109
255 3300048917 Ga0496114_0004545 Ga0496114_0004545_2264_2599 109
256 3300048918 Ga0496115_0354054 Ga0496115_0354054_103_438 109
257 3300049588 Ga0501072_0333895 Ga0501072_0333895_750_1079 109
258 3300049741 Ga0501079_0047501 Ga0501079_0047501_246_575 109
259 3300049824 Ga0501045_1063910 Ga0501045_1063910_204_533 109
260 3300050512 nmdc:mga0n895_266369_c1 nmdc:mga0n895_266369_c1_1059_1403 109
261 3300050515 nmdc:mga0a205_728394_c1 nmdc:mga0a205_728394_c1_202_546 109
262 3300053077 Ga0495601_0000006 Ga0495601_0000006_352141_352491 109
263 3300053078 Ga0495612_0000007 Ga0495612_0000007_37552_37902 109
264 3300053084 Ga0495595_0000051 Ga0495595_0000051_50199_50549 109
265 3300053084 Ga0495595_0574395 Ga0495595_0574395_175_510 109
266 3300053085 Ga0495619_0000027 Ga0495619_0000027_143399_143749 109
267 3300053085 Ga0495619_0579995 Ga0495619_0579995_310_645 109
268 3300061734 Ga0530510_0168227 Ga0530510_0168227_306_635 109
269 3300001976 JGI24752J21851_1048827 JGI24752J21851_10488272 110
270 3300001990 JGI24737J22298_10126440 JGI24737J22298_101264402 110
271 3300001991 JGI24743J22301_10028635 JGI24743J22301_100286352 110
272 3300002070 JGI24750J21931_1015787 JGI24750J21931_10157871 110
273 3300002075 JGI24738J21930_10083859 JGI24738J21930_100838591 110
274 3300003659 JGI25404J52841_10088525 JGI25404J52841_100885251 110
275 3300003911 JGI25405J52794_10020696 JGI25405J52794_100206962 110
276 3300005328 Ga0070676_10061128 Ga0070676_100611282 110
277 3300005329 Ga0070683_100808506 Ga0070683_1008085061 110
278 3300005330 Ga0070690_100524414 Ga0070690_1005244142 110
279 3300005331 Ga0070670_100006065 Ga0070670_1000060659 110
280 3300005331 Ga0070670_100099690 Ga0070670_1000996902 110
281 3300005334 Ga0068869_100043423 Ga0068869_1000434231 110
282 3300005337 Ga0070682_100415099 Ga0070682_1004150991 110
283 3300005338 Ga0068868_100528535 Ga0068868_1005285352 110
284 3300005339 Ga0070660_100643420 Ga0070660_1006434202 110
285 3300005341 Ga0070691_10034541 Ga0070691_100345413 110
286 3300005343 Ga0070687_100091255 Ga0070687_1000912552 110
287 3300005343 Ga0070687_100164163 Ga0070687_1001641631 110
288 3300005345 Ga0070692_10076173 Ga0070692_100761733 110
289 3300005347 Ga0070668_100176747 Ga0070668_1001767472 110
290 3300005353 Ga0070669_100078799 Ga0070669_1000787992 110
291 3300005354 Ga0070675_100616294 Ga0070675_1006162942 110
292 3300005355 Ga0070671_100307216 Ga0070671_1003072162 110
293 3300005356 Ga0070674_100122177 Ga0070674_1001221773 110
294 3300005364 Ga0070673_100678921 Ga0070673_1006789211 110
295 3300005365 Ga0070688_100092695 Ga0070688_1000926953 110
296 3300005366 Ga0070659_100105626 Ga0070659_1001056262 110
297 3300005367 Ga0070667_100028679 Ga0070667_1000286795 110
298 3300005367 Ga0070667_100790535 Ga0070667_1007905352 110
299 3300005435 Ga0070714_100043181 Ga0070714_1000431812 110
300 3300005435 Ga0070714_101564329 Ga0070714_1015643291 110
301 3300005436 Ga0070713_100043972 Ga0070713_1000439722 110
302 3300005436 Ga0070713_100136697 Ga0070713_1001366972 110
303 3300005437 Ga0070710_10016561 Ga0070710_100165614 110
304 3300005437 Ga0070710_10088851 Ga0070710_100888512 110
305 3300005437 Ga0070710_10270612 Ga0070710_102706122 110
306 3300005438 Ga0070701_10015207 Ga0070701_100152074 110
307 3300005439 Ga0070711_100010256 Ga0070711_1000102566 110
308 3300005439 Ga0070711_100135471 Ga0070711_1001354713 110
309 3300005439 Ga0070711_100320627 Ga0070711_1003206271 110
310 3300005439 Ga0070711_101857610 Ga0070711_1018576101 110
311 3300005441 Ga0070700_100016035 Ga0070700_1000160352 110
312 3300005444 Ga0070694_100172876 Ga0070694_1001728761 110
313 3300005444 Ga0070694_100209186 Ga0070694_1002091862 110
314 3300005445 Ga0070708_100338691 Ga0070708_1003386912 110
315 3300005456 Ga0070678_100071005 Ga0070678_1000710054 110
316 3300005457 Ga0070662_100018453 Ga0070662_1000184534 110
317 3300005457 Ga0070662_101340874 Ga0070662_1013408741 110
318 3300005459 Ga0068867_100026541 Ga0068867_1000265412 110
319 3300005466 Ga0070685_10400288 Ga0070685_104002882 110
320 3300005467 Ga0070706_100625975 Ga0070706_1006259752 110
321 3300005467 Ga0070706_101010710 Ga0070706_1010107102 110
322 3300005518 Ga0070699_100003835 Ga0070699_1000038352 110
323 3300005535 Ga0070684_100316243 Ga0070684_1003162431 110
324 3300005535 Ga0070684_100826829 Ga0070684_1008268292 110
325 3300005536 Ga0070697_101003233 Ga0070697_1010032332 110
326 3300005536 Ga0070697_101487948 Ga0070697_1014879481 110
327 3300005539 Ga0068853_101435594 Ga0068853_1014355942 110
328 3300005543 Ga0070672_100059208 Ga0070672_1000592083 110
329 3300005544 Ga0070686_100203823 Ga0070686_1002038231 110
330 3300005546 Ga0070696_100545893 Ga0070696_1005458932 110
331 3300005548 Ga0070665_100358778 Ga0070665_1003587782 110
332 3300005549 Ga0070704_100058330 Ga0070704_1000583303 110
333 3300005549 Ga0070704_100196352 Ga0070704_1001963522 110
334 3300005549 Ga0070704_100280070 Ga0070704_1002800701 110
335 3300005564 Ga0070664_100559888 Ga0070664_1005598882 110
336 3300005615 Ga0070702_100026311 Ga0070702_1000263112 110
337 3300005615 Ga0070702_101177261 Ga0070702_1011772611 110
338 3300005616 Ga0068852_100510313 Ga0068852_1005103132 110
339 3300005617 Ga0068859_100673676 Ga0068859_1006736762 110
340 3300005618 Ga0068864_100084294 Ga0068864_1000842942 110
341 3300005719 Ga0068861_100496336 Ga0068861_1004963361 110
342 3300005834 Ga0068851_10106126 Ga0068851_101061262 110
343 3300005840 Ga0068870_10117558 Ga0068870_101175582 110
344 3300005841 Ga0068863_100030734 Ga0068863_1000307344 110
345 3300005842 Ga0068858_100079754 Ga0068858_1000797544 110
346 3300005843 Ga0068860_100005826 Ga0068860_1000058263 110
347 3300005844 Ga0068862_100092258 Ga0068862_1000922583 110
348 3300005937 Ga0081455_10001050 Ga0081455_1000105021 110
349 3300005937 Ga0081455_10031856 Ga0081455_100318563 110
350 3300005937 Ga0081455_10036607 Ga0081455_100366075 110
351 3300005937 Ga0081455_10757094 Ga0081455_107570941 110
352 3300005981 Ga0081538_10016926 Ga0081538_100169265 110
353 3300005981 Ga0081538_10116180 Ga0081538_101161802 110
354 3300005983 Ga0081540_1008191 Ga0081540_10081917 110
355 3300006028 Ga0070717_10007808 Ga0070717_100078084 110
356 3300006028 Ga0070717_10082576 Ga0070717_100825762 110
357 3300006028 Ga0070717_10128140 Ga0070717_101281402 110
358 3300006028 Ga0070717_10367293 Ga0070717_103672932 110
359 3300006028 Ga0070717_11509956 Ga0070717_115099562 110
360 3300006038 Ga0075365_10036002 Ga0075365_100360023 110
361 3300006038 Ga0075365_10076788 Ga0075365_100767882 110
362 3300006038 Ga0075365_10266999 Ga0075365_102669992 110
363 3300006038 Ga0075365_10869090 Ga0075365_108690901 110
364 3300006038 Ga0075365_11076423 Ga0075365_110764231 110
365 3300006048 Ga0075363_100903323 Ga0075363_1009033231 110
366 3300006051 Ga0075364_10140744 Ga0075364_101407441 110
367 3300006163 Ga0070715_10001812 Ga0070715_100018128 110
368 3300006163 Ga0070715_10043541 Ga0070715_100435413 110
369 3300006163 Ga0070715_10598220 Ga0070715_105982202 110
370 3300006173 Ga0070716_100178179 Ga0070716_1001781791 110
371 3300006175 Ga0070712_100002532 Ga0070712_1000025327 110
372 3300006175 Ga0070712_100117576 Ga0070712_1001175762 110
373 3300006177 Ga0075362_10048763 Ga0075362_100487633 110
374 3300006178 Ga0075367_10138723 Ga0075367_101387232 110
375 3300006237 Ga0097621_100347890 Ga0097621_1003478902 110
376 3300006358 Ga0068871_100005812 Ga0068871_1000058127 110
377 3300006358 Ga0068871_100463965 Ga0068871_1004639652 110
378 3300006844 Ga0075428_100696028 Ga0075428_1006960282 110
379 3300006846 Ga0075430_100000039 Ga0075430_1000000393 110
380 3300006847 Ga0075431_100028614 Ga0075431_1000286142 110
381 3300006847 Ga0075431_100313239 Ga0075431_1003132392 110
382 3300006847 Ga0075431_100664210 Ga0075431_1006642101 110
383 3300006852 Ga0075433_10091548 Ga0075433_100915482 110
384 3300006871 Ga0075434_100020016 Ga0075434_1000200162 110
385 3300006871 Ga0075434_101643372 Ga0075434_1016433721 110
386 3300006880 Ga0075429_100295656 Ga0075429_1002956562 110
387 3300006881 Ga0068865_100323405 Ga0068865_1003234051 110
388 3300006914 Ga0075436_100172172 Ga0075436_1001721722 110
389 3300006931 Ga0097620_100673670 Ga0097620_1006736702 110
390 3300007076 Ga0075435_100229392 Ga0075435_1002293922 110
391 3300007076 Ga0075435_101350281 Ga0075435_1013502811 110
392 3300007076 Ga0075435_101383038 Ga0075435_1013830382 110
393 3300007265 Ga0099794_10027634 Ga0099794_100276342 110
394 3300009011 Ga0105251_10383070 Ga0105251_103830702 110
395 3300009092 Ga0105250_10185307 Ga0105250_101853071 110
396 3300009094 Ga0111539_10345688 Ga0111539_103456882 110
397 3300009094 Ga0111539_10413885 Ga0111539_104138852 110
398 3300009094 Ga0111539_10759691 Ga0111539_107596911 110
399 3300009094 Ga0111539_11514860 Ga0111539_115148602 110
400 3300009094 Ga0111539_12333532 Ga0111539_123335322 110
401 3300009098 Ga0105245_10020462 Ga0105245_100204624 110
402 3300009101 Ga0105247_10009951 Ga0105247_100099515 110
403 3300009101 Ga0105247_11321689 Ga0105247_113216891 110
404 3300009147 Ga0114129_10002765 Ga0114129_1000276522 110
405 3300009147 Ga0114129_10444493 Ga0114129_104444932 110
406 3300009147 Ga0114129_10622678 Ga0114129_106226782 110
407 3300009147 Ga0114129_10978388 Ga0114129_109783881 110
408 3300009148 Ga0105243_10043710 Ga0105243_100437102 110
409 3300009148 Ga0105243_10820117 Ga0105243_108201171 110
410 3300009176 Ga0105242_10084073 Ga0105242_100840732 110
411 3300009176 Ga0105242_12030499 Ga0105242_120304991 110
412 3300009177 Ga0105248_10763499 Ga0105248_107634991 110
413 3300009553 Ga0105249_10068118 Ga0105249_100681181 110
414 3300009553 Ga0105249_10693943 Ga0105249_106939432 110
415 3300010375 Ga0105239_10043720 Ga0105239_100437202 110
416 3300010375 Ga0105239_10127756 Ga0105239_101277561 110
417 3300011119 Ga0105246_10047575 Ga0105246_100475754 110
418 3300011119 Ga0105246_12502838 Ga0105246_125028382 110
419 3300013105 Ga0157369_11653364 Ga0157369_116533641 110
420 3300013296 Ga0157374_10052111 Ga0157374_100521113 110
421 3300013297 Ga0157378_10345717 Ga0157378_103457172 110
422 3300013306 Ga0163162_10970434 Ga0163162_109704342 110
423 3300013306 Ga0163162_11194776 Ga0163162_111947761 110
424 3300013308 Ga0157375_10135295 Ga0157375_101352953 110
425 3300014325 Ga0163163_10601423 Ga0163163_106014232 110
426 3300014325 Ga0163163_12323049 Ga0163163_123230492 110
427 3300014326 Ga0157380_12487736 Ga0157380_124877362 110
428 3300014745 Ga0157377_10324174 Ga0157377_103241741 110
429 3300014968 Ga0157379_10080414 Ga0157379_100804141 110
430 3300014969 Ga0157376_10809569 Ga0157376_108095692 110
431 3300017792 Ga0163161_10052402 Ga0163161_100524023 110
432 3300021361 Ga0213872_10082248 Ga0213872_100822482 110
433 3300021377 Ga0213874_10014735 Ga0213874_100147353 110
434 3300025315 Ga0207697_10084111 Ga0207697_100841111 110
435 3300025321 Ga0207656_10051821 Ga0207656_100518212 110
436 3300025900 Ga0207710_10009117 Ga0207710_100091172 110
437 3300025901 Ga0207688_10000528 Ga0207688_1000052814 110
438 3300025904 Ga0207647_10161748 Ga0207647_101617481 110
439 3300025905 Ga0207685_10015951 Ga0207685_100159514 110
440 3300025906 Ga0207699_10810008 Ga0207699_108100081 110
441 3300025910 Ga0207684_10018238 Ga0207684_100182382 110
442 3300025910 Ga0207684_10369160 Ga0207684_103691602 110
443 3300025911 Ga0207654_10569638 Ga0207654_105696381 110
444 3300025914 Ga0207671_10452173 Ga0207671_104521731 110
445 3300025915 Ga0207693_10004530 Ga0207693_100045306 110
446 3300025915 Ga0207693_10010765 Ga0207693_100107654 110
447 3300025915 Ga0207693_10045969 Ga0207693_100459692 110
448 3300025916 Ga0207663_10100684 Ga0207663_101006842 110
449 3300025916 Ga0207663_10193064 Ga0207663_101930642 110
450 3300025916 Ga0207663_10758700 Ga0207663_107587001 110
451 3300025918 Ga0207662_10024468 Ga0207662_100244683 110
452 3300025919 Ga0207657_10073936 Ga0207657_100739364 110
453 3300025920 Ga0207649_10148584 Ga0207649_101485842 110
454 3300025922 Ga0207646_10443594 Ga0207646_104435942 110
455 3300025925 Ga0207650_10002055 Ga0207650_100020553 110
456 3300025926 Ga0207659_10138330 Ga0207659_101383302 110
457 3300025928 Ga0207700_10032531 Ga0207700_100325314 110
458 3300025928 Ga0207700_10204810 Ga0207700_102048103 110
459 3300025928 Ga0207700_10220634 Ga0207700_102206343 110
460 3300025931 Ga0207644_10305312 Ga0207644_103053121 110
461 3300025931 Ga0207644_10370633 Ga0207644_103706331 110
462 3300025933 Ga0207706_10005066 Ga0207706_100050661 110
463 3300025933 Ga0207706_11031716 Ga0207706_110317162 110
464 3300025934 Ga0207686_10548648 Ga0207686_105486482 110
465 3300025935 Ga0207709_10228008 Ga0207709_102280082 110
466 3300025936 Ga0207670_10124786 Ga0207670_101247863 110
467 3300025937 Ga0207669_10610586 Ga0207669_106105862 110
468 3300025938 Ga0207704_10853766 Ga0207704_108537662 110
469 3300025939 Ga0207665_10002938 Ga0207665_1000293815 110
470 3300025940 Ga0207691_10011323 Ga0207691_100113234 110
471 3300025942 Ga0207689_10006443 Ga0207689_100064435 110
472 3300025944 Ga0207661_10433613 Ga0207661_104336132 110
473 3300025945 Ga0207679_10590121 Ga0207679_105901212 110
474 3300025961 Ga0207712_10056046 Ga0207712_100560462 110
475 3300025961 Ga0207712_10396083 Ga0207712_103960832 110
476 3300025972 Ga0207668_10090173 Ga0207668_100901731 110
477 3300025986 Ga0207658_10297954 Ga0207658_102979541 110
478 3300026023 Ga0207677_10866247 Ga0207677_108662472 110
479 3300026041 Ga0207639_10879180 Ga0207639_108791801 110
480 3300026067 Ga0207678_10022498 Ga0207678_100224981 110
481 3300026067 Ga0207678_10512161 Ga0207678_105121611 110
482 3300026075 Ga0207708_10024764 Ga0207708_100247644 110
483 3300026088 Ga0207641_10453756 Ga0207641_104537562 110
484 3300026089 Ga0207648_10023078 Ga0207648_100230783 110
485 3300026095 Ga0207676_10814658 Ga0207676_108146581 110
486 3300026095 Ga0207676_12562197 Ga0207676_125621971 110
487 3300026116 Ga0207674_10196776 Ga0207674_101967762 110
488 3300026118 Ga0207675_100017638 Ga0207675_1000176384 110
489 3300026121 Ga0207683_10091494 Ga0207683_100914942 110
490 3300026142 Ga0207698_10844744 Ga0207698_108447441 110
491 3300027907 Ga0207428_10039150 Ga0207428_100391502 110
492 3300028379 Ga0268266_10189851 Ga0268266_101898512 110
493 3300028380 Ga0268265_10250938 Ga0268265_102509382 110
494 3300028381 Ga0268264_11144026 Ga0268264_111440262 110
495 3300035112 Ga0373932_0019664 Ga0373932_0019664_164_496 110
496 3300035113 Ga0373936_0087368 Ga0373936_0087368_890_1222 110
497 3300035115 Ga0373941_0204683 Ga0373941_0204683_209_541 110
498 3300035116 Ga0373945_0019539 Ga0373945_0019539_891_1223 110
499 3300035116 Ga0373945_0020534 Ga0373945_0020534_1146_1478 110
500 3300035119 Ga0373956_0211162 Ga0373956_0211162_92_424 110
501 3300035170 Ga0373943_0224694 Ga0373943_0224694_638_1000 110
502 3300035691 Ga0373931_0154642 Ga0373931_0154642_132_494 110
503 3300035695 Ga0373927_0088057 Ga0373927_0088057_1585_1917 110
504 3300035695 Ga0373927_0296286 Ga0373927_0296286_429_791 110
505 3300035725 Ga0373947_0209273 Ga0373947_0209273_755_1087 110
506 3300037068 Ga0373925_0104160 Ga0373925_0104160_1709_2041 110
507 3300037068 Ga0373925_0373950 Ga0373925_0373950_428_760 110
508 3300037471 Ga0395905_0214941 Ga0395905_0214941_1332_1727 110
509 3300038443 Ga0395901_0479131 Ga0395901_0479131_558_953 110
510 3300039447 Ga0436361_0639384 Ga0436361_0639384_4758_5090 110
511 3300039450 Ga0436363_1532208 Ga0436363_1532208_1011_1343 110
512 3300041501 Ga0451845_0831721 Ga0451845_0831721_58_390 110
513 3300041512 Ga0451853_3488713 Ga0451853_3488713_85_423 110
514 3300046455 Ga0495603_0051374 Ga0495603_0051374_819_1151 110
515 3300046459 Ga0495629_0141734 Ga0495629_0141734_629_961 110
516 3300046461 Ga0495641_0041672 Ga0495641_0041672_1600_1932 110
517 3300046473 Ga0495582_0051730 Ga0495582_0051730_231_563 110
518 3300046474 Ga0495605_0452495 Ga0495605_0452495_138_470 110
519 3300046475 Ga0495639_0381869 Ga0495639_0381869_244_606 110
520 3300046491 Ga0495584_0117253 Ga0495584_0117253_73_405 110
521 3300046499 Ga0495594_0747733 Ga0495594_0747733_131_493 110
522 3300046514 Ga0495618_0278763 Ga0495618_0278763_373_705 110
523 3300046515 Ga0495620_0161149 Ga0495620_0161149_526_858 110
524 3300046517 Ga0495630_0349614 Ga0495630_0349614_312_644 110
525 3300046519 Ga0495632_0068499 Ga0495632_0068499_742_1074 110
526 3300046520 Ga0495637_0147662 Ga0495637_0147662_478_810 110
527 3300046528 Ga0495642_0194048 Ga0495642_0194048_221_553 110
528 3300046529 Ga0495652_0288669 Ga0495652_0288669_598_930 110
529 3300046537 Ga0495598_0051214 Ga0495598_0051214_694_1026 110
530 3300046538 Ga0495609_0273624 Ga0495609_0273624_39_371 110
531 3300046543 Ga0495645_0460547 Ga0495645_0460547_277_609 110
532 3300046557 Ga0495622_0096739 Ga0495622_0096739_579_911 110
533 3300046558 Ga0495633_0267895 Ga0495633_0267895_287_619 110
534 3300046559 Ga0495667_0583292 Ga0495667_0583292_104_436 110
535 3300046615 Ga0495656_0173484 Ga0495656_0173484_88_420 110
536 3300046616 Ga0495668_0129758 Ga0495668_0129758_541_873 110
537 3300046642 Ga0495634_0306084 Ga0495634_0306084_607_939 110
538 3300046663 Ga0495635_0692687 Ga0495635_0692687_243_575 110
539 3300046664 Ga0495659_0261827 Ga0495659_0261827_278_610 110
540 3300046674 Ga0495588_0772055 Ga0495588_0772055_122_484 110
541 3300046681 Ga0495647_0093683 Ga0495647_0093683_585_917 110
542 3300046681 Ga0495647_0162975 Ga0495647_0162975_92_424 110
543 3300046683 Ga0495658_0065237 Ga0495658_0065237_1237_1569 110
544 3300046683 Ga0495658_0089234 Ga0495658_0089234_322_654 110
545 3300046684 Ga0495669_0060058 Ga0495669_0060058_66_398 110
546 3300046689 Ga0495613_0124178 Ga0495613_0124178_782_1114 110
547 3300046689 Ga0495613_0466158 Ga0495613_0466158_54_386 110
548 3300046690 Ga0495624_0034557 Ga0495624_0034557_1776_2108 110
549 3300046690 Ga0495624_0427297 Ga0495624_0427297_289_621 110
550 3300046691 Ga0495670_0358020 Ga0495670_0358020_197_529 110
551 3300046692 Ga0495671_0250068 Ga0495671_0250068_190_522 110
552 3300046794 Ga0495589_0120418 Ga0495589_0120418_194_526 110
553 3300046810 Ga0495660_0140379 Ga0495660_0140379_420_752 110
554 3300047315 Ga0495581_0120374 Ga0495581_0120374_1178_1510 110
555 3300047319 Ga0495674_1264996 Ga0495674_1264996_194_526 110
556 3300047322 Ga0495680_0619742 Ga0495680_0619742_338_670 110
557 3300047445 Ga0495677_0210726 Ga0495677_0210726_52_384 110
558 3300047470 Ga0495681_0283853 Ga0495681_0283853_110_442 110
559 3300047673 Ga0495593_0420510 Ga0495593_0420510_224_556 110
560 3300048090 Ga0495615_0088278 Ga0495615_0088278_220_552 110
561 3300048903 Ga0496100_0069482 Ga0496100_0069482_739_1143 110
562 3300048904 Ga0496101_0012045 Ga0496101_0012045_2138_2470 110
563 3300048904 Ga0496101_0463044 Ga0496101_0463044_182_514 110
564 3300048905 Ga0496102_0020204 Ga0496102_0020204_1095_1427 110
565 3300048905 Ga0496102_0055176 Ga0496102_0055176_574_978 110
566 3300048905 Ga0496102_0160511 Ga0496102_0160511_1592_1924 110
567 3300048906 Ga0496103_0033206 Ga0496103_0033206_182_514 110
568 3300048906 Ga0496103_0137446 Ga0496103_0137446_50_454 110
569 3300048907 Ga0496104_0010954 Ga0496104_0010954_1375_1707 110
570 3300048908 Ga0496105_0025914 Ga0496105_0025914_3611_3943 110
571 3300048908 Ga0496105_0215875 Ga0496105_0215875_1038_1370 110
572 3300048909 Ga0496106_0023831 Ga0496106_0023831_637_969 110
573 3300048909 Ga0496106_0565967 Ga0496106_0565967_411_743 110
574 3300048909 Ga0496106_0644718 Ga0496106_0644718_137_541 110
575 3300048910 Ga0496107_0076503 Ga0496107_0076503_404_736 110
576 3300048910 Ga0496107_0447594 Ga0496107_0447594_88_492 110
577 3300048911 Ga0496108_0030831 Ga0496108_0030831_1611_1943 110
578 3300048911 Ga0496108_0241429 Ga0496108_0241429_518_850 110
579 3300048912 Ga0496109_0002836 Ga0496109_0002836_8848_9180 110
580 3300048912 Ga0496109_0784951 Ga0496109_0784951_518_850 110
581 3300048913 Ga0496110_0001434 Ga0496110_0001434_4515_4847 110
582 3300048913 Ga0496110_0286904 Ga0496110_0286904_126_530 110
583 3300048913 Ga0496110_0520041 Ga0496110_0520041_334_666 110
584 3300048913 Ga0496110_0827846 Ga0496110_0827846_339_671 110
585 3300048914 Ga0496111_0007669 Ga0496111_0007669_1423_1755 110
586 3300048914 Ga0496111_0057596 Ga0496111_0057596_1924_2256 110
587 3300048914 Ga0496111_0154954 Ga0496111_0154954_528_860 110
588 3300048914 Ga0496111_0404421 Ga0496111_0404421_126_530 110
589 3300048915 Ga0496112_0012499 Ga0496112_0012499_1159_1491 110
590 3300048916 Ga0496113_0000104 Ga0496113_0000104_13057_13389 110
591 3300048916 Ga0496113_0366825 Ga0496113_0366825_150_482 110
592 3300048917 Ga0496114_0100387 Ga0496114_0100387_1933_2295 110
593 3300048917 Ga0496114_0432591 Ga0496114_0432591_474_806 110
594 3300048917 Ga0496114_1038463 Ga0496114_1038463_299_631 110
595 3300048918 Ga0496115_0100820 Ga0496115_0100820_1690_2022 110
596 3300048918 Ga0496115_0301613 Ga0496115_0301613_606_1010 110
597 3300049568 Ga0501031_0257218 Ga0501031_0257218_522_854 110
598 3300049572 Ga0501036_1494659 Ga0501036_1494659_26_358 110
599 3300049575 Ga0501039_1112595 Ga0501039_1112595_28_366 110
600 3300049576 Ga0501040_0339248 Ga0501040_0339248_35_370 110
601 3300049577 Ga0501041_0299390 Ga0501041_0299390_511_843 110
602 3300049592 Ga0501076_1119386 Ga0501076_1119386_300_638 110
603 3300049743 Ga0501081_0827523 Ga0501081_0827523_330_662 110
604 3300049824 Ga0501045_0108584 Ga0501045_0108584_312_650 110
605 3300049824 Ga0501045_1129993 Ga0501045_1129993_217_549 110
606 3300050489 nmdc:mga03683_12738_c1 nmdc:mga03683_12738_c1_2464_2796 110
607 3300050489 nmdc:mga03683_45400_c1 nmdc:mga03683_45400_c1_93_431 110
608 3300050491 nmdc:mga00v17_388229_c1 nmdc:mga00v17_388229_c1_74_406 110
609 3300050492 nmdc:mga0yw44_1062210_c1 nmdc:mga0yw44_1062210_c1_68_400 110
610 3300050492 nmdc:mga0yw44_151434_c1 nmdc:mga0yw44_151434_c1_526_876 110
611 3300050492 nmdc:mga0yw44_80976_c1 nmdc:mga0yw44_80976_c1_1348_1680 110
612 3300050494 nmdc:mga06z11_595934_c1 nmdc:mga06z11_595934_c1_61_393 110
613 3300050496 nmdc:mga07m45_669211_c1 nmdc:mga07m45_669211_c1_219_551 110
614 3300050507 nmdc:mga05p37_1099605_c1 nmdc:mga05p37_1099605_c1_39_404 110
615 3300050507 nmdc:mga05p37_569007_c1 nmdc:mga05p37_569007_c1_652_984 110
616 3300050507 nmdc:mga05p37_6074_c1 nmdc:mga05p37_6074_c1_3659_3997 110
617 3300050508 nmdc:mga09592_1300430_c1 nmdc:mga09592_1300430_c1_245_586 110
618 3300050508 nmdc:mga09592_219979_c1 nmdc:mga09592_219979_c1_604_936 110
619 3300050508 nmdc:mga09592_794934_c1 nmdc:mga09592_794934_c1_198_530 110
620 3300050509 nmdc:mga0qj67_58_c1 nmdc:mga0qj67_58_c1_1325_1666 110
621 3300050510 nmdc:mga06r32_127399_c1 nmdc:mga06r32_127399_c1_2150_2488 110
622 3300050510 nmdc:mga06r32_327054_c1 nmdc:mga06r32_327054_c1_1163_1501 110
623 3300050511 nmdc:mga08y16_1156074_c1 nmdc:mga08y16_1156074_c1_179_520 110
624 3300050511 nmdc:mga08y16_261648_c1 nmdc:mga08y16_261648_c1_828_1193 110
625 3300050511 nmdc:mga08y16_55660_c1 nmdc:mga08y16_55660_c1_2524_2856 110
626 3300050511 nmdc:mga08y16_687704_c1 nmdc:mga08y16_687704_c1_329_661 110
627 3300050512 nmdc:mga0n895_54484_c1 nmdc:mga0n895_54484_c1_553_885 110
628 3300050513 nmdc:mga0rr50_1206659_c1 nmdc:mga0rr50_1206659_c1_186_518 110
629 3300050513 nmdc:mga0rr50_138991_c1 nmdc:mga0rr50_138991_c1_720_1124 110
630 3300050513 nmdc:mga0rr50_260982_c1 nmdc:mga0rr50_260982_c1_1038_1370 110
631 3300050513 nmdc:mga0rr50_422020_c1 nmdc:mga0rr50_422020_c1_110_442 110
632 3300050515 nmdc:mga0a205_308638_c1 nmdc:mga0a205_308638_c1_999_1331 110
633 3300050515 nmdc:mga0a205_852219_c1 nmdc:mga0a205_852219_c1_265_669 110
634 3300053077 Ga0495601_0056897 Ga0495601_0056897_1432_1764 110
635 3300053085 Ga0495619_0026800 Ga0495619_0026800_3013_3345 110
636 3300053085 Ga0495619_0363575 Ga0495619_0363575_571_903 110
637 3300054114 Ga0501084_0479025 Ga0501084_0479025_94_429 110
638 3300054114 Ga0501084_1368825 Ga0501084_1368825_134_469 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03091

CutA1

CutA1 divalent ion tolerance protein

29

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y6i-assembly1.cif.gz_B crystal structure of e.coli cuta1 e61v/c16a/c39a/c79a mutation 0.9645 3 104
1vhf-assembly1.cif.gz_A crystal structure of periplasmic divalent cation tolerance protein 0.9639 4 103
3ah6-assembly2.cif.gz_F remarkable improvement of the heat stability of cuta1 from e.coli by rational protein designing 0.9622 3 103
2nuh-assembly1.cif.gz_A crystal structure of cuta from the phytopathgen bacterium xylella fastidiosa 0.96 3 105
1osc-assembly1.cif.gz_B crystal structure of rat cuta1 at 2.15 a resolution 0.9595 3 105
ID Description Score Start End Superfamily
af_P69488_1_112_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9655 3 103 3.30.70.120
2nuhA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.96 3 105 3.30.70.120
1v99F00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9568 5 105 3.30.70.120
1xk8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9559 3 105 3.30.70.120
1p1lA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9559 4 105 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A0P8ABG3-F1-model_v4 Periplasmic divalent cation tolerance protein 0.9688 1 104 GO:0005507
GO:0010038
AF-A0A1W9QHH9-F1-model_v4 Divalent-cation tolerance protein CutA 0.9663 2 104 GO:0005507
GO:0010038
AF-A0A411H1J1-F1-model_v4 deleted 0.9658 3 103
AF-A0A2G4YLW0-F1-model_v4 Divalent-cation tolerance protein CutA 0.9658 3 104 GO:0005507
GO:0010038
AF-A0A3B0RU92-F1-model_v4 Periplasmic divalent cation tolerance protein CutA 0.9657 1 105 GO:0005507
GO:0010038

Feature Viewer

pLDDT pTM Quality
91.92 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map