F471509
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 638 | 332 | 638 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_12030499|Ga0105242_120304991 |
| Length | 134 |
| Sequence | LEYCRLAIEAQAVGGRARRRKGISMERAVFVYTTYPSVVEAERAGRALVEQRLCACVNILPGMISHYWWQGVLDRGEETVMIIKTRSSLTGPVSTAVKEMHSYATPAILVIPIESVDRDYLDWLMAETAPAAKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 123 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 187 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 215 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 216 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 217 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.06 |
| Metatranscriptomes | 0.94 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.66 |
| Nodule | 0 |
| Rhizoplane | 7.84 |
| Rhizosphere | 88.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1048827 | 3300001976 | Unclassified | 573 |
| 2 | JGI24737J22298_10126440 | 3300001990 | Bacteria | 755 |
| 3 | JGI24743J22301_10028635 | 3300001991 | Bacteria | 1091 |
| 4 | JGI24750J21931_1015787 | 3300002070 | Bacteria | 1022 |
| 5 | JGI24738J21930_10083859 | 3300002075 | Unclassified | 669 |
| 6 | JGI25404J52841_10088525 | 3300003659 | Bacteria | 647 |
| 7 | JGI25405J52794_10020696 | 3300003911 | Bacteria | 1326 |
| 8 | Ga0070676_10061128 | 3300005328 | Bacteria | 2239 |
| 9 | Ga0070676_10920784 | 3300005328 | Bacteria | 652 |
| 10 | Ga0070683_100808506 | 3300005329 | Bacteria | 899 |
| 11 | Ga0070690_100094769 | 3300005330 | Bacteria | 1970 |
| 12 | Ga0070690_100524414 | 3300005330 | Unclassified | 889 |
| 13 | Ga0070670_100006065 | 3300005331 | Bacteria | 10225 |
| 14 | Ga0070670_100009667 | 3300005331 | Bacteria | 8230 |
| 15 | Ga0070670_100099690 | 3300005331 | Bacteria | 2500 |
| 16 | Ga0070677_10402072 | 3300005333 | Bacteria | 722 |
| 17 | Ga0068869_100043423 | 3300005334 | Bacteria | 3228 |
| 18 | Ga0068869_100313588 | 3300005334 | Bacteria | 1270 |
| 19 | Ga0070682_100415099 | 3300005337 | Bacteria | 1021 |
| 20 | Ga0068868_100528535 | 3300005338 | Bacteria | 1037 |
| 21 | Ga0070660_100643420 | 3300005339 | Bacteria | 888 |
| 22 | Ga0070689_100029652 | 3300005340 | Bacteria | 4144 |
| 23 | Ga0070691_10034541 | 3300005341 | Bacteria | 2380 |
| 24 | Ga0070687_100091255 | 3300005343 | Bacteria | 1685 |
| 25 | Ga0070687_100164163 | 3300005343 | Bacteria | 1316 |
| 26 | Ga0070692_10076173 | 3300005345 | Bacteria | 1797 |
| 27 | Ga0070668_100176747 | 3300005347 | Bacteria | 1741 |
| 28 | Ga0070669_100078799 | 3300005353 | Bacteria | 2449 |
| 29 | Ga0070675_100613915 | 3300005354 | Bacteria | 987 |
| 30 | Ga0070675_100616294 | 3300005354 | Bacteria | 985 |
| 31 | Ga0070675_101064566 | 3300005354 | Bacteria | 743 |
| 32 | Ga0070671_100003913 | 3300005355 | Bacteria | 11715 |
| 33 | Ga0070671_100307216 | 3300005355 | Bacteria | 1351 |
| 34 | Ga0070671_100918418 | 3300005355 | Unclassified | 765 |
| 35 | Ga0070674_100122177 | 3300005356 | Bacteria | 1929 |
| 36 | Ga0070674_100422325 | 3300005356 | Bacteria | 1094 |
| 37 | Ga0070673_100003043 | 3300005364 | Bacteria | 10371 |
| 38 | Ga0070673_100678921 | 3300005364 | Bacteria | 945 |
| 39 | Ga0070673_101326518 | 3300005364 | Bacteria | 676 |
| 40 | Ga0070688_100092695 | 3300005365 | Bacteria | 1976 |
| 41 | Ga0070659_100105626 | 3300005366 | Bacteria | 2269 |
| 42 | Ga0070659_100227497 | 3300005366 | Bacteria | 1541 |
| 43 | Ga0070667_100028679 | 3300005367 | Bacteria | 4635 |
| 44 | Ga0070667_100790535 | 3300005367 | Bacteria | 881 |
| 45 | Ga0070709_10066528 | 3300005434 | Bacteria | 2312 |
| 46 | Ga0070709_10426590 | 3300005434 | Bacteria | 995 |
| 47 | Ga0070714_100043181 | 3300005435 | Bacteria | 3811 |
| 48 | Ga0070714_100691655 | 3300005435 | Bacteria | 983 |
| 49 | Ga0070714_101307985 | 3300005435 | Bacteria | 708 |
| 50 | Ga0070714_101410217 | 3300005435 | Bacteria | 680 |
| 51 | Ga0070714_101564329 | 3300005435 | Bacteria | 644 |
| 52 | Ga0070714_101671527 | 3300005435 | Bacteria | 622 |
| 53 | Ga0070714_102121020 | 3300005435 | Unclassified | 548 |
| 54 | Ga0070713_100043972 | 3300005436 | Bacteria | 3654 |
| 55 | Ga0070713_100136697 | 3300005436 | Bacteria | 2166 |
| 56 | Ga0070713_100627113 | 3300005436 | Bacteria | 1023 |
| 57 | Ga0070713_100710247 | 3300005436 | Unclassified | 960 |
| 58 | Ga0070710_10016561 | 3300005437 | Bacteria | 3754 |
| 59 | Ga0070710_10088851 | 3300005437 | Bacteria | 1819 |
| 60 | Ga0070710_10270612 | 3300005437 | Bacteria | 1098 |
| 61 | Ga0070710_10803775 | 3300005437 | Bacteria | 672 |
| 62 | Ga0070701_10015207 | 3300005438 | Bacteria | 3547 |
| 63 | Ga0070711_100010256 | 3300005439 | Bacteria | 5795 |
| 64 | Ga0070711_100075944 | 3300005439 | Bacteria | 2381 |
| 65 | Ga0070711_100135471 | 3300005439 | Bacteria | 1840 |
| 66 | Ga0070711_100320627 | 3300005439 | Bacteria | 1238 |
| 67 | Ga0070711_101502312 | 3300005439 | Unclassified | 588 |
| 68 | Ga0070711_101857610 | 3300005439 | Bacteria | 529 |
| 69 | Ga0070700_100016035 | 3300005441 | Bacteria | 4260 |
| 70 | Ga0070694_100172876 | 3300005444 | Bacteria | 1593 |
| 71 | Ga0070694_100209186 | 3300005444 | Bacteria | 1458 |
| 72 | Ga0070708_100338691 | 3300005445 | Bacteria | 1417 |
| 73 | Ga0070678_100071005 | 3300005456 | Bacteria | 2605 |
| 74 | Ga0070678_100867894 | 3300005456 | Bacteria | 823 |
| 75 | Ga0070662_100018453 | 3300005457 | Bacteria | 4719 |
| 76 | Ga0070662_100994181 | 3300005457 | Bacteria | 718 |
| 77 | Ga0070662_101340874 | 3300005457 | Bacteria | 616 |
| 78 | Ga0068867_100026541 | 3300005459 | Bacteria | 4159 |
| 79 | Ga0070685_10400288 | 3300005466 | Bacteria | 951 |
| 80 | Ga0070706_100625975 | 3300005467 | Bacteria | 999 |
| 81 | Ga0070706_101010710 | 3300005467 | Unclassified | 767 |
| 82 | Ga0070699_100003835 | 3300005518 | Bacteria | 13283 |
| 83 | Ga0070684_100316243 | 3300005535 | Bacteria | 1434 |
| 84 | Ga0070684_100826829 | 3300005535 | Bacteria | 866 |
| 85 | Ga0070697_101003233 | 3300005536 | Bacteria | 742 |
| 86 | Ga0070697_101487948 | 3300005536 | Bacteria | 605 |
| 87 | Ga0068853_101435594 | 3300005539 | Bacteria | 668 |
| 88 | Ga0070672_100059208 | 3300005543 | Bacteria | 3013 |
| 89 | Ga0070686_100203823 | 3300005544 | Bacteria | 1420 |
| 90 | Ga0070695_100252182 | 3300005545 | Bacteria | 1285 |
| 91 | Ga0070696_100545893 | 3300005546 | Bacteria | 928 |
| 92 | Ga0070665_100358778 | 3300005548 | Bacteria | 1463 |
| 93 | Ga0070704_100058330 | 3300005549 | Bacteria | 2749 |
| 94 | Ga0070704_100196352 | 3300005549 | Bacteria | 1626 |
| 95 | Ga0070704_100280070 | 3300005549 | Bacteria | 1381 |
| 96 | Ga0070704_101519474 | 3300005549 | Bacteria | 616 |
| 97 | Ga0070664_100559888 | 3300005564 | Bacteria | 1058 |
| 98 | Ga0068854_102053911 | 3300005578 | Unclassified | 527 |
| 99 | Ga0068856_100519709 | 3300005614 | Bacteria | 1212 |
| 100 | Ga0070702_100026311 | 3300005615 | Bacteria | 3125 |
| 101 | Ga0070702_100928869 | 3300005615 | Bacteria | 683 |
| 102 | Ga0070702_101177261 | 3300005615 | Unclassified | 617 |
| 103 | Ga0068852_100510313 | 3300005616 | Bacteria | 1198 |
| 104 | Ga0068859_100673676 | 3300005617 | Bacteria | 1126 |
| 105 | Ga0068864_100084294 | 3300005618 | Bacteria | 2792 |
| 106 | Ga0068861_100114323 | 3300005719 | Bacteria | 2167 |
| 107 | Ga0068861_100496336 | 3300005719 | Bacteria | 1102 |
| 108 | Ga0068851_10106126 | 3300005834 | Bacteria | 1495 |
| 109 | Ga0068870_10117558 | 3300005840 | Bacteria | 1527 |
| 110 | Ga0068863_100030734 | 3300005841 | Bacteria | 5128 |
| 111 | Ga0068858_100035884 | 3300005842 | Bacteria | 4598 |
| 112 | Ga0068858_100079754 | 3300005842 | Bacteria | 3041 |
| 113 | Ga0068860_100005826 | 3300005843 | Bacteria | 12405 |
| 114 | Ga0068862_100092258 | 3300005844 | Bacteria | 2640 |
| 115 | Ga0081455_10001050 | 3300005937 | Bacteria | 34770 |
| 116 | Ga0081455_10031856 | 3300005937 | Bacteria | 4761 |
| 117 | Ga0081455_10036607 | 3300005937 | Bacteria | 4367 |
| 118 | Ga0081455_10757094 | 3300005937 | Bacteria | 613 |
| 119 | Ga0081538_10016926 | 3300005981 | Bacteria | 5561 |
| 120 | Ga0081538_10116180 | 3300005981 | Bacteria | 1299 |
| 121 | Ga0081540_1008191 | 3300005983 | Bacteria | 7321 |
| 122 | Ga0070717_10007808 | 3300006028 | Bacteria | 7960 |
| 123 | Ga0070717_10056132 | 3300006028 | Bacteria | 3253 |
| 124 | Ga0070717_10082576 | 3300006028 | Bacteria | 2701 |
| 125 | Ga0070717_10092317 | 3300006028 | Bacteria | 2558 |
| 126 | Ga0070717_10128140 | 3300006028 | Bacteria | 2180 |
| 127 | Ga0070717_10367293 | 3300006028 | Bacteria | 1289 |
| 128 | Ga0070717_10402023 | 3300006028 | Bacteria | 1231 |
| 129 | Ga0070717_11509956 | 3300006028 | Unclassified | 609 |
| 130 | Ga0075365_10036002 | 3300006038 | Bacteria | 3206 |
| 131 | Ga0075365_10076788 | 3300006038 | Bacteria | 2256 |
| 132 | Ga0075365_10266999 | 3300006038 | Bacteria | 1203 |
| 133 | Ga0075365_10869090 | 3300006038 | Bacteria | 636 |
| 134 | Ga0075365_11076423 | 3300006038 | Bacteria | 566 |
| 135 | Ga0075363_100903323 | 3300006048 | Unclassified | 541 |
| 136 | Ga0075364_10140744 | 3300006051 | Bacteria | 1623 |
| 137 | Ga0070715_10001812 | 3300006163 | Bacteria | 6372 |
| 138 | Ga0070715_10043541 | 3300006163 | Bacteria | 1893 |
| 139 | Ga0070715_10598220 | 3300006163 | Bacteria | 646 |
| 140 | Ga0070716_100178179 | 3300006173 | Bacteria | 1393 |
| 141 | Ga0070716_100202019 | 3300006173 | Bacteria | 1322 |
| 142 | Ga0070716_100803925 | 3300006173 | Bacteria | 728 |
| 143 | Ga0070716_100843629 | 3300006173 | Bacteria | 713 |
| 144 | Ga0070712_100002532 | 3300006175 | Bacteria | 11286 |
| 145 | Ga0070712_100117576 | 3300006175 | Bacteria | 1995 |
| 146 | Ga0070712_100193994 | 3300006175 | Bacteria | 1591 |
| 147 | Ga0070712_101519877 | 3300006175 | Unclassified | 585 |
| 148 | Ga0075362_10048763 | 3300006177 | Bacteria | 1890 |
| 149 | Ga0075367_10138723 | 3300006178 | Bacteria | 1505 |
| 150 | Ga0097621_100025691 | 3300006237 | Bacteria | 4610 |
| 151 | Ga0097621_100347890 | 3300006237 | Bacteria | 1317 |
| 152 | Ga0068871_100005812 | 3300006358 | Bacteria | 8667 |
| 153 | Ga0068871_100463965 | 3300006358 | Bacteria | 1137 |
| 154 | Ga0075428_100696028 | 3300006844 | Bacteria | 1083 |
| 155 | Ga0075430_100000039 | 3300006846 | Bacteria | 68229 |
| 156 | Ga0075431_100028614 | 3300006847 | Bacteria | 5728 |
| 157 | Ga0075431_100313239 | 3300006847 | Bacteria | 1584 |
| 158 | Ga0075431_100664210 | 3300006847 | Bacteria | 1022 |
| 159 | Ga0075433_10091548 | 3300006852 | Bacteria | 2689 |
| 160 | Ga0075433_10321892 | 3300006852 | Bacteria | 1368 |
| 161 | Ga0075434_100020016 | 3300006871 | Bacteria | 6482 |
| 162 | Ga0075434_100276677 | 3300006871 | Bacteria | 1698 |
| 163 | Ga0075434_101643372 | 3300006871 | Bacteria | 651 |
| 164 | Ga0075429_100295656 | 3300006880 | Bacteria | 1418 |
| 165 | Ga0068865_100323405 | 3300006881 | Bacteria | 1241 |
| 166 | Ga0068865_100596214 | 3300006881 | Bacteria | 933 |
| 167 | Ga0075436_100172172 | 3300006914 | Bacteria | 1529 |
| 168 | Ga0097620_100673670 | 3300006931 | Bacteria | 1126 |
| 169 | Ga0075435_100229392 | 3300007076 | Unclassified | 1577 |
| 170 | Ga0075435_101350281 | 3300007076 | Bacteria | 624 |
| 171 | Ga0075435_101383038 | 3300007076 | Bacteria | 617 |
| 172 | Ga0099794_10027634 | 3300007265 | Bacteria | 2632 |
| 173 | Ga0099795_10001705 | 3300007788 | Bacteria | 4889 |
| 174 | Ga0099795_10120224 | 3300007788 | Bacteria | 1049 |
| 175 | Ga0105251_10383070 | 3300009011 | Unclassified | 645 |
| 176 | Ga0105250_10185307 | 3300009092 | Bacteria | 874 |
| 177 | Ga0111539_10058430 | 3300009094 | Bacteria | 4576 |
| 178 | Ga0111539_10345688 | 3300009094 | Bacteria | 1731 |
| 179 | Ga0111539_10413885 | 3300009094 | Bacteria | 1570 |
| 180 | Ga0111539_10759691 | 3300009094 | Bacteria | 1128 |
| 181 | Ga0111539_11514860 | 3300009094 | Bacteria | 778 |
| 182 | Ga0111539_12333532 | 3300009094 | Bacteria | 621 |
| 183 | Ga0105245_10003663 | 3300009098 | Bacteria | 13721 |
| 184 | Ga0105245_10020462 | 3300009098 | Bacteria | 5804 |
| 185 | Ga0105245_10064297 | 3300009098 | Bacteria | 3315 |
| 186 | Ga0105245_11111932 | 3300009098 | Unclassified | 837 |
| 187 | Ga0105245_11933016 | 3300009098 | Bacteria | 643 |
| 188 | Ga0105247_10009951 | 3300009101 | Bacteria | 5759 |
| 189 | Ga0105247_10334935 | 3300009101 | Bacteria | 1060 |
| 190 | Ga0105247_10921349 | 3300009101 | Bacteria | 676 |
| 191 | Ga0105247_11321689 | 3300009101 | Bacteria | 580 |
| 192 | Ga0114129_10002765 | 3300009147 | Bacteria | 24439 |
| 193 | Ga0114129_10444493 | 3300009147 | Bacteria | 1701 |
| 194 | Ga0114129_10622678 | 3300009147 | Bacteria | 1396 |
| 195 | Ga0114129_10978388 | 3300009147 | Bacteria | 1067 |
| 196 | Ga0114129_12389429 | 3300009147 | Bacteria | 633 |
| 197 | Ga0105243_10043710 | 3300009148 | Bacteria | 3511 |
| 198 | Ga0105243_10047260 | 3300009148 | Bacteria | 3387 |
| 199 | Ga0105243_10469776 | 3300009148 | Unclassified | 1185 |
| 200 | Ga0105243_10820117 | 3300009148 | Bacteria | 919 |
| 201 | Ga0105241_11212192 | 3300009174 | Bacteria | 715 |
| 202 | Ga0105242_10084073 | 3300009176 | Bacteria | 2666 |
| 203 | Ga0105242_10893987 | 3300009176 | Unclassified | 887 |
| 204 | Ga0105242_12030499 | 3300009176 | Bacteria | 618 |
| 205 | Ga0105242_12875067 | 3300009176 | Unclassified | 532 |
| 206 | Ga0105248_10091528 | 3300009177 | Bacteria | 3425 |
| 207 | Ga0105248_10763499 | 3300009177 | Bacteria | 1091 |
| 208 | Ga0105249_10068118 | 3300009553 | Bacteria | 3281 |
| 209 | Ga0105249_10693943 | 3300009553 | Bacteria | 1078 |
| 210 | Ga0099796_10002657 | 3300010159 | Bacteria | 3977 |
| 211 | Ga0105239_10043720 | 3300010375 | Bacteria | 4912 |
| 212 | Ga0105239_10127756 | 3300010375 | Bacteria | 2826 |
| 213 | Ga0105239_11403724 | 3300010375 | Bacteria | 806 |
| 214 | Ga0105246_10047575 | 3300011119 | Bacteria | 2930 |
| 215 | Ga0105246_10097416 | 3300011119 | Bacteria | 2134 |
| 216 | Ga0105246_10158672 | 3300011119 | Bacteria | 1721 |
| 217 | Ga0105246_12502838 | 3300011119 | Bacteria | 508 |
| 218 | Ga0157369_11653364 | 3300013105 | Unclassified | 651 |
| 219 | Ga0157374_10052111 | 3300013296 | Bacteria | 3810 |
| 220 | Ga0157374_10123817 | 3300013296 | Unclassified | 2497 |
| 221 | Ga0157374_10757708 | 3300013296 | Bacteria | 986 |
| 222 | Ga0157378_10345717 | 3300013297 | Bacteria | 1452 |
| 223 | Ga0163162_10970434 | 3300013306 | Bacteria | 960 |
| 224 | Ga0163162_11194776 | 3300013306 | Bacteria | 863 |
| 225 | Ga0163162_11347829 | 3300013306 | Bacteria | 811 |
| 226 | Ga0157375_10135295 | 3300013308 | Bacteria | 2587 |
| 227 | Ga0163163_10081068 | 3300014325 | Bacteria | 3246 |
| 228 | Ga0163163_10601423 | 3300014325 | Bacteria | 1163 |
| 229 | Ga0163163_12323049 | 3300014325 | Bacteria | 595 |
| 230 | Ga0157380_10307389 | 3300014326 | Bacteria | 1463 |
| 231 | Ga0157380_12487736 | 3300014326 | Unclassified | 583 |
| 232 | Ga0157377_10324174 | 3300014745 | Bacteria | 1024 |
| 233 | Ga0157379_10080414 | 3300014968 | Bacteria | 2919 |
| 234 | Ga0157376_10809569 | 3300014969 | Bacteria | 950 |
| 235 | Ga0157376_11755973 | 3300014969 | Unclassified | 656 |
| 236 | Ga0163161_10052402 | 3300017792 | Bacteria | 2957 |
| 237 | Ga0213872_10082248 | 3300021361 | Bacteria | 1446 |
| 238 | Ga0213874_10014735 | 3300021377 | Bacteria | 2050 |
| 239 | Ga0213876_10216793 | 3300021384 | Bacteria | 1018 |
| 240 | Ga0224572_1036531 | 3300024225 | Bacteria | 931 |
| 241 | Ga0228598_1000228 | 3300024227 | Bacteria | 10658 |
| 242 | Ga0228598_1017155 | 3300024227 | Bacteria | 1428 |
| 243 | Ga0207697_10084111 | 3300025315 | Bacteria | 1343 |
| 244 | Ga0207656_10051821 | 3300025321 | Bacteria | 1775 |
| 245 | Ga0207692_11214296 | 3300025898 | Bacteria | 501 |
| 246 | Ga0207710_10009117 | 3300025900 | Bacteria | 4176 |
| 247 | Ga0207688_10000528 | 3300025901 | Bacteria | 18519 |
| 248 | Ga0207680_10176044 | 3300025903 | Bacteria | 1444 |
| 249 | Ga0207647_10161748 | 3300025904 | Bacteria | 1306 |
| 250 | Ga0207685_10015951 | 3300025905 | Bacteria | 2393 |
| 251 | Ga0207699_10087816 | 3300025906 | Bacteria | 1945 |
| 252 | Ga0207699_10689668 | 3300025906 | Bacteria | 747 |
| 253 | Ga0207699_10810008 | 3300025906 | Bacteria | 689 |
| 254 | Ga0207684_10018238 | 3300025910 | Bacteria | 6010 |
| 255 | Ga0207684_10369160 | 3300025910 | Bacteria | 1235 |
| 256 | Ga0207654_10569638 | 3300025911 | Bacteria | 806 |
| 257 | Ga0207671_10452173 | 3300025914 | Bacteria | 1023 |
| 258 | Ga0207693_10004530 | 3300025915 | Bacteria | 11744 |
| 259 | Ga0207693_10010765 | 3300025915 | Bacteria | 7426 |
| 260 | Ga0207693_10045969 | 3300025915 | Bacteria | 3430 |
| 261 | Ga0207693_10145733 | 3300025915 | Bacteria | 1862 |
| 262 | Ga0207693_10218530 | 3300025915 | Bacteria | 1497 |
| 263 | Ga0207663_10100684 | 3300025916 | Bacteria | 1940 |
| 264 | Ga0207663_10193064 | 3300025916 | Bacteria | 1463 |
| 265 | Ga0207663_10758700 | 3300025916 | Bacteria | 771 |
| 266 | Ga0207663_11311183 | 3300025916 | Unclassified | 583 |
| 267 | Ga0207662_10024468 | 3300025918 | Bacteria | 3474 |
| 268 | Ga0207657_10073936 | 3300025919 | Bacteria | 2879 |
| 269 | Ga0207649_10148584 | 3300025920 | Bacteria | 1611 |
| 270 | Ga0207646_10443594 | 3300025922 | Bacteria | 1171 |
| 271 | Ga0207681_10104561 | 3300025923 | Bacteria | 2049 |
| 272 | Ga0207650_10002055 | 3300025925 | Bacteria | 14070 |
| 273 | Ga0207650_10035565 | 3300025925 | Bacteria | 3618 |
| 274 | Ga0207659_10138330 | 3300025926 | Bacteria | 1888 |
| 275 | Ga0207659_10952127 | 3300025926 | Bacteria | 738 |
| 276 | Ga0207659_11488751 | 3300025926 | Unclassified | 579 |
| 277 | Ga0207687_10304804 | 3300025927 | Bacteria | 1284 |
| 278 | Ga0207700_10032531 | 3300025928 | Bacteria | 3721 |
| 279 | Ga0207700_10204810 | 3300025928 | Bacteria | 1664 |
| 280 | Ga0207700_10220634 | 3300025928 | Bacteria | 1607 |
| 281 | Ga0207700_10253925 | 3300025928 | Bacteria | 1503 |
| 282 | Ga0207664_10421146 | 3300025929 | Bacteria | 1189 |
| 283 | Ga0207664_10940083 | 3300025929 | Unclassified | 776 |
| 284 | Ga0207644_10016666 | 3300025931 | Bacteria | 4947 |
| 285 | Ga0207644_10305312 | 3300025931 | Bacteria | 1283 |
| 286 | Ga0207644_10370633 | 3300025931 | Bacteria | 1166 |
| 287 | Ga0207690_11027122 | 3300025932 | Bacteria | 686 |
| 288 | Ga0207706_10005066 | 3300025933 | Bacteria | 12302 |
| 289 | Ga0207706_11031716 | 3300025933 | Bacteria | 690 |
| 290 | Ga0207686_10526657 | 3300025934 | Bacteria | 921 |
| 291 | Ga0207686_10548648 | 3300025934 | Bacteria | 903 |
| 292 | Ga0207709_10228008 | 3300025935 | Bacteria | 1348 |
| 293 | Ga0207670_10030515 | 3300025936 | Bacteria | 3444 |
| 294 | Ga0207670_10124786 | 3300025936 | Bacteria | 1877 |
| 295 | Ga0207669_10610586 | 3300025937 | Unclassified | 887 |
| 296 | Ga0207704_10853766 | 3300025938 | Bacteria | 763 |
| 297 | Ga0207665_10002938 | 3300025939 | Bacteria | 11417 |
| 298 | Ga0207665_10601333 | 3300025939 | Bacteria | 859 |
| 299 | Ga0207691_10011323 | 3300025940 | Bacteria | 8558 |
| 300 | Ga0207691_10163271 | 3300025940 | Bacteria | 1953 |
| 301 | Ga0207689_10006443 | 3300025942 | Bacteria | 10381 |
| 302 | Ga0207661_10433613 | 3300025944 | Bacteria | 1195 |
| 303 | Ga0207679_10590121 | 3300025945 | Bacteria | 1000 |
| 304 | Ga0207712_10056046 | 3300025961 | Bacteria | 2776 |
| 305 | Ga0207712_10396083 | 3300025961 | Bacteria | 1159 |
| 306 | Ga0207668_10090173 | 3300025972 | Bacteria | 2249 |
| 307 | Ga0207640_11831007 | 3300025981 | Unclassified | 549 |
| 308 | Ga0207658_10297954 | 3300025986 | Bacteria | 1388 |
| 309 | Ga0207677_10866247 | 3300026023 | Unclassified | 812 |
| 310 | Ga0207703_10660860 | 3300026035 | Bacteria | 992 |
| 311 | Ga0207639_10879180 | 3300026041 | Bacteria | 837 |
| 312 | Ga0207639_11577870 | 3300026041 | Unclassified | 616 |
| 313 | Ga0207678_10022498 | 3300026067 | Bacteria | 5520 |
| 314 | Ga0207678_10512161 | 3300026067 | Bacteria | 1047 |
| 315 | Ga0207708_10024764 | 3300026075 | Bacteria | 4540 |
| 316 | Ga0207641_10453756 | 3300026088 | Bacteria | 1239 |
| 317 | Ga0207648_10023078 | 3300026089 | Bacteria | 5580 |
| 318 | Ga0207676_10814658 | 3300026095 | Bacteria | 911 |
| 319 | Ga0207676_12562197 | 3300026095 | Unclassified | 506 |
| 320 | Ga0207674_10196776 | 3300026116 | Bacteria | 1965 |
| 321 | Ga0207675_100017638 | 3300026118 | Bacteria | 6658 |
| 322 | Ga0207675_100214759 | 3300026118 | Bacteria | 1852 |
| 323 | Ga0207683_10091494 | 3300026121 | Bacteria | 2710 |
| 324 | Ga0207683_12080914 | 3300026121 | Unclassified | 516 |
| 325 | Ga0207698_10844744 | 3300026142 | Bacteria | 920 |
| 326 | Ga0209179_1003699 | 3300027512 | Bacteria | 2233 |
| 327 | Ga0207428_10039150 | 3300027907 | Bacteria | 3848 |
| 328 | Ga0268266_10189851 | 3300028379 | Bacteria | 1875 |
| 329 | Ga0268265_10250938 | 3300028380 | Bacteria | 1567 |
| 330 | Ga0268264_11144026 | 3300028381 | Unclassified | 787 |
| 331 | Ga0265763_1020462 | 3300030763 | Bacteria | 692 |
| 332 | Ga0265770_1027491 | 3300030878 | Bacteria | 936 |
| 333 | Ga0265773_1002977 | 3300031018 | Bacteria | 1076 |
| 334 | Ga0265760_10023618 | 3300031090 | Bacteria | 1787 |
| 335 | Ga0265760_10054588 | 3300031090 | Bacteria | 1207 |
| 336 | Ga0265760_10387492 | 3300031090 | Unclassified | 503 |
| 337 | Ga0373926_0019891 | 3300035083 | Bacteria | 2317 |
| 338 | Ga0373934_0208864 | 3300035086 | Bacteria | 804 |
| 339 | Ga0373944_0057696 | 3300035089 | Bacteria | 1238 |
| 340 | Ga0373952_0300650 | 3300035092 | Unclassified | 500 |
| 341 | Ga0373923_0000479 | 3300035111 | Bacteria | 9559 |
| 342 | Ga0373932_0019664 | 3300035112 | Bacteria | 1763 |
| 343 | Ga0373936_0006290 | 3300035113 | Bacteria | 4477 |
| 344 | Ga0373936_0087368 | 3300035113 | Bacteria | 1304 |
| 345 | Ga0373941_0204683 | 3300035115 | Unclassified | 752 |
| 346 | Ga0373945_0019539 | 3300035116 | Bacteria | 2314 |
| 347 | Ga0373945_0020534 | 3300035116 | Bacteria | 2262 |
| 348 | Ga0373953_0006080 | 3300035117 | Bacteria | 3958 |
| 349 | Ga0373953_0020404 | 3300035117 | Bacteria | 2476 |
| 350 | Ga0373954_0013416 | 3300035118 | Bacteria | 3651 |
| 351 | Ga0373954_0029261 | 3300035118 | Bacteria | 2536 |
| 352 | Ga0373956_0063464 | 3300035119 | Bacteria | 1675 |
| 353 | Ga0373956_0211162 | 3300035119 | Bacteria | 921 |
| 354 | Ga0373956_0246313 | 3300035119 | Bacteria | 849 |
| 355 | Ga0373957_0051167 | 3300035120 | Bacteria | 1580 |
| 356 | Ga0373943_0063037 | 3300035170 | Bacteria | 1857 |
| 357 | Ga0373943_0145805 | 3300035170 | Bacteria | 1279 |
| 358 | Ga0373943_0224694 | 3300035170 | Bacteria | 1047 |
| 359 | Ga0373946_0028163 | 3300035171 | Bacteria | 2227 |
| 360 | Ga0373946_0041761 | 3300035171 | Bacteria | 1882 |
| 361 | Ga0373955_0001971 | 3300035172 | Bacteria | 8840 |
| 362 | Ga0373924_0000313 | 3300035410 | Bacteria | 14908 |
| 363 | Ga0373924_0032081 | 3300035410 | Bacteria | 2115 |
| 364 | Ga0373931_0154642 | 3300035691 | Bacteria | 1340 |
| 365 | Ga0373935_0000756 | 3300035692 | Bacteria | 17208 |
| 366 | Ga0373935_0042672 | 3300035692 | Bacteria | 2853 |
| 367 | Ga0373927_0004701 | 3300035695 | Bacteria | 9519 |
| 368 | Ga0373927_0027458 | 3300035695 | Bacteria | 3716 |
| 369 | Ga0373927_0088057 | 3300035695 | Bacteria | 2015 |
| 370 | Ga0373927_0296286 | 3300035695 | Bacteria | 1064 |
| 371 | Ga0373927_0525610 | 3300035695 | Bacteria | 782 |
| 372 | Ga0373927_0713734 | 3300035695 | Bacteria | 662 |
| 373 | Ga0373933_0001225 | 3300035724 | Bacteria | 15180 |
| 374 | Ga0373933_0391716 | 3300035724 | Bacteria | 906 |
| 375 | Ga0373947_0017026 | 3300035725 | Bacteria | 4178 |
| 376 | Ga0373947_0209273 | 3300035725 | Bacteria | 1279 |
| 377 | Ga0373937_0000271 | 3300036401 | Bacteria | 49749 |
| 378 | Ga0373937_0001973 | 3300036401 | Bacteria | 17162 |
| 379 | Ga0373925_0000557 | 3300037068 | Bacteria | 36526 |
| 380 | Ga0373925_0104160 | 3300037068 | Bacteria | 2184 |
| 381 | Ga0373925_0373950 | 3300037068 | Bacteria | 1160 |
| 382 | Ga0395905_0214941 | 3300037471 | Bacteria | 1801 |
| 383 | Ga0436364_1268188 | 3300037853 | Unclassified | 548 |
| 384 | Ga0395901_0479131 | 3300038443 | Bacteria | 1269 |
| 385 | Ga0436365_1702936 | 3300039437 | Bacteria | 1130 |
| 386 | Ga0436361_0639384 | 3300039447 | Bacteria | 11225 |
| 387 | Ga0436363_1532208 | 3300039450 | Bacteria | 2124 |
| 388 | Ga0451845_0831721 | 3300041501 | Unclassified | 554 |
| 389 | Ga0451853_3488713 | 3300041512 | Bacteria | 538 |
| 390 | Ga0466963_0042249 | 3300044694 | Bacteria | 2993 |
| 391 | Ga0466968_0237339 | 3300044735 | Bacteria | 863 |
| 392 | Ga0466968_0444356 | 3300044735 | Bacteria | 640 |
| 393 | Ga0466967_0251728 | 3300045976 | Bacteria | 1688 |
| 394 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 395 | Ga0495592_0004076 | 3300046454 | Bacteria | 10624 |
| 396 | Ga0495603_0051374 | 3300046455 | Bacteria | 2450 |
| 397 | Ga0495603_0383388 | 3300046455 | Bacteria | 806 |
| 398 | Ga0495629_0001945 | 3300046459 | Bacteria | 16099 |
| 399 | Ga0495629_0036846 | 3300046459 | Bacteria | 3450 |
| 400 | Ga0495629_0141734 | 3300046459 | Bacteria | 1672 |
| 401 | Ga0495641_0041672 | 3300046461 | Bacteria | 2132 |
| 402 | Ga0495641_0185015 | 3300046461 | Bacteria | 933 |
| 403 | Ga0495651_0000596 | 3300046462 | Bacteria | 27994 |
| 404 | Ga0495651_0001437 | 3300046462 | Bacteria | 18451 |
| 405 | Ga0495651_0528729 | 3300046462 | Unclassified | 752 |
| 406 | Ga0495653_0000092 | 3300046463 | Bacteria | 74868 |
| 407 | Ga0495653_0017442 | 3300046463 | Bacteria | 5839 |
| 408 | Ga0495582_0018977 | 3300046473 | Bacteria | 3763 |
| 409 | Ga0495582_0041606 | 3300046473 | Bacteria | 2532 |
| 410 | Ga0495582_0051730 | 3300046473 | Bacteria | 2265 |
| 411 | Ga0495582_0335910 | 3300046473 | Bacteria | 870 |
| 412 | Ga0495605_0452495 | 3300046474 | Unclassified | 529 |
| 413 | Ga0495639_0381869 | 3300046475 | Bacteria | 710 |
| 414 | Ga0495662_0017258 | 3300046476 | Bacteria | 3493 |
| 415 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 416 | Ga0495664_0125156 | 3300046477 | Bacteria | 1555 |
| 417 | Ga0495584_0090047 | 3300046491 | Bacteria | 1547 |
| 418 | Ga0495584_0117253 | 3300046491 | Bacteria | 1348 |
| 419 | Ga0495594_0747733 | 3300046499 | Bacteria | 552 |
| 420 | Ga0495608_0000109 | 3300046511 | Bacteria | 59207 |
| 421 | Ga0495608_0007124 | 3300046511 | Bacteria | 7911 |
| 422 | Ga0495618_0000064 | 3300046514 | Bacteria | 77194 |
| 423 | Ga0495618_0011966 | 3300046514 | Bacteria | 5265 |
| 424 | Ga0495618_0278763 | 3300046514 | Bacteria | 1043 |
| 425 | Ga0495620_0161149 | 3300046515 | Bacteria | 872 |
| 426 | Ga0495628_0000003 | 3300046516 | Bacteria | 470339 |
| 427 | Ga0495628_0022697 | 3300046516 | Bacteria | 5154 |
| 428 | Ga0495628_0066244 | 3300046516 | Bacteria | 2823 |
| 429 | Ga0495630_0000920 | 3300046517 | Bacteria | 20504 |
| 430 | Ga0495630_0058084 | 3300046517 | Bacteria | 2900 |
| 431 | Ga0495630_0349614 | 3300046517 | Bacteria | 1131 |
| 432 | Ga0495632_0068499 | 3300046519 | Bacteria | 1710 |
| 433 | Ga0495637_0147662 | 3300046520 | Bacteria | 889 |
| 434 | Ga0495642_0194048 | 3300046528 | Bacteria | 885 |
| 435 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 436 | Ga0495652_0028625 | 3300046529 | Bacteria | 4900 |
| 437 | Ga0495652_0288669 | 3300046529 | Bacteria | 1198 |
| 438 | Ga0495640_0000012 | 3300046533 | Bacteria | 194692 |
| 439 | Ga0495640_0004066 | 3300046533 | Bacteria | 11705 |
| 440 | Ga0495640_0132755 | 3300046533 | Bacteria | 1610 |
| 441 | Ga0495640_0243700 | 3300046533 | Bacteria | 1127 |
| 442 | Ga0495586_0226476 | 3300046535 | Bacteria | 1063 |
| 443 | Ga0495587_0000028 | 3300046536 | Bacteria | 138663 |
| 444 | Ga0495587_0003805 | 3300046536 | Bacteria | 10013 |
| 445 | Ga0495587_0466033 | 3300046536 | Bacteria | 699 |
| 446 | Ga0495598_0051214 | 3300046537 | Bacteria | 1243 |
| 447 | Ga0495609_0273624 | 3300046538 | Bacteria | 692 |
| 448 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 449 | Ga0495645_0098081 | 3300046543 | Bacteria | 2086 |
| 450 | Ga0495645_0460547 | 3300046543 | Unclassified | 801 |
| 451 | Ga0495622_0096739 | 3300046557 | Bacteria | 1355 |
| 452 | Ga0495633_0267895 | 3300046558 | Unclassified | 778 |
| 453 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 454 | Ga0495667_0001772 | 3300046559 | Bacteria | 14330 |
| 455 | Ga0495667_0583292 | 3300046559 | Bacteria | 697 |
| 456 | Ga0495656_0173484 | 3300046615 | Bacteria | 1056 |
| 457 | Ga0495668_0129758 | 3300046616 | Bacteria | 1380 |
| 458 | Ga0495634_0000075 | 3300046642 | Bacteria | 77824 |
| 459 | Ga0495634_0003759 | 3300046642 | Bacteria | 12074 |
| 460 | Ga0495634_0306084 | 3300046642 | Bacteria | 960 |
| 461 | Ga0495635_0000015 | 3300046663 | Bacteria | 215468 |
| 462 | Ga0495635_0013128 | 3300046663 | Bacteria | 5799 |
| 463 | Ga0495635_0692687 | 3300046663 | Bacteria | 661 |
| 464 | Ga0495659_0261827 | 3300046664 | Bacteria | 723 |
| 465 | Ga0495588_0772055 | 3300046674 | Bacteria | 502 |
| 466 | Ga0495657_0000155 | 3300046675 | Bacteria | 62116 |
| 467 | Ga0495657_0070588 | 3300046675 | Bacteria | 2282 |
| 468 | Ga0495599_0000029 | 3300046678 | Bacteria | 113803 |
| 469 | Ga0495599_0028522 | 3300046678 | Bacteria | 3499 |
| 470 | Ga0495623_0000012 | 3300046679 | Bacteria | 120267 |
| 471 | Ga0495623_0016640 | 3300046679 | Bacteria | 4749 |
| 472 | Ga0495646_0000006 | 3300046680 | Bacteria | 258496 |
| 473 | Ga0495646_0048619 | 3300046680 | Bacteria | 2575 |
| 474 | Ga0495646_0261383 | 3300046680 | Bacteria | 925 |
| 475 | Ga0495647_0093683 | 3300046681 | Bacteria | 1235 |
| 476 | Ga0495647_0162975 | 3300046681 | Bacteria | 962 |
| 477 | Ga0495658_0021927 | 3300046683 | Bacteria | 3373 |
| 478 | Ga0495658_0065237 | 3300046683 | Bacteria | 2100 |
| 479 | Ga0495658_0089234 | 3300046683 | Bacteria | 1823 |
| 480 | Ga0495658_0338492 | 3300046683 | Bacteria | 955 |
| 481 | Ga0495658_0429734 | 3300046683 | Bacteria | 843 |
| 482 | Ga0495669_0060058 | 3300046684 | Bacteria | 1718 |
| 483 | Ga0495613_0012194 | 3300046689 | Bacteria | 6388 |
| 484 | Ga0495613_0124178 | 3300046689 | Bacteria | 1852 |
| 485 | Ga0495613_0466158 | 3300046689 | Bacteria | 854 |
| 486 | Ga0495624_0014887 | 3300046690 | Bacteria | 5268 |
| 487 | Ga0495624_0034557 | 3300046690 | Bacteria | 3269 |
| 488 | Ga0495624_0107093 | 3300046690 | Bacteria | 1719 |
| 489 | Ga0495624_0427297 | 3300046690 | Bacteria | 794 |
| 490 | Ga0495670_0358020 | 3300046691 | Bacteria | 786 |
| 491 | Ga0495671_0250068 | 3300046692 | Bacteria | 855 |
| 492 | Ga0495589_0120418 | 3300046794 | Bacteria | 1264 |
| 493 | Ga0495600_0000081 | 3300046809 | Bacteria | 52285 |
| 494 | Ga0495660_0140379 | 3300046810 | Bacteria | 1203 |
| 495 | Ga0495581_0001934 | 3300047315 | Bacteria | 11616 |
| 496 | Ga0495581_0120374 | 3300047315 | Bacteria | 1528 |
| 497 | Ga0495604_0000091 | 3300047317 | Bacteria | 77216 |
| 498 | Ga0495604_0006197 | 3300047317 | Bacteria | 9493 |
| 499 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 500 | Ga0495674_0003999 | 3300047319 | Bacteria | 14278 |
| 501 | Ga0495674_1264996 | 3300047319 | Bacteria | 555 |
| 502 | Ga0495672_0153136 | 3300047320 | Bacteria | 1194 |
| 503 | Ga0495676_0249294 | 3300047321 | Bacteria | 1212 |
| 504 | Ga0495676_0289852 | 3300047321 | Bacteria | 1106 |
| 505 | Ga0495680_0001331 | 3300047322 | Bacteria | 26943 |
| 506 | Ga0495680_0003944 | 3300047322 | Bacteria | 14346 |
| 507 | Ga0495680_0115221 | 3300047322 | Bacteria | 1989 |
| 508 | Ga0495680_0619742 | 3300047322 | Bacteria | 722 |
| 509 | Ga0495675_0000113 | 3300047444 | Bacteria | 58250 |
| 510 | Ga0495675_0030948 | 3300047444 | Bacteria | 3415 |
| 511 | Ga0495677_0210726 | 3300047445 | Bacteria | 756 |
| 512 | Ga0495681_0283853 | 3300047470 | Unclassified | 645 |
| 513 | Ga0495684_0000055 | 3300047471 | Bacteria | 79796 |
| 514 | Ga0495684_0086796 | 3300047471 | Bacteria | 2371 |
| 515 | Ga0495593_0000990 | 3300047673 | Bacteria | 16699 |
| 516 | Ga0495593_0420510 | 3300047673 | Bacteria | 668 |
| 517 | Ga0495602_0000002 | 3300048088 | Bacteria | 422216 |
| 518 | Ga0495602_0017584 | 3300048088 | Bacteria | 7163 |
| 519 | Ga0495602_0932037 | 3300048088 | Unclassified | 576 |
| 520 | Ga0495615_0088278 | 3300048090 | Bacteria | 860 |
| 521 | Ga0496100_0069482 | 3300048903 | Bacteria | 2346 |
| 522 | Ga0496101_0012045 | 3300048904 | Bacteria | 5761 |
| 523 | Ga0496101_0463044 | 3300048904 | Bacteria | 1000 |
| 524 | Ga0496102_0020204 | 3300048905 | Bacteria | 5882 |
| 525 | Ga0496102_0055176 | 3300048905 | Bacteria | 3624 |
| 526 | Ga0496102_0160511 | 3300048905 | Bacteria | 2114 |
| 527 | Ga0496102_0259321 | 3300048905 | Bacteria | 1639 |
| 528 | Ga0496102_0425603 | 3300048905 | Bacteria | 1247 |
| 529 | Ga0496102_1265889 | 3300048905 | Bacteria | 657 |
| 530 | Ga0496103_0033206 | 3300048906 | Bacteria | 3152 |
| 531 | Ga0496103_0137446 | 3300048906 | Bacteria | 1562 |
| 532 | Ga0496104_0010954 | 3300048907 | Bacteria | 8113 |
| 533 | Ga0496104_0148231 | 3300048907 | Bacteria | 2253 |
| 534 | Ga0496105_0025914 | 3300048908 | Bacteria | 4777 |
| 535 | Ga0496105_0215875 | 3300048908 | Bacteria | 1562 |
| 536 | Ga0496106_0023831 | 3300048909 | Bacteria | 4549 |
| 537 | Ga0496106_0565967 | 3300048909 | Bacteria | 911 |
| 538 | Ga0496106_0644718 | 3300048909 | Bacteria | 846 |
| 539 | Ga0496106_0931473 | 3300048909 | Bacteria | 685 |
| 540 | Ga0496106_1335613 | 3300048909 | Unclassified | 556 |
| 541 | Ga0496107_0076503 | 3300048910 | Bacteria | 2437 |
| 542 | Ga0496107_0447594 | 3300048910 | Bacteria | 959 |
| 543 | Ga0496108_0030831 | 3300048911 | Bacteria | 4443 |
| 544 | Ga0496108_0241429 | 3300048911 | Bacteria | 1571 |
| 545 | Ga0496109_0002836 | 3300048912 | Bacteria | 14521 |
| 546 | Ga0496109_0234485 | 3300048912 | Bacteria | 1727 |
| 547 | Ga0496109_0784951 | 3300048912 | Bacteria | 890 |
| 548 | Ga0496109_1192752 | 3300048912 | Unclassified | 698 |
| 549 | Ga0496110_0001434 | 3300048913 | Bacteria | 17245 |
| 550 | Ga0496110_0225258 | 3300048913 | Bacteria | 1705 |
| 551 | Ga0496110_0286904 | 3300048913 | Unclassified | 1499 |
| 552 | Ga0496110_0520041 | 3300048913 | Bacteria | 1082 |
| 553 | Ga0496110_0827846 | 3300048913 | Bacteria | 830 |
| 554 | Ga0496111_0007669 | 3300048914 | Bacteria | 7096 |
| 555 | Ga0496111_0057596 | 3300048914 | Bacteria | 2813 |
| 556 | Ga0496111_0154954 | 3300048914 | Bacteria | 1700 |
| 557 | Ga0496111_0404421 | 3300048914 | Bacteria | 1009 |
| 558 | Ga0496112_0012499 | 3300048915 | Bacteria | 7801 |
| 559 | Ga0496112_0075069 | 3300048915 | Bacteria | 3343 |
| 560 | Ga0496112_0155583 | 3300048915 | Bacteria | 2253 |
| 561 | Ga0496112_0876329 | 3300048915 | Bacteria | 820 |
| 562 | Ga0496113_0000104 | 3300048916 | Bacteria | 35682 |
| 563 | Ga0496113_0366825 | 3300048916 | Bacteria | 1155 |
| 564 | Ga0496114_0004545 | 3300048917 | Bacteria | 10773 |
| 565 | Ga0496114_0100387 | 3300048917 | Bacteria | 2470 |
| 566 | Ga0496114_0432591 | 3300048917 | Bacteria | 1165 |
| 567 | Ga0496114_1038463 | 3300048917 | Bacteria | 703 |
| 568 | Ga0496115_0100820 | 3300048918 | Bacteria | 2367 |
| 569 | Ga0496115_0301613 | 3300048918 | Bacteria | 1313 |
| 570 | Ga0496115_0354054 | 3300048918 | Unclassified | 1197 |
| 571 | Ga0501031_0257218 | 3300049568 | Bacteria | 1135 |
| 572 | Ga0501036_1494659 | 3300049572 | Unclassified | 547 |
| 573 | Ga0501039_1112595 | 3300049575 | Bacteria | 612 |
| 574 | Ga0501040_0339248 | 3300049576 | Bacteria | 1076 |
| 575 | Ga0501041_0299390 | 3300049577 | Unclassified | 1013 |
| 576 | Ga0501068_0659874 | 3300049584 | Bacteria | 683 |
| 577 | Ga0501072_0333895 | 3300049588 | Bacteria | 1204 |
| 578 | Ga0501076_0941998 | 3300049592 | Bacteria | 712 |
| 579 | Ga0501076_1119386 | 3300049592 | Bacteria | 648 |
| 580 | Ga0501076_1133844 | 3300049592 | Bacteria | 644 |
| 581 | Ga0501077_0845165 | 3300049593 | Bacteria | 589 |
| 582 | Ga0501079_0047501 | 3300049741 | Bacteria | 3312 |
| 583 | Ga0501081_0827523 | 3300049743 | Bacteria | 697 |
| 584 | Ga0501083_0005509 | 3300049744 | Bacteria | 8970 |
| 585 | Ga0501045_0108584 | 3300049824 | Bacteria | 2057 |
| 586 | Ga0501045_1063910 | 3300049824 | Unclassified | 592 |
| 587 | Ga0501045_1129993 | 3300049824 | Unclassified | 573 |
| 588 | nmdc:mga03683_12738_c1 | 3300050489 | Bacteria | 3078 |
| 589 | nmdc:mga03683_45400_c1 | 3300050489 | Bacteria | 1818 |
| 590 | nmdc:mga00v17_388229_c1 | 3300050491 | Bacteria | 907 |
| 591 | nmdc:mga0yw44_1062210_c1 | 3300050492 | Bacteria | 547 |
| 592 | nmdc:mga0yw44_151434_c1 | 3300050492 | Bacteria | 1513 |
| 593 | nmdc:mga0yw44_80976_c1 | 3300050492 | Bacteria | 2035 |
| 594 | nmdc:mga06z11_595934_c1 | 3300050494 | Bacteria | 672 |
| 595 | nmdc:mga07m45_669211_c1 | 3300050496 | Unclassified | 598 |
| 596 | nmdc:mga05p37_1099605_c1 | 3300050507 | Bacteria | 832 |
| 597 | nmdc:mga05p37_569007_c1 | 3300050507 | Bacteria | 1286 |
| 598 | nmdc:mga05p37_6074_c1 | 3300050507 | Bacteria | 14220 |
| 599 | nmdc:mga09592_1300430_c1 | 3300050508 | Bacteria | 598 |
| 600 | nmdc:mga09592_219979_c1 | 3300050508 | Bacteria | 1645 |
| 601 | nmdc:mga09592_794934_c1 | 3300050508 | Unclassified | 800 |
| 602 | nmdc:mga0qj67_58_c1 | 3300050509 | Bacteria | 81362 |
| 603 | nmdc:mga06r32_127399_c1 | 3300050510 | Bacteria | 2515 |
| 604 | nmdc:mga06r32_327054_c1 | 3300050510 | Unclassified | 1518 |
| 605 | nmdc:mga08y16_1156074_c1 | 3300050511 | Bacteria | 746 |
| 606 | nmdc:mga08y16_261648_c1 | 3300050511 | Bacteria | 1786 |
| 607 | nmdc:mga08y16_46773_c1 | 3300050511 | Bacteria | 4529 |
| 608 | nmdc:mga08y16_55660_c1 | 3300050511 | Bacteria | 4132 |
| 609 | nmdc:mga08y16_687704_c1 | 3300050511 | Bacteria | 1024 |
| 610 | nmdc:mga0n895_266369_c1 | 3300050512 | Bacteria | 1738 |
| 611 | nmdc:mga0n895_54484_c1 | 3300050512 | Bacteria | 3934 |
| 612 | nmdc:mga0rr50_1206659_c1 | 3300050513 | Bacteria | 643 |
| 613 | nmdc:mga0rr50_138991_c1 | 3300050513 | Bacteria | 1952 |
| 614 | nmdc:mga0rr50_260982_c1 | 3300050513 | Bacteria | 1441 |
| 615 | nmdc:mga0rr50_422020_c1 | 3300050513 | Bacteria | 1128 |
| 616 | nmdc:mga0a205_308638_c1 | 3300050515 | Bacteria | 1454 |
| 617 | nmdc:mga0a205_728394_c1 | 3300050515 | Bacteria | 841 |
| 618 | nmdc:mga0a205_852219_c1 | 3300050515 | Unclassified | 758 |
| 619 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 620 | Ga0495601_0020294 | 3300053077 | Bacteria | 4058 |
| 621 | Ga0495601_0053340 | 3300053077 | Bacteria | 2555 |
| 622 | Ga0495601_0056897 | 3300053077 | Bacteria | 2477 |
| 623 | Ga0495612_0000007 | 3300053078 | Bacteria | 253300 |
| 624 | Ga0495612_0022643 | 3300053078 | Bacteria | 2517 |
| 625 | Ga0495612_0029298 | 3300053078 | Bacteria | 2217 |
| 626 | Ga0495595_0000051 | 3300053084 | Bacteria | 60041 |
| 627 | Ga0495595_0000580 | 3300053084 | Bacteria | 14001 |
| 628 | Ga0495595_0574395 | 3300053084 | Unclassified | 576 |
| 629 | Ga0495619_0000027 | 3300053085 | Bacteria | 165001 |
| 630 | Ga0495619_0026800 | 3300053085 | Bacteria | 3710 |
| 631 | Ga0495619_0028774 | 3300053085 | Bacteria | 3586 |
| 632 | Ga0495619_0363575 | 3300053085 | Bacteria | 1000 |
| 633 | Ga0495619_0579995 | 3300053085 | Bacteria | 768 |
| 634 | Ga0501084_0479025 | 3300054114 | Bacteria | 1052 |
| 635 | Ga0501084_0588277 | 3300054114 | Bacteria | 940 |
| 636 | Ga0501084_1368825 | 3300054114 | Unclassified | 593 |
| 637 | Ga0530510_0106019 | 3300061734 | Bacteria | 2057 |
| 638 | Ga0530510_0168227 | 3300061734 | Bacteria | 1623 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_0941998 | Ga0501076_0941998_165_491 | 106 |
| 2 | 3300005333 | Ga0070677_10402072 | Ga0070677_104020722 | 107 |
| 3 | 3300006028 | Ga0070717_10402023 | Ga0070717_104020232 | 107 |
| 4 | 3300006175 | Ga0070712_101519877 | Ga0070712_1015198772 | 107 |
| 5 | 3300009147 | Ga0114129_12389429 | Ga0114129_123894292 | 107 |
| 6 | 3300024227 | Ga0228598_1000228 | Ga0228598_10002284 | 107 |
| 7 | 3300025903 | Ga0207680_10176044 | Ga0207680_101760443 | 107 |
| 8 | 3300025915 | Ga0207693_10218530 | Ga0207693_102185302 | 107 |
| 9 | 3300035695 | Ga0373927_0713734 | Ga0373927_0713734_208_540 | 107 |
| 10 | 3300044735 | Ga0466968_0237339 | Ga0466968_0237339_402_737 | 107 |
| 11 | 3300046473 | Ga0495582_0335910 | Ga0495582_0335910_221_553 | 107 |
| 12 | 3300046516 | Ga0495628_0066244 | Ga0495628_0066244_2422_2799 | 107 |
| 13 | 3300046533 | Ga0495640_0243700 | Ga0495640_0243700_121_498 | 107 |
| 14 | 3300046536 | Ga0495587_0466033 | Ga0495587_0466033_122_499 | 107 |
| 15 | 3300046680 | Ga0495646_0261383 | Ga0495646_0261383_244_621 | 107 |
| 16 | 3300046683 | Ga0495658_0429734 | Ga0495658_0429734_178_510 | 107 |
| 17 | 3300047322 | Ga0495680_0115221 | Ga0495680_0115221_47_424 | 107 |
| 18 | 3300053077 | Ga0495601_0020294 | Ga0495601_0020294_1696_2073 | 107 |
| 19 | 3300053078 | Ga0495612_0029298 | Ga0495612_0029298_1276_1653 | 107 |
| 20 | 3300005328 | Ga0070676_10920784 | Ga0070676_109207842 | 108 |
| 21 | 3300005334 | Ga0068869_100313588 | Ga0068869_1003135882 | 108 |
| 22 | 3300005354 | Ga0070675_101064566 | Ga0070675_1010645662 | 108 |
| 23 | 3300005355 | Ga0070671_100918418 | Ga0070671_1009184182 | 108 |
| 24 | 3300005356 | Ga0070674_100422325 | Ga0070674_1004223252 | 108 |
| 25 | 3300005364 | Ga0070673_101326518 | Ga0070673_1013265182 | 108 |
| 26 | 3300005434 | Ga0070709_10426590 | Ga0070709_104265902 | 108 |
| 27 | 3300005435 | Ga0070714_100691655 | Ga0070714_1006916552 | 108 |
| 28 | 3300005435 | Ga0070714_101307985 | Ga0070714_1013079851 | 108 |
| 29 | 3300005435 | Ga0070714_101410217 | Ga0070714_1014102171 | 108 |
| 30 | 3300005436 | Ga0070713_100710247 | Ga0070713_1007102472 | 108 |
| 31 | 3300005437 | Ga0070710_10803775 | Ga0070710_108037752 | 108 |
| 32 | 3300005439 | Ga0070711_101502312 | Ga0070711_1015023121 | 108 |
| 33 | 3300005456 | Ga0070678_100867894 | Ga0070678_1008678941 | 108 |
| 34 | 3300005457 | Ga0070662_100994181 | Ga0070662_1009941811 | 108 |
| 35 | 3300005615 | Ga0070702_100928869 | Ga0070702_1009288692 | 108 |
| 36 | 3300005719 | Ga0068861_100114323 | Ga0068861_1001143233 | 108 |
| 37 | 3300005842 | Ga0068858_100035884 | Ga0068858_1000358843 | 108 |
| 38 | 3300006028 | Ga0070717_10092317 | Ga0070717_100923174 | 108 |
| 39 | 3300006173 | Ga0070716_100803925 | Ga0070716_1008039252 | 108 |
| 40 | 3300006237 | Ga0097621_100025691 | Ga0097621_1000256915 | 108 |
| 41 | 3300006881 | Ga0068865_100596214 | Ga0068865_1005962142 | 108 |
| 42 | 3300009094 | Ga0111539_10058430 | Ga0111539_100584303 | 108 |
| 43 | 3300009098 | Ga0105245_10003663 | Ga0105245_1000366311 | 108 |
| 44 | 3300009098 | Ga0105245_11111932 | Ga0105245_111119322 | 108 |
| 45 | 3300009101 | Ga0105247_10921349 | Ga0105247_109213492 | 108 |
| 46 | 3300009148 | Ga0105243_10047260 | Ga0105243_100472604 | 108 |
| 47 | 3300009174 | Ga0105241_11212192 | Ga0105241_112121922 | 108 |
| 48 | 3300009176 | Ga0105242_12875067 | Ga0105242_128750671 | 108 |
| 49 | 3300009177 | Ga0105248_10091528 | Ga0105248_100915284 | 108 |
| 50 | 3300011119 | Ga0105246_10097416 | Ga0105246_100974163 | 108 |
| 51 | 3300013296 | Ga0157374_10757708 | Ga0157374_107577082 | 108 |
| 52 | 3300013306 | Ga0163162_11347829 | Ga0163162_113478292 | 108 |
| 53 | 3300021384 | Ga0213876_10216793 | Ga0213876_102167932 | 108 |
| 54 | 3300024225 | Ga0224572_1036531 | Ga0224572_10365312 | 108 |
| 55 | 3300024227 | Ga0228598_1017155 | Ga0228598_10171551 | 108 |
| 56 | 3300025898 | Ga0207692_11214296 | Ga0207692_112142961 | 108 |
| 57 | 3300025926 | Ga0207659_10952127 | Ga0207659_109521271 | 108 |
| 58 | 3300025928 | Ga0207700_10253925 | Ga0207700_102539252 | 108 |
| 59 | 3300025929 | Ga0207664_10421146 | Ga0207664_104211462 | 108 |
| 60 | 3300026041 | Ga0207639_11577870 | Ga0207639_115778702 | 108 |
| 61 | 3300026118 | Ga0207675_100214759 | Ga0207675_1002147592 | 108 |
| 62 | 3300026121 | Ga0207683_12080914 | Ga0207683_120809141 | 108 |
| 63 | 3300030763 | Ga0265763_1020462 | Ga0265763_10204621 | 108 |
| 64 | 3300030878 | Ga0265770_1027491 | Ga0265770_10274912 | 108 |
| 65 | 3300031018 | Ga0265773_1002977 | Ga0265773_10029772 | 108 |
| 66 | 3300031090 | Ga0265760_10023618 | Ga0265760_100236183 | 108 |
| 67 | 3300031090 | Ga0265760_10054588 | Ga0265760_100545882 | 108 |
| 68 | 3300031090 | Ga0265760_10387492 | Ga0265760_103874921 | 108 |
| 69 | 3300035117 | Ga0373953_0020404 | Ga0373953_0020404_582_911 | 108 |
| 70 | 3300035118 | Ga0373954_0029261 | Ga0373954_0029261_256_585 | 108 |
| 71 | 3300035119 | Ga0373956_0246313 | Ga0373956_0246313_76_405 | 108 |
| 72 | 3300035120 | Ga0373957_0051167 | Ga0373957_0051167_94_423 | 108 |
| 73 | 3300035171 | Ga0373946_0028163 | Ga0373946_0028163_728_1057 | 108 |
| 74 | 3300035410 | Ga0373924_0032081 | Ga0373924_0032081_855_1184 | 108 |
| 75 | 3300035692 | Ga0373935_0042672 | Ga0373935_0042672_2084_2413 | 108 |
| 76 | 3300035695 | Ga0373927_0027458 | Ga0373927_0027458_861_1190 | 108 |
| 77 | 3300035724 | Ga0373933_0001225 | Ga0373933_0001225_10933_11262 | 108 |
| 78 | 3300035725 | Ga0373947_0017026 | Ga0373947_0017026_1702_2031 | 108 |
| 79 | 3300036401 | Ga0373937_0001973 | Ga0373937_0001973_4323_4652 | 108 |
| 80 | 3300037853 | Ga0436364_1268188 | Ga0436364_1268188_112_441 | 108 |
| 81 | 3300039437 | Ga0436365_1702936 | Ga0436365_1702936_520_852 | 108 |
| 82 | 3300044694 | Ga0466963_0042249 | Ga0466963_0042249_55_387 | 108 |
| 83 | 3300044735 | Ga0466968_0444356 | Ga0466968_0444356_32_361 | 108 |
| 84 | 3300045976 | Ga0466967_0251728 | Ga0466967_0251728_656_988 | 108 |
| 85 | 3300046454 | Ga0495592_0004076 | Ga0495592_0004076_5665_5994 | 108 |
| 86 | 3300046459 | Ga0495629_0001945 | Ga0495629_0001945_2416_2745 | 108 |
| 87 | 3300046462 | Ga0495651_0001437 | Ga0495651_0001437_13355_13684 | 108 |
| 88 | 3300046463 | Ga0495653_0017442 | Ga0495653_0017442_2085_2414 | 108 |
| 89 | 3300046473 | Ga0495582_0018977 | Ga0495582_0018977_1885_2214 | 108 |
| 90 | 3300046477 | Ga0495664_0125156 | Ga0495664_0125156_1158_1487 | 108 |
| 91 | 3300046491 | Ga0495584_0090047 | Ga0495584_0090047_1156_1488 | 108 |
| 92 | 3300046511 | Ga0495608_0007124 | Ga0495608_0007124_632_961 | 108 |
| 93 | 3300046514 | Ga0495618_0011966 | Ga0495618_0011966_3101_3430 | 108 |
| 94 | 3300046516 | Ga0495628_0022697 | Ga0495628_0022697_415_744 | 108 |
| 95 | 3300046517 | Ga0495630_0058084 | Ga0495630_0058084_550_879 | 108 |
| 96 | 3300046529 | Ga0495652_0028625 | Ga0495652_0028625_4347_4676 | 108 |
| 97 | 3300046533 | Ga0495640_0004066 | Ga0495640_0004066_7519_7848 | 108 |
| 98 | 3300046536 | Ga0495587_0003805 | Ga0495587_0003805_4952_5281 | 108 |
| 99 | 3300046543 | Ga0495645_0098081 | Ga0495645_0098081_900_1229 | 108 |
| 100 | 3300046559 | Ga0495667_0001772 | Ga0495667_0001772_1152_1481 | 108 |
| 101 | 3300046642 | Ga0495634_0003759 | Ga0495634_0003759_7335_7664 | 108 |
| 102 | 3300046663 | Ga0495635_0013128 | Ga0495635_0013128_564_893 | 108 |
| 103 | 3300046675 | Ga0495657_0070588 | Ga0495657_0070588_1726_2055 | 108 |
| 104 | 3300046678 | Ga0495599_0028522 | Ga0495599_0028522_48_377 | 108 |
| 105 | 3300046679 | Ga0495623_0016640 | Ga0495623_0016640_213_542 | 108 |
| 106 | 3300046680 | Ga0495646_0048619 | Ga0495646_0048619_1535_1864 | 108 |
| 107 | 3300046683 | Ga0495658_0021927 | Ga0495658_0021927_1590_1919 | 108 |
| 108 | 3300046690 | Ga0495624_0107093 | Ga0495624_0107093_1113_1442 | 108 |
| 109 | 3300047317 | Ga0495604_0006197 | Ga0495604_0006197_7208_7537 | 108 |
| 110 | 3300047319 | Ga0495674_0003999 | Ga0495674_0003999_9369_9698 | 108 |
| 111 | 3300047321 | Ga0495676_0289852 | Ga0495676_0289852_149_478 | 108 |
| 112 | 3300047322 | Ga0495680_0003944 | Ga0495680_0003944_1462_1791 | 108 |
| 113 | 3300047444 | Ga0495675_0030948 | Ga0495675_0030948_1109_1438 | 108 |
| 114 | 3300047471 | Ga0495684_0086796 | Ga0495684_0086796_1314_1643 | 108 |
| 115 | 3300048088 | Ga0495602_0017584 | Ga0495602_0017584_4275_4604 | 108 |
| 116 | 3300048905 | Ga0496102_1265889 | Ga0496102_1265889_78_407 | 108 |
| 117 | 3300048909 | Ga0496106_0931473 | Ga0496106_0931473_262_591 | 108 |
| 118 | 3300048915 | Ga0496112_0155583 | Ga0496112_0155583_1812_2141 | 108 |
| 119 | 3300049584 | Ga0501068_0659874 | Ga0501068_0659874_284_616 | 108 |
| 120 | 3300049592 | Ga0501076_1133844 | Ga0501076_1133844_15_344 | 108 |
| 121 | 3300049593 | Ga0501077_0845165 | Ga0501077_0845165_13_342 | 108 |
| 122 | 3300049744 | Ga0501083_0005509 | Ga0501083_0005509_7603_7929 | 108 |
| 123 | 3300050511 | nmdc:mga08y16_46773_c1 | nmdc:mga08y16_46773_c1_667_996 | 108 |
| 124 | 3300053077 | Ga0495601_0053340 | Ga0495601_0053340_2007_2336 | 108 |
| 125 | 3300053078 | Ga0495612_0022643 | Ga0495612_0022643_219_548 | 108 |
| 126 | 3300053084 | Ga0495595_0000580 | Ga0495595_0000580_4314_4643 | 108 |
| 127 | 3300053085 | Ga0495619_0028774 | Ga0495619_0028774_1745_2074 | 108 |
| 128 | 3300054114 | Ga0501084_0588277 | Ga0501084_0588277_226_552 | 108 |
| 129 | 3300061734 | Ga0530510_0106019 | Ga0530510_0106019_862_1188 | 108 |
| 130 | 3300005330 | Ga0070690_100094769 | Ga0070690_1000947692 | 109 |
| 131 | 3300005331 | Ga0070670_100009667 | Ga0070670_1000096673 | 109 |
| 132 | 3300005340 | Ga0070689_100029652 | Ga0070689_1000296525 | 109 |
| 133 | 3300005354 | Ga0070675_100613915 | Ga0070675_1006139152 | 109 |
| 134 | 3300005355 | Ga0070671_100003913 | Ga0070671_10000391314 | 109 |
| 135 | 3300005364 | Ga0070673_100003043 | Ga0070673_1000030436 | 109 |
| 136 | 3300005366 | Ga0070659_100227497 | Ga0070659_1002274972 | 109 |
| 137 | 3300005434 | Ga0070709_10066528 | Ga0070709_100665283 | 109 |
| 138 | 3300005435 | Ga0070714_101671527 | Ga0070714_1016715271 | 109 |
| 139 | 3300005435 | Ga0070714_102121020 | Ga0070714_1021210201 | 109 |
| 140 | 3300005436 | Ga0070713_100627113 | Ga0070713_1006271132 | 109 |
| 141 | 3300005439 | Ga0070711_100075944 | Ga0070711_1000759441 | 109 |
| 142 | 3300005545 | Ga0070695_100252182 | Ga0070695_1002521821 | 109 |
| 143 | 3300005549 | Ga0070704_101519474 | Ga0070704_1015194742 | 109 |
| 144 | 3300005578 | Ga0068854_102053911 | Ga0068854_1020539111 | 109 |
| 145 | 3300005614 | Ga0068856_100519709 | Ga0068856_1005197091 | 109 |
| 146 | 3300006028 | Ga0070717_10056132 | Ga0070717_100561323 | 109 |
| 147 | 3300006173 | Ga0070716_100202019 | Ga0070716_1002020192 | 109 |
| 148 | 3300006173 | Ga0070716_100843629 | Ga0070716_1008436292 | 109 |
| 149 | 3300006175 | Ga0070712_100193994 | Ga0070712_1001939943 | 109 |
| 150 | 3300006852 | Ga0075433_10321892 | Ga0075433_103218921 | 109 |
| 151 | 3300006871 | Ga0075434_100276677 | Ga0075434_1002766772 | 109 |
| 152 | 3300007788 | Ga0099795_10001705 | Ga0099795_100017053 | 109 |
| 153 | 3300007788 | Ga0099795_10120224 | Ga0099795_101202241 | 109 |
| 154 | 3300009098 | Ga0105245_10064297 | Ga0105245_100642973 | 109 |
| 155 | 3300009098 | Ga0105245_11933016 | Ga0105245_119330161 | 109 |
| 156 | 3300009101 | Ga0105247_10334935 | Ga0105247_103349351 | 109 |
| 157 | 3300009148 | Ga0105243_10469776 | Ga0105243_104697762 | 109 |
| 158 | 3300009176 | Ga0105242_10893987 | Ga0105242_108939872 | 109 |
| 159 | 3300010159 | Ga0099796_10002657 | Ga0099796_100026573 | 109 |
| 160 | 3300010375 | Ga0105239_11403724 | Ga0105239_114037242 | 109 |
| 161 | 3300011119 | Ga0105246_10158672 | Ga0105246_101586722 | 109 |
| 162 | 3300013296 | Ga0157374_10123817 | Ga0157374_101238172 | 109 |
| 163 | 3300014325 | Ga0163163_10081068 | Ga0163163_100810684 | 109 |
| 164 | 3300014326 | Ga0157380_10307389 | Ga0157380_103073892 | 109 |
| 165 | 3300014969 | Ga0157376_11755973 | Ga0157376_117559731 | 109 |
| 166 | 3300025906 | Ga0207699_10087816 | Ga0207699_100878163 | 109 |
| 167 | 3300025906 | Ga0207699_10689668 | Ga0207699_106896682 | 109 |
| 168 | 3300025915 | Ga0207693_10145733 | Ga0207693_101457332 | 109 |
| 169 | 3300025916 | Ga0207663_11311183 | Ga0207663_113111831 | 109 |
| 170 | 3300025923 | Ga0207681_10104561 | Ga0207681_101045613 | 109 |
| 171 | 3300025925 | Ga0207650_10035565 | Ga0207650_100355652 | 109 |
| 172 | 3300025926 | Ga0207659_11488751 | Ga0207659_114887511 | 109 |
| 173 | 3300025927 | Ga0207687_10304804 | Ga0207687_103048042 | 109 |
| 174 | 3300025929 | Ga0207664_10940083 | Ga0207664_109400831 | 109 |
| 175 | 3300025931 | Ga0207644_10016666 | Ga0207644_100166666 | 109 |
| 176 | 3300025932 | Ga0207690_11027122 | Ga0207690_110271221 | 109 |
| 177 | 3300025934 | Ga0207686_10526657 | Ga0207686_105266572 | 109 |
| 178 | 3300025936 | Ga0207670_10030515 | Ga0207670_100305155 | 109 |
| 179 | 3300025939 | Ga0207665_10601333 | Ga0207665_106013332 | 109 |
| 180 | 3300025940 | Ga0207691_10163271 | Ga0207691_101632711 | 109 |
| 181 | 3300025981 | Ga0207640_11831007 | Ga0207640_118310072 | 109 |
| 182 | 3300026035 | Ga0207703_10660860 | Ga0207703_106608601 | 109 |
| 183 | 3300027512 | Ga0209179_1003699 | Ga0209179_10036993 | 109 |
| 184 | 3300035083 | Ga0373926_0019891 | Ga0373926_0019891_1176_1526 | 109 |
| 185 | 3300035086 | Ga0373934_0208864 | Ga0373934_0208864_433_783 | 109 |
| 186 | 3300035089 | Ga0373944_0057696 | Ga0373944_0057696_219_569 | 109 |
| 187 | 3300035092 | Ga0373952_0300650 | Ga0373952_0300650_41_382 | 109 |
| 188 | 3300035111 | Ga0373923_0000479 | Ga0373923_0000479_1411_1761 | 109 |
| 189 | 3300035113 | Ga0373936_0006290 | Ga0373936_0006290_2110_2460 | 109 |
| 190 | 3300035117 | Ga0373953_0006080 | Ga0373953_0006080_2654_3004 | 109 |
| 191 | 3300035118 | Ga0373954_0013416 | Ga0373954_0013416_1963_2313 | 109 |
| 192 | 3300035119 | Ga0373956_0063464 | Ga0373956_0063464_1231_1581 | 109 |
| 193 | 3300035170 | Ga0373943_0063037 | Ga0373943_0063037_895_1245 | 109 |
| 194 | 3300035170 | Ga0373943_0145805 | Ga0373943_0145805_104_436 | 109 |
| 195 | 3300035171 | Ga0373946_0041761 | Ga0373946_0041761_1411_1761 | 109 |
| 196 | 3300035172 | Ga0373955_0001971 | Ga0373955_0001971_1212_1562 | 109 |
| 197 | 3300035410 | Ga0373924_0000313 | Ga0373924_0000313_1301_1651 | 109 |
| 198 | 3300035692 | Ga0373935_0000756 | Ga0373935_0000756_4138_4488 | 109 |
| 199 | 3300035695 | Ga0373927_0004701 | Ga0373927_0004701_6944_7294 | 109 |
| 200 | 3300035695 | Ga0373927_0525610 | Ga0373927_0525610_61_393 | 109 |
| 201 | 3300035724 | Ga0373933_0391716 | Ga0373933_0391716_520_870 | 109 |
| 202 | 3300036401 | Ga0373937_0000271 | Ga0373937_0000271_25839_26189 | 109 |
| 203 | 3300037068 | Ga0373925_0000557 | Ga0373925_0000557_30111_30461 | 109 |
| 204 | 3300046454 | Ga0495592_0000001 | Ga0495592_0000001_3857_4207 | 109 |
| 205 | 3300046455 | Ga0495603_0383388 | Ga0495603_0383388_80_409 | 109 |
| 206 | 3300046459 | Ga0495629_0036846 | Ga0495629_0036846_97_447 | 109 |
| 207 | 3300046461 | Ga0495641_0185015 | Ga0495641_0185015_381_731 | 109 |
| 208 | 3300046462 | Ga0495651_0000596 | Ga0495651_0000596_12171_12521 | 109 |
| 209 | 3300046462 | Ga0495651_0528729 | Ga0495651_0528729_310_645 | 109 |
| 210 | 3300046463 | Ga0495653_0000092 | Ga0495653_0000092_18856_19206 | 109 |
| 211 | 3300046473 | Ga0495582_0041606 | Ga0495582_0041606_1226_1576 | 109 |
| 212 | 3300046476 | Ga0495662_0017258 | Ga0495662_0017258_2647_2997 | 109 |
| 213 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_312154_312504 | 109 |
| 214 | 3300046511 | Ga0495608_0000109 | Ga0495608_0000109_37578_37928 | 109 |
| 215 | 3300046514 | Ga0495618_0000064 | Ga0495618_0000064_55576_55926 | 109 |
| 216 | 3300046516 | Ga0495628_0000003 | Ga0495628_0000003_143211_143561 | 109 |
| 217 | 3300046517 | Ga0495630_0000920 | Ga0495630_0000920_17633_17983 | 109 |
| 218 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_514661_515011 | 109 |
| 219 | 3300046533 | Ga0495640_0000012 | Ga0495640_0000012_156953_157303 | 109 |
| 220 | 3300046533 | Ga0495640_0132755 | Ga0495640_0132755_1117_1449 | 109 |
| 221 | 3300046535 | Ga0495586_0226476 | Ga0495586_0226476_642_992 | 109 |
| 222 | 3300046536 | Ga0495587_0000028 | Ga0495587_0000028_21274_21624 | 109 |
| 223 | 3300046543 | Ga0495645_0000004 | Ga0495645_0000004_205660_206010 | 109 |
| 224 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_354653_355003 | 109 |
| 225 | 3300046642 | Ga0495634_0000075 | Ga0495634_0000075_34035_34385 | 109 |
| 226 | 3300046663 | Ga0495635_0000015 | Ga0495635_0000015_157145_157495 | 109 |
| 227 | 3300046675 | Ga0495657_0000155 | Ga0495657_0000155_6141_6491 | 109 |
| 228 | 3300046678 | Ga0495599_0000029 | Ga0495599_0000029_55605_55955 | 109 |
| 229 | 3300046679 | Ga0495623_0000012 | Ga0495623_0000012_37390_37740 | 109 |
| 230 | 3300046680 | Ga0495646_0000006 | Ga0495646_0000006_202547_202897 | 109 |
| 231 | 3300046683 | Ga0495658_0338492 | Ga0495658_0338492_66_416 | 109 |
| 232 | 3300046689 | Ga0495613_0012194 | Ga0495613_0012194_5101_5451 | 109 |
| 233 | 3300046690 | Ga0495624_0014887 | Ga0495624_0014887_4527_4877 | 109 |
| 234 | 3300046809 | Ga0495600_0000081 | Ga0495600_0000081_21058_21408 | 109 |
| 235 | 3300047315 | Ga0495581_0001934 | Ga0495581_0001934_6516_6866 | 109 |
| 236 | 3300047317 | Ga0495604_0000091 | Ga0495604_0000091_55672_56022 | 109 |
| 237 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_512091_512441 | 109 |
| 238 | 3300047320 | Ga0495672_0153136 | Ga0495672_0153136_323_658 | 109 |
| 239 | 3300047321 | Ga0495676_0249294 | Ga0495676_0249294_715_1065 | 109 |
| 240 | 3300047322 | Ga0495680_0001331 | Ga0495680_0001331_21069_21419 | 109 |
| 241 | 3300047444 | Ga0495675_0000113 | Ga0495675_0000113_36751_37101 | 109 |
| 242 | 3300047471 | Ga0495684_0000055 | Ga0495684_0000055_21339_21689 | 109 |
| 243 | 3300047673 | Ga0495593_0000990 | Ga0495593_0000990_4149_4499 | 109 |
| 244 | 3300048088 | Ga0495602_0000002 | Ga0495602_0000002_55634_55984 | 109 |
| 245 | 3300048088 | Ga0495602_0932037 | Ga0495602_0932037_172_525 | 109 |
| 246 | 3300048905 | Ga0496102_0259321 | Ga0496102_0259321_339_680 | 109 |
| 247 | 3300048905 | Ga0496102_0425603 | Ga0496102_0425603_532_867 | 109 |
| 248 | 3300048907 | Ga0496104_0148231 | Ga0496104_0148231_801_1142 | 109 |
| 249 | 3300048909 | Ga0496106_1335613 | Ga0496106_1335613_135_476 | 109 |
| 250 | 3300048912 | Ga0496109_0234485 | Ga0496109_0234485_712_1053 | 109 |
| 251 | 3300048912 | Ga0496109_1192752 | Ga0496109_1192752_351_686 | 109 |
| 252 | 3300048913 | Ga0496110_0225258 | Ga0496110_0225258_316_657 | 109 |
| 253 | 3300048915 | Ga0496112_0075069 | Ga0496112_0075069_142_483 | 109 |
| 254 | 3300048915 | Ga0496112_0876329 | Ga0496112_0876329_471_806 | 109 |
| 255 | 3300048917 | Ga0496114_0004545 | Ga0496114_0004545_2264_2599 | 109 |
| 256 | 3300048918 | Ga0496115_0354054 | Ga0496115_0354054_103_438 | 109 |
| 257 | 3300049588 | Ga0501072_0333895 | Ga0501072_0333895_750_1079 | 109 |
| 258 | 3300049741 | Ga0501079_0047501 | Ga0501079_0047501_246_575 | 109 |
| 259 | 3300049824 | Ga0501045_1063910 | Ga0501045_1063910_204_533 | 109 |
| 260 | 3300050512 | nmdc:mga0n895_266369_c1 | nmdc:mga0n895_266369_c1_1059_1403 | 109 |
| 261 | 3300050515 | nmdc:mga0a205_728394_c1 | nmdc:mga0a205_728394_c1_202_546 | 109 |
| 262 | 3300053077 | Ga0495601_0000006 | Ga0495601_0000006_352141_352491 | 109 |
| 263 | 3300053078 | Ga0495612_0000007 | Ga0495612_0000007_37552_37902 | 109 |
| 264 | 3300053084 | Ga0495595_0000051 | Ga0495595_0000051_50199_50549 | 109 |
| 265 | 3300053084 | Ga0495595_0574395 | Ga0495595_0574395_175_510 | 109 |
| 266 | 3300053085 | Ga0495619_0000027 | Ga0495619_0000027_143399_143749 | 109 |
| 267 | 3300053085 | Ga0495619_0579995 | Ga0495619_0579995_310_645 | 109 |
| 268 | 3300061734 | Ga0530510_0168227 | Ga0530510_0168227_306_635 | 109 |
| 269 | 3300001976 | JGI24752J21851_1048827 | JGI24752J21851_10488272 | 110 |
| 270 | 3300001990 | JGI24737J22298_10126440 | JGI24737J22298_101264402 | 110 |
| 271 | 3300001991 | JGI24743J22301_10028635 | JGI24743J22301_100286352 | 110 |
| 272 | 3300002070 | JGI24750J21931_1015787 | JGI24750J21931_10157871 | 110 |
| 273 | 3300002075 | JGI24738J21930_10083859 | JGI24738J21930_100838591 | 110 |
| 274 | 3300003659 | JGI25404J52841_10088525 | JGI25404J52841_100885251 | 110 |
| 275 | 3300003911 | JGI25405J52794_10020696 | JGI25405J52794_100206962 | 110 |
| 276 | 3300005328 | Ga0070676_10061128 | Ga0070676_100611282 | 110 |
| 277 | 3300005329 | Ga0070683_100808506 | Ga0070683_1008085061 | 110 |
| 278 | 3300005330 | Ga0070690_100524414 | Ga0070690_1005244142 | 110 |
| 279 | 3300005331 | Ga0070670_100006065 | Ga0070670_1000060659 | 110 |
| 280 | 3300005331 | Ga0070670_100099690 | Ga0070670_1000996902 | 110 |
| 281 | 3300005334 | Ga0068869_100043423 | Ga0068869_1000434231 | 110 |
| 282 | 3300005337 | Ga0070682_100415099 | Ga0070682_1004150991 | 110 |
| 283 | 3300005338 | Ga0068868_100528535 | Ga0068868_1005285352 | 110 |
| 284 | 3300005339 | Ga0070660_100643420 | Ga0070660_1006434202 | 110 |
| 285 | 3300005341 | Ga0070691_10034541 | Ga0070691_100345413 | 110 |
| 286 | 3300005343 | Ga0070687_100091255 | Ga0070687_1000912552 | 110 |
| 287 | 3300005343 | Ga0070687_100164163 | Ga0070687_1001641631 | 110 |
| 288 | 3300005345 | Ga0070692_10076173 | Ga0070692_100761733 | 110 |
| 289 | 3300005347 | Ga0070668_100176747 | Ga0070668_1001767472 | 110 |
| 290 | 3300005353 | Ga0070669_100078799 | Ga0070669_1000787992 | 110 |
| 291 | 3300005354 | Ga0070675_100616294 | Ga0070675_1006162942 | 110 |
| 292 | 3300005355 | Ga0070671_100307216 | Ga0070671_1003072162 | 110 |
| 293 | 3300005356 | Ga0070674_100122177 | Ga0070674_1001221773 | 110 |
| 294 | 3300005364 | Ga0070673_100678921 | Ga0070673_1006789211 | 110 |
| 295 | 3300005365 | Ga0070688_100092695 | Ga0070688_1000926953 | 110 |
| 296 | 3300005366 | Ga0070659_100105626 | Ga0070659_1001056262 | 110 |
| 297 | 3300005367 | Ga0070667_100028679 | Ga0070667_1000286795 | 110 |
| 298 | 3300005367 | Ga0070667_100790535 | Ga0070667_1007905352 | 110 |
| 299 | 3300005435 | Ga0070714_100043181 | Ga0070714_1000431812 | 110 |
| 300 | 3300005435 | Ga0070714_101564329 | Ga0070714_1015643291 | 110 |
| 301 | 3300005436 | Ga0070713_100043972 | Ga0070713_1000439722 | 110 |
| 302 | 3300005436 | Ga0070713_100136697 | Ga0070713_1001366972 | 110 |
| 303 | 3300005437 | Ga0070710_10016561 | Ga0070710_100165614 | 110 |
| 304 | 3300005437 | Ga0070710_10088851 | Ga0070710_100888512 | 110 |
| 305 | 3300005437 | Ga0070710_10270612 | Ga0070710_102706122 | 110 |
| 306 | 3300005438 | Ga0070701_10015207 | Ga0070701_100152074 | 110 |
| 307 | 3300005439 | Ga0070711_100010256 | Ga0070711_1000102566 | 110 |
| 308 | 3300005439 | Ga0070711_100135471 | Ga0070711_1001354713 | 110 |
| 309 | 3300005439 | Ga0070711_100320627 | Ga0070711_1003206271 | 110 |
| 310 | 3300005439 | Ga0070711_101857610 | Ga0070711_1018576101 | 110 |
| 311 | 3300005441 | Ga0070700_100016035 | Ga0070700_1000160352 | 110 |
| 312 | 3300005444 | Ga0070694_100172876 | Ga0070694_1001728761 | 110 |
| 313 | 3300005444 | Ga0070694_100209186 | Ga0070694_1002091862 | 110 |
| 314 | 3300005445 | Ga0070708_100338691 | Ga0070708_1003386912 | 110 |
| 315 | 3300005456 | Ga0070678_100071005 | Ga0070678_1000710054 | 110 |
| 316 | 3300005457 | Ga0070662_100018453 | Ga0070662_1000184534 | 110 |
| 317 | 3300005457 | Ga0070662_101340874 | Ga0070662_1013408741 | 110 |
| 318 | 3300005459 | Ga0068867_100026541 | Ga0068867_1000265412 | 110 |
| 319 | 3300005466 | Ga0070685_10400288 | Ga0070685_104002882 | 110 |
| 320 | 3300005467 | Ga0070706_100625975 | Ga0070706_1006259752 | 110 |
| 321 | 3300005467 | Ga0070706_101010710 | Ga0070706_1010107102 | 110 |
| 322 | 3300005518 | Ga0070699_100003835 | Ga0070699_1000038352 | 110 |
| 323 | 3300005535 | Ga0070684_100316243 | Ga0070684_1003162431 | 110 |
| 324 | 3300005535 | Ga0070684_100826829 | Ga0070684_1008268292 | 110 |
| 325 | 3300005536 | Ga0070697_101003233 | Ga0070697_1010032332 | 110 |
| 326 | 3300005536 | Ga0070697_101487948 | Ga0070697_1014879481 | 110 |
| 327 | 3300005539 | Ga0068853_101435594 | Ga0068853_1014355942 | 110 |
| 328 | 3300005543 | Ga0070672_100059208 | Ga0070672_1000592083 | 110 |
| 329 | 3300005544 | Ga0070686_100203823 | Ga0070686_1002038231 | 110 |
| 330 | 3300005546 | Ga0070696_100545893 | Ga0070696_1005458932 | 110 |
| 331 | 3300005548 | Ga0070665_100358778 | Ga0070665_1003587782 | 110 |
| 332 | 3300005549 | Ga0070704_100058330 | Ga0070704_1000583303 | 110 |
| 333 | 3300005549 | Ga0070704_100196352 | Ga0070704_1001963522 | 110 |
| 334 | 3300005549 | Ga0070704_100280070 | Ga0070704_1002800701 | 110 |
| 335 | 3300005564 | Ga0070664_100559888 | Ga0070664_1005598882 | 110 |
| 336 | 3300005615 | Ga0070702_100026311 | Ga0070702_1000263112 | 110 |
| 337 | 3300005615 | Ga0070702_101177261 | Ga0070702_1011772611 | 110 |
| 338 | 3300005616 | Ga0068852_100510313 | Ga0068852_1005103132 | 110 |
| 339 | 3300005617 | Ga0068859_100673676 | Ga0068859_1006736762 | 110 |
| 340 | 3300005618 | Ga0068864_100084294 | Ga0068864_1000842942 | 110 |
| 341 | 3300005719 | Ga0068861_100496336 | Ga0068861_1004963361 | 110 |
| 342 | 3300005834 | Ga0068851_10106126 | Ga0068851_101061262 | 110 |
| 343 | 3300005840 | Ga0068870_10117558 | Ga0068870_101175582 | 110 |
| 344 | 3300005841 | Ga0068863_100030734 | Ga0068863_1000307344 | 110 |
| 345 | 3300005842 | Ga0068858_100079754 | Ga0068858_1000797544 | 110 |
| 346 | 3300005843 | Ga0068860_100005826 | Ga0068860_1000058263 | 110 |
| 347 | 3300005844 | Ga0068862_100092258 | Ga0068862_1000922583 | 110 |
| 348 | 3300005937 | Ga0081455_10001050 | Ga0081455_1000105021 | 110 |
| 349 | 3300005937 | Ga0081455_10031856 | Ga0081455_100318563 | 110 |
| 350 | 3300005937 | Ga0081455_10036607 | Ga0081455_100366075 | 110 |
| 351 | 3300005937 | Ga0081455_10757094 | Ga0081455_107570941 | 110 |
| 352 | 3300005981 | Ga0081538_10016926 | Ga0081538_100169265 | 110 |
| 353 | 3300005981 | Ga0081538_10116180 | Ga0081538_101161802 | 110 |
| 354 | 3300005983 | Ga0081540_1008191 | Ga0081540_10081917 | 110 |
| 355 | 3300006028 | Ga0070717_10007808 | Ga0070717_100078084 | 110 |
| 356 | 3300006028 | Ga0070717_10082576 | Ga0070717_100825762 | 110 |
| 357 | 3300006028 | Ga0070717_10128140 | Ga0070717_101281402 | 110 |
| 358 | 3300006028 | Ga0070717_10367293 | Ga0070717_103672932 | 110 |
| 359 | 3300006028 | Ga0070717_11509956 | Ga0070717_115099562 | 110 |
| 360 | 3300006038 | Ga0075365_10036002 | Ga0075365_100360023 | 110 |
| 361 | 3300006038 | Ga0075365_10076788 | Ga0075365_100767882 | 110 |
| 362 | 3300006038 | Ga0075365_10266999 | Ga0075365_102669992 | 110 |
| 363 | 3300006038 | Ga0075365_10869090 | Ga0075365_108690901 | 110 |
| 364 | 3300006038 | Ga0075365_11076423 | Ga0075365_110764231 | 110 |
| 365 | 3300006048 | Ga0075363_100903323 | Ga0075363_1009033231 | 110 |
| 366 | 3300006051 | Ga0075364_10140744 | Ga0075364_101407441 | 110 |
| 367 | 3300006163 | Ga0070715_10001812 | Ga0070715_100018128 | 110 |
| 368 | 3300006163 | Ga0070715_10043541 | Ga0070715_100435413 | 110 |
| 369 | 3300006163 | Ga0070715_10598220 | Ga0070715_105982202 | 110 |
| 370 | 3300006173 | Ga0070716_100178179 | Ga0070716_1001781791 | 110 |
| 371 | 3300006175 | Ga0070712_100002532 | Ga0070712_1000025327 | 110 |
| 372 | 3300006175 | Ga0070712_100117576 | Ga0070712_1001175762 | 110 |
| 373 | 3300006177 | Ga0075362_10048763 | Ga0075362_100487633 | 110 |
| 374 | 3300006178 | Ga0075367_10138723 | Ga0075367_101387232 | 110 |
| 375 | 3300006237 | Ga0097621_100347890 | Ga0097621_1003478902 | 110 |
| 376 | 3300006358 | Ga0068871_100005812 | Ga0068871_1000058127 | 110 |
| 377 | 3300006358 | Ga0068871_100463965 | Ga0068871_1004639652 | 110 |
| 378 | 3300006844 | Ga0075428_100696028 | Ga0075428_1006960282 | 110 |
| 379 | 3300006846 | Ga0075430_100000039 | Ga0075430_1000000393 | 110 |
| 380 | 3300006847 | Ga0075431_100028614 | Ga0075431_1000286142 | 110 |
| 381 | 3300006847 | Ga0075431_100313239 | Ga0075431_1003132392 | 110 |
| 382 | 3300006847 | Ga0075431_100664210 | Ga0075431_1006642101 | 110 |
| 383 | 3300006852 | Ga0075433_10091548 | Ga0075433_100915482 | 110 |
| 384 | 3300006871 | Ga0075434_100020016 | Ga0075434_1000200162 | 110 |
| 385 | 3300006871 | Ga0075434_101643372 | Ga0075434_1016433721 | 110 |
| 386 | 3300006880 | Ga0075429_100295656 | Ga0075429_1002956562 | 110 |
| 387 | 3300006881 | Ga0068865_100323405 | Ga0068865_1003234051 | 110 |
| 388 | 3300006914 | Ga0075436_100172172 | Ga0075436_1001721722 | 110 |
| 389 | 3300006931 | Ga0097620_100673670 | Ga0097620_1006736702 | 110 |
| 390 | 3300007076 | Ga0075435_100229392 | Ga0075435_1002293922 | 110 |
| 391 | 3300007076 | Ga0075435_101350281 | Ga0075435_1013502811 | 110 |
| 392 | 3300007076 | Ga0075435_101383038 | Ga0075435_1013830382 | 110 |
| 393 | 3300007265 | Ga0099794_10027634 | Ga0099794_100276342 | 110 |
| 394 | 3300009011 | Ga0105251_10383070 | Ga0105251_103830702 | 110 |
| 395 | 3300009092 | Ga0105250_10185307 | Ga0105250_101853071 | 110 |
| 396 | 3300009094 | Ga0111539_10345688 | Ga0111539_103456882 | 110 |
| 397 | 3300009094 | Ga0111539_10413885 | Ga0111539_104138852 | 110 |
| 398 | 3300009094 | Ga0111539_10759691 | Ga0111539_107596911 | 110 |
| 399 | 3300009094 | Ga0111539_11514860 | Ga0111539_115148602 | 110 |
| 400 | 3300009094 | Ga0111539_12333532 | Ga0111539_123335322 | 110 |
| 401 | 3300009098 | Ga0105245_10020462 | Ga0105245_100204624 | 110 |
| 402 | 3300009101 | Ga0105247_10009951 | Ga0105247_100099515 | 110 |
| 403 | 3300009101 | Ga0105247_11321689 | Ga0105247_113216891 | 110 |
| 404 | 3300009147 | Ga0114129_10002765 | Ga0114129_1000276522 | 110 |
| 405 | 3300009147 | Ga0114129_10444493 | Ga0114129_104444932 | 110 |
| 406 | 3300009147 | Ga0114129_10622678 | Ga0114129_106226782 | 110 |
| 407 | 3300009147 | Ga0114129_10978388 | Ga0114129_109783881 | 110 |
| 408 | 3300009148 | Ga0105243_10043710 | Ga0105243_100437102 | 110 |
| 409 | 3300009148 | Ga0105243_10820117 | Ga0105243_108201171 | 110 |
| 410 | 3300009176 | Ga0105242_10084073 | Ga0105242_100840732 | 110 |
| 411 | 3300009176 | Ga0105242_12030499 | Ga0105242_120304991 | 110 |
| 412 | 3300009177 | Ga0105248_10763499 | Ga0105248_107634991 | 110 |
| 413 | 3300009553 | Ga0105249_10068118 | Ga0105249_100681181 | 110 |
| 414 | 3300009553 | Ga0105249_10693943 | Ga0105249_106939432 | 110 |
| 415 | 3300010375 | Ga0105239_10043720 | Ga0105239_100437202 | 110 |
| 416 | 3300010375 | Ga0105239_10127756 | Ga0105239_101277561 | 110 |
| 417 | 3300011119 | Ga0105246_10047575 | Ga0105246_100475754 | 110 |
| 418 | 3300011119 | Ga0105246_12502838 | Ga0105246_125028382 | 110 |
| 419 | 3300013105 | Ga0157369_11653364 | Ga0157369_116533641 | 110 |
| 420 | 3300013296 | Ga0157374_10052111 | Ga0157374_100521113 | 110 |
| 421 | 3300013297 | Ga0157378_10345717 | Ga0157378_103457172 | 110 |
| 422 | 3300013306 | Ga0163162_10970434 | Ga0163162_109704342 | 110 |
| 423 | 3300013306 | Ga0163162_11194776 | Ga0163162_111947761 | 110 |
| 424 | 3300013308 | Ga0157375_10135295 | Ga0157375_101352953 | 110 |
| 425 | 3300014325 | Ga0163163_10601423 | Ga0163163_106014232 | 110 |
| 426 | 3300014325 | Ga0163163_12323049 | Ga0163163_123230492 | 110 |
| 427 | 3300014326 | Ga0157380_12487736 | Ga0157380_124877362 | 110 |
| 428 | 3300014745 | Ga0157377_10324174 | Ga0157377_103241741 | 110 |
| 429 | 3300014968 | Ga0157379_10080414 | Ga0157379_100804141 | 110 |
| 430 | 3300014969 | Ga0157376_10809569 | Ga0157376_108095692 | 110 |
| 431 | 3300017792 | Ga0163161_10052402 | Ga0163161_100524023 | 110 |
| 432 | 3300021361 | Ga0213872_10082248 | Ga0213872_100822482 | 110 |
| 433 | 3300021377 | Ga0213874_10014735 | Ga0213874_100147353 | 110 |
| 434 | 3300025315 | Ga0207697_10084111 | Ga0207697_100841111 | 110 |
| 435 | 3300025321 | Ga0207656_10051821 | Ga0207656_100518212 | 110 |
| 436 | 3300025900 | Ga0207710_10009117 | Ga0207710_100091172 | 110 |
| 437 | 3300025901 | Ga0207688_10000528 | Ga0207688_1000052814 | 110 |
| 438 | 3300025904 | Ga0207647_10161748 | Ga0207647_101617481 | 110 |
| 439 | 3300025905 | Ga0207685_10015951 | Ga0207685_100159514 | 110 |
| 440 | 3300025906 | Ga0207699_10810008 | Ga0207699_108100081 | 110 |
| 441 | 3300025910 | Ga0207684_10018238 | Ga0207684_100182382 | 110 |
| 442 | 3300025910 | Ga0207684_10369160 | Ga0207684_103691602 | 110 |
| 443 | 3300025911 | Ga0207654_10569638 | Ga0207654_105696381 | 110 |
| 444 | 3300025914 | Ga0207671_10452173 | Ga0207671_104521731 | 110 |
| 445 | 3300025915 | Ga0207693_10004530 | Ga0207693_100045306 | 110 |
| 446 | 3300025915 | Ga0207693_10010765 | Ga0207693_100107654 | 110 |
| 447 | 3300025915 | Ga0207693_10045969 | Ga0207693_100459692 | 110 |
| 448 | 3300025916 | Ga0207663_10100684 | Ga0207663_101006842 | 110 |
| 449 | 3300025916 | Ga0207663_10193064 | Ga0207663_101930642 | 110 |
| 450 | 3300025916 | Ga0207663_10758700 | Ga0207663_107587001 | 110 |
| 451 | 3300025918 | Ga0207662_10024468 | Ga0207662_100244683 | 110 |
| 452 | 3300025919 | Ga0207657_10073936 | Ga0207657_100739364 | 110 |
| 453 | 3300025920 | Ga0207649_10148584 | Ga0207649_101485842 | 110 |
| 454 | 3300025922 | Ga0207646_10443594 | Ga0207646_104435942 | 110 |
| 455 | 3300025925 | Ga0207650_10002055 | Ga0207650_100020553 | 110 |
| 456 | 3300025926 | Ga0207659_10138330 | Ga0207659_101383302 | 110 |
| 457 | 3300025928 | Ga0207700_10032531 | Ga0207700_100325314 | 110 |
| 458 | 3300025928 | Ga0207700_10204810 | Ga0207700_102048103 | 110 |
| 459 | 3300025928 | Ga0207700_10220634 | Ga0207700_102206343 | 110 |
| 460 | 3300025931 | Ga0207644_10305312 | Ga0207644_103053121 | 110 |
| 461 | 3300025931 | Ga0207644_10370633 | Ga0207644_103706331 | 110 |
| 462 | 3300025933 | Ga0207706_10005066 | Ga0207706_100050661 | 110 |
| 463 | 3300025933 | Ga0207706_11031716 | Ga0207706_110317162 | 110 |
| 464 | 3300025934 | Ga0207686_10548648 | Ga0207686_105486482 | 110 |
| 465 | 3300025935 | Ga0207709_10228008 | Ga0207709_102280082 | 110 |
| 466 | 3300025936 | Ga0207670_10124786 | Ga0207670_101247863 | 110 |
| 467 | 3300025937 | Ga0207669_10610586 | Ga0207669_106105862 | 110 |
| 468 | 3300025938 | Ga0207704_10853766 | Ga0207704_108537662 | 110 |
| 469 | 3300025939 | Ga0207665_10002938 | Ga0207665_1000293815 | 110 |
| 470 | 3300025940 | Ga0207691_10011323 | Ga0207691_100113234 | 110 |
| 471 | 3300025942 | Ga0207689_10006443 | Ga0207689_100064435 | 110 |
| 472 | 3300025944 | Ga0207661_10433613 | Ga0207661_104336132 | 110 |
| 473 | 3300025945 | Ga0207679_10590121 | Ga0207679_105901212 | 110 |
| 474 | 3300025961 | Ga0207712_10056046 | Ga0207712_100560462 | 110 |
| 475 | 3300025961 | Ga0207712_10396083 | Ga0207712_103960832 | 110 |
| 476 | 3300025972 | Ga0207668_10090173 | Ga0207668_100901731 | 110 |
| 477 | 3300025986 | Ga0207658_10297954 | Ga0207658_102979541 | 110 |
| 478 | 3300026023 | Ga0207677_10866247 | Ga0207677_108662472 | 110 |
| 479 | 3300026041 | Ga0207639_10879180 | Ga0207639_108791801 | 110 |
| 480 | 3300026067 | Ga0207678_10022498 | Ga0207678_100224981 | 110 |
| 481 | 3300026067 | Ga0207678_10512161 | Ga0207678_105121611 | 110 |
| 482 | 3300026075 | Ga0207708_10024764 | Ga0207708_100247644 | 110 |
| 483 | 3300026088 | Ga0207641_10453756 | Ga0207641_104537562 | 110 |
| 484 | 3300026089 | Ga0207648_10023078 | Ga0207648_100230783 | 110 |
| 485 | 3300026095 | Ga0207676_10814658 | Ga0207676_108146581 | 110 |
| 486 | 3300026095 | Ga0207676_12562197 | Ga0207676_125621971 | 110 |
| 487 | 3300026116 | Ga0207674_10196776 | Ga0207674_101967762 | 110 |
| 488 | 3300026118 | Ga0207675_100017638 | Ga0207675_1000176384 | 110 |
| 489 | 3300026121 | Ga0207683_10091494 | Ga0207683_100914942 | 110 |
| 490 | 3300026142 | Ga0207698_10844744 | Ga0207698_108447441 | 110 |
| 491 | 3300027907 | Ga0207428_10039150 | Ga0207428_100391502 | 110 |
| 492 | 3300028379 | Ga0268266_10189851 | Ga0268266_101898512 | 110 |
| 493 | 3300028380 | Ga0268265_10250938 | Ga0268265_102509382 | 110 |
| 494 | 3300028381 | Ga0268264_11144026 | Ga0268264_111440262 | 110 |
| 495 | 3300035112 | Ga0373932_0019664 | Ga0373932_0019664_164_496 | 110 |
| 496 | 3300035113 | Ga0373936_0087368 | Ga0373936_0087368_890_1222 | 110 |
| 497 | 3300035115 | Ga0373941_0204683 | Ga0373941_0204683_209_541 | 110 |
| 498 | 3300035116 | Ga0373945_0019539 | Ga0373945_0019539_891_1223 | 110 |
| 499 | 3300035116 | Ga0373945_0020534 | Ga0373945_0020534_1146_1478 | 110 |
| 500 | 3300035119 | Ga0373956_0211162 | Ga0373956_0211162_92_424 | 110 |
| 501 | 3300035170 | Ga0373943_0224694 | Ga0373943_0224694_638_1000 | 110 |
| 502 | 3300035691 | Ga0373931_0154642 | Ga0373931_0154642_132_494 | 110 |
| 503 | 3300035695 | Ga0373927_0088057 | Ga0373927_0088057_1585_1917 | 110 |
| 504 | 3300035695 | Ga0373927_0296286 | Ga0373927_0296286_429_791 | 110 |
| 505 | 3300035725 | Ga0373947_0209273 | Ga0373947_0209273_755_1087 | 110 |
| 506 | 3300037068 | Ga0373925_0104160 | Ga0373925_0104160_1709_2041 | 110 |
| 507 | 3300037068 | Ga0373925_0373950 | Ga0373925_0373950_428_760 | 110 |
| 508 | 3300037471 | Ga0395905_0214941 | Ga0395905_0214941_1332_1727 | 110 |
| 509 | 3300038443 | Ga0395901_0479131 | Ga0395901_0479131_558_953 | 110 |
| 510 | 3300039447 | Ga0436361_0639384 | Ga0436361_0639384_4758_5090 | 110 |
| 511 | 3300039450 | Ga0436363_1532208 | Ga0436363_1532208_1011_1343 | 110 |
| 512 | 3300041501 | Ga0451845_0831721 | Ga0451845_0831721_58_390 | 110 |
| 513 | 3300041512 | Ga0451853_3488713 | Ga0451853_3488713_85_423 | 110 |
| 514 | 3300046455 | Ga0495603_0051374 | Ga0495603_0051374_819_1151 | 110 |
| 515 | 3300046459 | Ga0495629_0141734 | Ga0495629_0141734_629_961 | 110 |
| 516 | 3300046461 | Ga0495641_0041672 | Ga0495641_0041672_1600_1932 | 110 |
| 517 | 3300046473 | Ga0495582_0051730 | Ga0495582_0051730_231_563 | 110 |
| 518 | 3300046474 | Ga0495605_0452495 | Ga0495605_0452495_138_470 | 110 |
| 519 | 3300046475 | Ga0495639_0381869 | Ga0495639_0381869_244_606 | 110 |
| 520 | 3300046491 | Ga0495584_0117253 | Ga0495584_0117253_73_405 | 110 |
| 521 | 3300046499 | Ga0495594_0747733 | Ga0495594_0747733_131_493 | 110 |
| 522 | 3300046514 | Ga0495618_0278763 | Ga0495618_0278763_373_705 | 110 |
| 523 | 3300046515 | Ga0495620_0161149 | Ga0495620_0161149_526_858 | 110 |
| 524 | 3300046517 | Ga0495630_0349614 | Ga0495630_0349614_312_644 | 110 |
| 525 | 3300046519 | Ga0495632_0068499 | Ga0495632_0068499_742_1074 | 110 |
| 526 | 3300046520 | Ga0495637_0147662 | Ga0495637_0147662_478_810 | 110 |
| 527 | 3300046528 | Ga0495642_0194048 | Ga0495642_0194048_221_553 | 110 |
| 528 | 3300046529 | Ga0495652_0288669 | Ga0495652_0288669_598_930 | 110 |
| 529 | 3300046537 | Ga0495598_0051214 | Ga0495598_0051214_694_1026 | 110 |
| 530 | 3300046538 | Ga0495609_0273624 | Ga0495609_0273624_39_371 | 110 |
| 531 | 3300046543 | Ga0495645_0460547 | Ga0495645_0460547_277_609 | 110 |
| 532 | 3300046557 | Ga0495622_0096739 | Ga0495622_0096739_579_911 | 110 |
| 533 | 3300046558 | Ga0495633_0267895 | Ga0495633_0267895_287_619 | 110 |
| 534 | 3300046559 | Ga0495667_0583292 | Ga0495667_0583292_104_436 | 110 |
| 535 | 3300046615 | Ga0495656_0173484 | Ga0495656_0173484_88_420 | 110 |
| 536 | 3300046616 | Ga0495668_0129758 | Ga0495668_0129758_541_873 | 110 |
| 537 | 3300046642 | Ga0495634_0306084 | Ga0495634_0306084_607_939 | 110 |
| 538 | 3300046663 | Ga0495635_0692687 | Ga0495635_0692687_243_575 | 110 |
| 539 | 3300046664 | Ga0495659_0261827 | Ga0495659_0261827_278_610 | 110 |
| 540 | 3300046674 | Ga0495588_0772055 | Ga0495588_0772055_122_484 | 110 |
| 541 | 3300046681 | Ga0495647_0093683 | Ga0495647_0093683_585_917 | 110 |
| 542 | 3300046681 | Ga0495647_0162975 | Ga0495647_0162975_92_424 | 110 |
| 543 | 3300046683 | Ga0495658_0065237 | Ga0495658_0065237_1237_1569 | 110 |
| 544 | 3300046683 | Ga0495658_0089234 | Ga0495658_0089234_322_654 | 110 |
| 545 | 3300046684 | Ga0495669_0060058 | Ga0495669_0060058_66_398 | 110 |
| 546 | 3300046689 | Ga0495613_0124178 | Ga0495613_0124178_782_1114 | 110 |
| 547 | 3300046689 | Ga0495613_0466158 | Ga0495613_0466158_54_386 | 110 |
| 548 | 3300046690 | Ga0495624_0034557 | Ga0495624_0034557_1776_2108 | 110 |
| 549 | 3300046690 | Ga0495624_0427297 | Ga0495624_0427297_289_621 | 110 |
| 550 | 3300046691 | Ga0495670_0358020 | Ga0495670_0358020_197_529 | 110 |
| 551 | 3300046692 | Ga0495671_0250068 | Ga0495671_0250068_190_522 | 110 |
| 552 | 3300046794 | Ga0495589_0120418 | Ga0495589_0120418_194_526 | 110 |
| 553 | 3300046810 | Ga0495660_0140379 | Ga0495660_0140379_420_752 | 110 |
| 554 | 3300047315 | Ga0495581_0120374 | Ga0495581_0120374_1178_1510 | 110 |
| 555 | 3300047319 | Ga0495674_1264996 | Ga0495674_1264996_194_526 | 110 |
| 556 | 3300047322 | Ga0495680_0619742 | Ga0495680_0619742_338_670 | 110 |
| 557 | 3300047445 | Ga0495677_0210726 | Ga0495677_0210726_52_384 | 110 |
| 558 | 3300047470 | Ga0495681_0283853 | Ga0495681_0283853_110_442 | 110 |
| 559 | 3300047673 | Ga0495593_0420510 | Ga0495593_0420510_224_556 | 110 |
| 560 | 3300048090 | Ga0495615_0088278 | Ga0495615_0088278_220_552 | 110 |
| 561 | 3300048903 | Ga0496100_0069482 | Ga0496100_0069482_739_1143 | 110 |
| 562 | 3300048904 | Ga0496101_0012045 | Ga0496101_0012045_2138_2470 | 110 |
| 563 | 3300048904 | Ga0496101_0463044 | Ga0496101_0463044_182_514 | 110 |
| 564 | 3300048905 | Ga0496102_0020204 | Ga0496102_0020204_1095_1427 | 110 |
| 565 | 3300048905 | Ga0496102_0055176 | Ga0496102_0055176_574_978 | 110 |
| 566 | 3300048905 | Ga0496102_0160511 | Ga0496102_0160511_1592_1924 | 110 |
| 567 | 3300048906 | Ga0496103_0033206 | Ga0496103_0033206_182_514 | 110 |
| 568 | 3300048906 | Ga0496103_0137446 | Ga0496103_0137446_50_454 | 110 |
| 569 | 3300048907 | Ga0496104_0010954 | Ga0496104_0010954_1375_1707 | 110 |
| 570 | 3300048908 | Ga0496105_0025914 | Ga0496105_0025914_3611_3943 | 110 |
| 571 | 3300048908 | Ga0496105_0215875 | Ga0496105_0215875_1038_1370 | 110 |
| 572 | 3300048909 | Ga0496106_0023831 | Ga0496106_0023831_637_969 | 110 |
| 573 | 3300048909 | Ga0496106_0565967 | Ga0496106_0565967_411_743 | 110 |
| 574 | 3300048909 | Ga0496106_0644718 | Ga0496106_0644718_137_541 | 110 |
| 575 | 3300048910 | Ga0496107_0076503 | Ga0496107_0076503_404_736 | 110 |
| 576 | 3300048910 | Ga0496107_0447594 | Ga0496107_0447594_88_492 | 110 |
| 577 | 3300048911 | Ga0496108_0030831 | Ga0496108_0030831_1611_1943 | 110 |
| 578 | 3300048911 | Ga0496108_0241429 | Ga0496108_0241429_518_850 | 110 |
| 579 | 3300048912 | Ga0496109_0002836 | Ga0496109_0002836_8848_9180 | 110 |
| 580 | 3300048912 | Ga0496109_0784951 | Ga0496109_0784951_518_850 | 110 |
| 581 | 3300048913 | Ga0496110_0001434 | Ga0496110_0001434_4515_4847 | 110 |
| 582 | 3300048913 | Ga0496110_0286904 | Ga0496110_0286904_126_530 | 110 |
| 583 | 3300048913 | Ga0496110_0520041 | Ga0496110_0520041_334_666 | 110 |
| 584 | 3300048913 | Ga0496110_0827846 | Ga0496110_0827846_339_671 | 110 |
| 585 | 3300048914 | Ga0496111_0007669 | Ga0496111_0007669_1423_1755 | 110 |
| 586 | 3300048914 | Ga0496111_0057596 | Ga0496111_0057596_1924_2256 | 110 |
| 587 | 3300048914 | Ga0496111_0154954 | Ga0496111_0154954_528_860 | 110 |
| 588 | 3300048914 | Ga0496111_0404421 | Ga0496111_0404421_126_530 | 110 |
| 589 | 3300048915 | Ga0496112_0012499 | Ga0496112_0012499_1159_1491 | 110 |
| 590 | 3300048916 | Ga0496113_0000104 | Ga0496113_0000104_13057_13389 | 110 |
| 591 | 3300048916 | Ga0496113_0366825 | Ga0496113_0366825_150_482 | 110 |
| 592 | 3300048917 | Ga0496114_0100387 | Ga0496114_0100387_1933_2295 | 110 |
| 593 | 3300048917 | Ga0496114_0432591 | Ga0496114_0432591_474_806 | 110 |
| 594 | 3300048917 | Ga0496114_1038463 | Ga0496114_1038463_299_631 | 110 |
| 595 | 3300048918 | Ga0496115_0100820 | Ga0496115_0100820_1690_2022 | 110 |
| 596 | 3300048918 | Ga0496115_0301613 | Ga0496115_0301613_606_1010 | 110 |
| 597 | 3300049568 | Ga0501031_0257218 | Ga0501031_0257218_522_854 | 110 |
| 598 | 3300049572 | Ga0501036_1494659 | Ga0501036_1494659_26_358 | 110 |
| 599 | 3300049575 | Ga0501039_1112595 | Ga0501039_1112595_28_366 | 110 |
| 600 | 3300049576 | Ga0501040_0339248 | Ga0501040_0339248_35_370 | 110 |
| 601 | 3300049577 | Ga0501041_0299390 | Ga0501041_0299390_511_843 | 110 |
| 602 | 3300049592 | Ga0501076_1119386 | Ga0501076_1119386_300_638 | 110 |
| 603 | 3300049743 | Ga0501081_0827523 | Ga0501081_0827523_330_662 | 110 |
| 604 | 3300049824 | Ga0501045_0108584 | Ga0501045_0108584_312_650 | 110 |
| 605 | 3300049824 | Ga0501045_1129993 | Ga0501045_1129993_217_549 | 110 |
| 606 | 3300050489 | nmdc:mga03683_12738_c1 | nmdc:mga03683_12738_c1_2464_2796 | 110 |
| 607 | 3300050489 | nmdc:mga03683_45400_c1 | nmdc:mga03683_45400_c1_93_431 | 110 |
| 608 | 3300050491 | nmdc:mga00v17_388229_c1 | nmdc:mga00v17_388229_c1_74_406 | 110 |
| 609 | 3300050492 | nmdc:mga0yw44_1062210_c1 | nmdc:mga0yw44_1062210_c1_68_400 | 110 |
| 610 | 3300050492 | nmdc:mga0yw44_151434_c1 | nmdc:mga0yw44_151434_c1_526_876 | 110 |
| 611 | 3300050492 | nmdc:mga0yw44_80976_c1 | nmdc:mga0yw44_80976_c1_1348_1680 | 110 |
| 612 | 3300050494 | nmdc:mga06z11_595934_c1 | nmdc:mga06z11_595934_c1_61_393 | 110 |
| 613 | 3300050496 | nmdc:mga07m45_669211_c1 | nmdc:mga07m45_669211_c1_219_551 | 110 |
| 614 | 3300050507 | nmdc:mga05p37_1099605_c1 | nmdc:mga05p37_1099605_c1_39_404 | 110 |
| 615 | 3300050507 | nmdc:mga05p37_569007_c1 | nmdc:mga05p37_569007_c1_652_984 | 110 |
| 616 | 3300050507 | nmdc:mga05p37_6074_c1 | nmdc:mga05p37_6074_c1_3659_3997 | 110 |
| 617 | 3300050508 | nmdc:mga09592_1300430_c1 | nmdc:mga09592_1300430_c1_245_586 | 110 |
| 618 | 3300050508 | nmdc:mga09592_219979_c1 | nmdc:mga09592_219979_c1_604_936 | 110 |
| 619 | 3300050508 | nmdc:mga09592_794934_c1 | nmdc:mga09592_794934_c1_198_530 | 110 |
| 620 | 3300050509 | nmdc:mga0qj67_58_c1 | nmdc:mga0qj67_58_c1_1325_1666 | 110 |
| 621 | 3300050510 | nmdc:mga06r32_127399_c1 | nmdc:mga06r32_127399_c1_2150_2488 | 110 |
| 622 | 3300050510 | nmdc:mga06r32_327054_c1 | nmdc:mga06r32_327054_c1_1163_1501 | 110 |
| 623 | 3300050511 | nmdc:mga08y16_1156074_c1 | nmdc:mga08y16_1156074_c1_179_520 | 110 |
| 624 | 3300050511 | nmdc:mga08y16_261648_c1 | nmdc:mga08y16_261648_c1_828_1193 | 110 |
| 625 | 3300050511 | nmdc:mga08y16_55660_c1 | nmdc:mga08y16_55660_c1_2524_2856 | 110 |
| 626 | 3300050511 | nmdc:mga08y16_687704_c1 | nmdc:mga08y16_687704_c1_329_661 | 110 |
| 627 | 3300050512 | nmdc:mga0n895_54484_c1 | nmdc:mga0n895_54484_c1_553_885 | 110 |
| 628 | 3300050513 | nmdc:mga0rr50_1206659_c1 | nmdc:mga0rr50_1206659_c1_186_518 | 110 |
| 629 | 3300050513 | nmdc:mga0rr50_138991_c1 | nmdc:mga0rr50_138991_c1_720_1124 | 110 |
| 630 | 3300050513 | nmdc:mga0rr50_260982_c1 | nmdc:mga0rr50_260982_c1_1038_1370 | 110 |
| 631 | 3300050513 | nmdc:mga0rr50_422020_c1 | nmdc:mga0rr50_422020_c1_110_442 | 110 |
| 632 | 3300050515 | nmdc:mga0a205_308638_c1 | nmdc:mga0a205_308638_c1_999_1331 | 110 |
| 633 | 3300050515 | nmdc:mga0a205_852219_c1 | nmdc:mga0a205_852219_c1_265_669 | 110 |
| 634 | 3300053077 | Ga0495601_0056897 | Ga0495601_0056897_1432_1764 | 110 |
| 635 | 3300053085 | Ga0495619_0026800 | Ga0495619_0026800_3013_3345 | 110 |
| 636 | 3300053085 | Ga0495619_0363575 | Ga0495619_0363575_571_903 | 110 |
| 637 | 3300054114 | Ga0501084_0479025 | Ga0501084_0479025_94_429 | 110 |
| 638 | 3300054114 | Ga0501084_1368825 | Ga0501084_1368825_134_469 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4y6i-assembly1.cif.gz_B | crystal structure of e.coli cuta1 e61v/c16a/c39a/c79a mutation | 0.9645 | 3 | 104 |
| 1vhf-assembly1.cif.gz_A | crystal structure of periplasmic divalent cation tolerance protein | 0.9639 | 4 | 103 |
| 3ah6-assembly2.cif.gz_F | remarkable improvement of the heat stability of cuta1 from e.coli by rational protein designing | 0.9622 | 3 | 103 |
| 2nuh-assembly1.cif.gz_A | crystal structure of cuta from the phytopathgen bacterium xylella fastidiosa | 0.96 | 3 | 105 |
| 1osc-assembly1.cif.gz_B | crystal structure of rat cuta1 at 2.15 a resolution | 0.9595 | 3 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69488_1_112_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9655 | 3 | 103 | 3.30.70.120 |
| 2nuhA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.96 | 3 | 105 | 3.30.70.120 |
| 1v99F00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9568 | 5 | 105 | 3.30.70.120 |
| 1xk8C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9559 | 3 | 105 | 3.30.70.120 |
| 1p1lA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9559 | 4 | 105 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P8ABG3-F1-model_v4 | Periplasmic divalent cation tolerance protein | 0.9688 | 1 | 104 |
GO:0005507
GO:0010038 |
| AF-A0A1W9QHH9-F1-model_v4 | Divalent-cation tolerance protein CutA | 0.9663 | 2 | 104 |
GO:0005507
GO:0010038 |
| AF-A0A411H1J1-F1-model_v4 | deleted | 0.9658 | 3 | 103 |
|
| AF-A0A2G4YLW0-F1-model_v4 | Divalent-cation tolerance protein CutA | 0.9658 | 3 | 104 |
GO:0005507
GO:0010038 |
| AF-A0A3B0RU92-F1-model_v4 | Periplasmic divalent cation tolerance protein CutA | 0.9657 | 1 | 105 |
GO:0005507
GO:0010038 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar