F471442

General Info

Members Datasets Scaffolds Average Seq Length
637 302 1268 279

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10335876|Ga0307410_103358761
Length 347
Sequence VISDVGIPLSLSFPPAAGATSSPTRAGGRELALRIGFDMQLEMAGPQPTALLLMLDVHPDAARQLDGPPPRIDVTHLGVAPSMTLTSSAPSLLPEPTPLLEPTRLAVEVFTDGFGNRCARVVAPPGMLRLAYDATFRCAYAPEPQPDPTAKQHPAGELASDVLPFLLGSRYCEVDRLSAVAWDLFGRTAPGGARALAVNEWVFKHIHFSYKLTRPNKTALDTYVERNGVCRDMMHLAVTFCRALNIPSRYATGYLGDIDAMDFSAFYEVYLDGRWWPMDARHGKPRVGRVLMARGRDATDVALITSFGRHRLAKFTVVTEEIAAPVEPLLVMSAPPPVAPAPLALSA

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
206 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
290 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
293 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
294 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
298 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
299 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
300 2902330777 Methylobacterium sp. 2A Isolate Unclassified
301 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
302 2928125067 Methylobacterium sp. 1973 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 0
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 3.61
Rhizosphere 90.89
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10335876 3300031852 Bacteria 1203
2 rootH2_10130113 3300003320 Bacteria 2096
3 rootH2_10207294 3300003320 Unclassified 3379
4 Ga0070658_10217556 3300005327 Bacteria 1615
5 Ga0070676_10005349 3300005328 Bacteria 6837
6 Ga0070676_10007227 3300005328 Bacteria 5953
7 Ga0070676_10024488 3300005328 Bacteria 3401
8 Ga0070683_100341514 3300005329 Bacteria 1426
9 Ga0070683_100489953 3300005329 Bacteria 1174
10 Ga0070670_100004301 3300005331 Bacteria 11917
11 Ga0070670_100129992 3300005331 Bacteria 2174
12 Ga0070677_10126667 3300005333 Bacteria 1160
13 Ga0068869_100001279 3300005334 Bacteria 14868
14 Ga0068869_100001892 3300005334 Bacteria 12589
15 Ga0068869_100091929 3300005334 Bacteria 2283
16 Ga0068869_100124587 3300005334 Bacteria 1975
17 Ga0070666_10038722 3300005335 Bacteria 3173
18 Ga0070666_10082785 3300005335 Bacteria 2195
19 Ga0070680_100001876 3300005336 Bacteria 15415
20 Ga0070680_100047771 3300005336 Bacteria 3486
21 Ga0070682_100001070 3300005337 Bacteria 15792
22 Ga0070660_100012388 3300005339 Bacteria 6088
23 Ga0070660_100013053 3300005339 Bacteria 5947
24 Ga0070660_100155308 3300005339 Bacteria 1842
25 Ga0070689_100033972 3300005340 Bacteria 3890
26 Ga0070689_100314139 3300005340 Bacteria 1307
27 Ga0070661_100000504 3300005344 Bacteria 29905
28 Ga0070661_100190154 3300005344 Bacteria 1565
29 Ga0070692_10001107 3300005345 Bacteria 9408
30 Ga0070692_10064056 3300005345 Bacteria 1943
31 Ga0070668_100010681 3300005347 Bacteria 6827
32 Ga0070668_100245119 3300005347 Bacteria 1486
33 Ga0070669_100015563 3300005353 Bacteria 5424
34 Ga0070669_100061925 3300005353 Bacteria 2750
35 Ga0070669_100065533 3300005353 Bacteria 2676
36 Ga0070675_100115509 3300005354 Bacteria 2275
37 Ga0070671_100027995 3300005355 Bacteria 4640
38 Ga0070671_100045085 3300005355 Bacteria 3665
39 Ga0070671_100064437 3300005355 Bacteria 3052
40 Ga0070671_100155812 3300005355 Bacteria 1930
41 Ga0070671_100162380 3300005355 Bacteria 1889
42 Ga0070671_100341264 3300005355 Unclassified 1278
43 Ga0070674_100041236 3300005356 Bacteria 3127
44 Ga0070674_100091112 3300005356 Bacteria 2201
45 Ga0070674_100100229 3300005356 Bacteria 2108
46 Ga0070673_100000849 3300005364 Bacteria 17119
47 Ga0070673_100171325 3300005364 Bacteria 1853
48 Ga0070659_100003709 3300005366 Bacteria 10893
49 Ga0070659_100060963 3300005366 Bacteria 2981
50 Ga0070667_100044686 3300005367 Bacteria 3721
51 Ga0070667_100147561 3300005367 Bacteria 2064
52 Ga0070703_10011385 3300005406 Bacteria 2512
53 Ga0070714_100032689 3300005435 Bacteria 4344
54 Ga0070714_100423723 3300005435 Bacteria 1261
55 Ga0070713_100075988 3300005436 Unclassified 2851
56 Ga0070713_100088586 3300005436 Bacteria 2657
57 Ga0070701_10036086 3300005438 Bacteria 2489
58 Ga0070711_100058392 3300005439 Bacteria 2675
59 Ga0070705_100009123 3300005440 Bacteria 4923
60 Ga0070705_100039622 3300005440 Bacteria 2674
61 Ga0070700_100050756 3300005441 Bacteria 2579
62 Ga0070700_100065988 3300005441 Bacteria 2296
63 Ga0070694_100000078 3300005444 Bacteria 46820
64 Ga0070694_100054850 3300005444 Bacteria 2701
65 Ga0070694_100071716 3300005444 Bacteria 2388
66 Ga0070694_100155926 3300005444 Bacteria 1671
67 Ga0070708_100006158 3300005445 Bacteria 9543
68 Ga0070708_100169359 3300005445 Bacteria 2038
69 Ga0070663_100052556 3300005455 Bacteria 2906
70 Ga0070678_100004644 3300005456 Bacteria 7810
71 Ga0070678_100122837 3300005456 Bacteria 2050
72 Ga0070678_100329621 3300005456 Unclassified 1306
73 Ga0070662_100009292 3300005457 Bacteria 6425
74 Ga0070662_100025694 3300005457 Bacteria 4069
75 Ga0070662_100190087 3300005457 Bacteria 1623
76 Ga0070681_10038941 3300005458 Bacteria 4766
77 Ga0068867_100001164 3300005459 Bacteria 17973
78 Ga0068867_100016694 3300005459 Bacteria 5216
79 Ga0068867_100063792 3300005459 Bacteria 2738
80 Ga0070706_100028601 3300005467 Bacteria 5132
81 Ga0070706_100028865 3300005467 Bacteria 5109
82 Ga0070706_100053010 3300005467 Bacteria 3743
83 Ga0070706_100160913 3300005467 Bacteria 2096
84 Ga0070706_100186523 3300005467 Bacteria 1938
85 Ga0070707_100031204 3300005468 Bacteria 5074
86 Ga0070707_100046289 3300005468 Bacteria 4163
87 Ga0070707_100055671 3300005468 Bacteria 3792
88 Ga0070707_100061038 3300005468 Bacteria 3615
89 Ga0070707_100352454 3300005468 Bacteria 1429
90 Ga0070698_100005791 3300005471 Bacteria 13518
91 Ga0070698_100034982 3300005471 Bacteria 5195
92 Ga0070698_100037944 3300005471 Bacteria 4966
93 Ga0070698_100128976 3300005471 Bacteria 2485
94 Ga0070698_100139269 3300005471 Bacteria 2379
95 Ga0070698_100140087 3300005471 Bacteria 2370
96 Ga0070698_100173476 3300005471 Bacteria 2096
97 Ga0070699_100006895 3300005518 Bacteria 9881
98 Ga0070699_100024693 3300005518 Bacteria 5181
99 Ga0070699_100035480 3300005518 Bacteria 4310
100 Ga0070699_100149183 3300005518 Bacteria 2067
101 Ga0070699_100167196 3300005518 Bacteria 1948
102 Ga0070699_100226557 3300005518 Bacteria 1666
103 Ga0070699_100272760 3300005518 Bacteria 1514
104 Ga0070679_100003671 3300005530 Bacteria 14055
105 Ga0070697_100007154 3300005536 Bacteria 8684
106 Ga0070697_100008872 3300005536 Bacteria 7851
107 Ga0070697_100038642 3300005536 Bacteria 3857
108 Ga0070697_100255545 3300005536 Bacteria 1499
109 Ga0070697_100318759 3300005536 Bacteria 1338
110 Ga0070697_100495839 3300005536 Bacteria 1067
111 Ga0068853_100001886 3300005539 Bacteria 15433
112 Ga0068853_100233455 3300005539 Bacteria 1683
113 Ga0068853_100328313 3300005539 Bacteria 1419
114 Ga0068853_100536320 3300005539 Bacteria 1107
115 Ga0070672_100018224 3300005543 Bacteria 5071
116 Ga0070672_100033474 3300005543 Bacteria 3892
117 Ga0070672_100201506 3300005543 Bacteria 1664
118 Ga0070672_100316605 3300005543 Bacteria 1325
119 Ga0070695_100001053 3300005545 Bacteria 15090
120 Ga0070695_100015297 3300005545 Bacteria 4631
121 Ga0070695_100189435 3300005545 Bacteria 1463
122 Ga0070696_100001856 3300005546 Bacteria 13872
123 Ga0070696_100094622 3300005546 Bacteria 2132
124 Ga0070696_100116228 3300005546 Bacteria 1931
125 Ga0070693_100000468 3300005547 Bacteria 18132
126 Ga0070693_100057726 3300005547 Bacteria 2244
127 Ga0070693_100285096 3300005547 Bacteria 1108
128 Ga0070665_100185057 3300005548 Bacteria 2084
129 Ga0070704_100001294 3300005549 Bacteria 13229
130 Ga0070704_100018104 3300005549 Bacteria 4495
131 Ga0070704_100145590 3300005549 Bacteria 1856
132 Ga0068855_100373922 3300005563 Bacteria 1566
133 Ga0070664_100004039 3300005564 Bacteria 11786
134 Ga0068857_100067114 3300005577 Bacteria 3192
135 Ga0068854_100002457 3300005578 Bacteria 11469
136 Ga0068856_100003246 3300005614 Bacteria 16550
137 Ga0068856_100160591 3300005614 Unclassified 2258
138 Ga0068856_100455109 3300005614 Bacteria 1301
139 Ga0070702_100011080 3300005615 Bacteria 4474
140 Ga0068852_100006482 3300005616 Bacteria 8460
141 Ga0068852_100110985 3300005616 Bacteria 2493
142 Ga0068852_100128378 3300005616 Bacteria 2332
143 Ga0068852_100185007 3300005616 Bacteria 1961
144 Ga0068852_100196560 3300005616 Bacteria 1906
145 Ga0068852_100315671 3300005616 Bacteria 1516
146 Ga0068859_100005409 3300005617 Bacteria 12983
147 Ga0068859_100090615 3300005617 Bacteria 3109
148 Ga0068864_100081712 3300005618 Bacteria 2833
149 Ga0068866_10011277 3300005718 Bacteria 3861
150 Ga0068866_10052929 3300005718 Bacteria 2073
151 Ga0068866_10090428 3300005718 Bacteria 1666
152 Ga0068861_100001625 3300005719 Bacteria 14336
153 Ga0068861_100020523 3300005719 Bacteria 4736
154 Ga0068861_100053741 3300005719 Bacteria 3066
155 Ga0068861_100287761 3300005719 Bacteria 1418
156 Ga0068851_10086810 3300005834 Unclassified 1642
157 Ga0068851_10100886 3300005834 Bacteria 1532
158 Ga0068870_10000045 3300005840 Bacteria 37970
159 Ga0068870_10111706 3300005840 Bacteria 1561
160 Ga0068863_100015679 3300005841 Bacteria 7276
161 Ga0068863_100030749 3300005841 Bacteria 5127
162 Ga0068863_100047851 3300005841 Bacteria 4056
163 Ga0068858_100001778 3300005842 Bacteria 21987
164 Ga0068858_100014514 3300005842 Bacteria 7421
165 Ga0068858_100034171 3300005842 Bacteria 4716
166 Ga0068860_100032641 3300005843 Bacteria 5001
167 Ga0068860_100072929 3300005843 Bacteria 3263
168 Ga0068860_100119584 3300005843 Bacteria 2522
169 Ga0068860_100716945 3300005843 Bacteria 1011
170 Ga0068862_100035825 3300005844 Bacteria 4205
171 Ga0070717_10007402 3300006028 Bacteria 8151
172 Ga0070715_10076198 3300006163 Bacteria 1511
173 Ga0097621_100010835 3300006237 Bacteria 6688
174 Ga0097621_100114078 3300006237 Bacteria 2286
175 Ga0068871_100022478 3300006358 Bacteria 4862
176 Ga0068871_100200288 3300006358 Bacteria 1723
177 Ga0068871_100397000 3300006358 Bacteria 1227
178 Ga0068871_100504533 3300006358 Bacteria 1091
179 Ga0075428_100040116 3300006844 Bacteria 5152
180 Ga0075428_100152375 3300006844 Bacteria 2511
181 Ga0075428_100376112 3300006844 Bacteria 1523
182 Ga0075430_100016287 3300006846 Bacteria 6332
183 Ga0075431_100026522 3300006847 Bacteria 5944
184 Ga0075433_10056793 3300006852 Bacteria 3421
185 Ga0075433_10111985 3300006852 Bacteria 2421
186 Ga0075433_10230551 3300006852 Bacteria 1644
187 Ga0075433_10236028 3300006852 Bacteria 1623
188 Ga0075434_100012903 3300006871 Bacteria 7936
189 Ga0075434_100036492 3300006871 Bacteria 4862
190 Ga0075434_100052026 3300006871 Bacteria 4069
191 Ga0075434_100060624 3300006871 Bacteria 3763
192 Ga0075434_100188723 3300006871 Bacteria 2081
193 Ga0075429_100010351 3300006880 Bacteria 8069
194 Ga0075429_100023806 3300006880 Bacteria 5313
195 Ga0075429_100038802 3300006880 Bacteria 4146
196 Ga0075429_100064546 3300006880 Bacteria 3189
197 Ga0068865_100009668 3300006881 Bacteria 5981
198 Ga0075436_100018647 3300006914 Bacteria 4749
199 Ga0075436_100040576 3300006914 Bacteria 3211
200 Ga0097620_100005409 3300006931 Bacteria 12983
201 Ga0097620_100090613 3300006931 Bacteria 3109
202 Ga0075435_100008448 3300007076 Bacteria 7389
203 Ga0075435_100048009 3300007076 Bacteria 3428
204 Ga0075435_100072472 3300007076 Bacteria 2814
205 Ga0099794_10004497 3300007265 Bacteria 5490
206 Ga0099794_10024740 3300007265 Bacteria 2759
207 Ga0099794_10055535 3300007265 Bacteria 1914
208 Ga0105240_10012842 3300009093 Bacteria 11538
209 Ga0105240_10527100 3300009093 Bacteria 1310
210 Ga0111539_10180060 3300009094 Bacteria 2469
211 Ga0111539_10297610 3300009094 Bacteria 1878
212 Ga0111539_10361913 3300009094 Bacteria 1688
213 Ga0105245_10007658 3300009098 Bacteria 9459
214 Ga0105245_10105182 3300009098 Bacteria 2618
215 Ga0105245_10105631 3300009098 Unclassified 2612
216 Ga0105245_10119601 3300009098 Unclassified 2459
217 Ga0105245_10604441 3300009098 Bacteria 1123
218 Ga0114129_10042481 3300009147 Bacteria 6402
219 Ga0114129_10042555 3300009147 Bacteria 6395
220 Ga0114129_10050104 3300009147 Bacteria 5867
221 Ga0114129_10050641 3300009147 Bacteria 5833
222 Ga0114129_10371935 3300009147 Bacteria 1889
223 Ga0105243_10160417 3300009148 Bacteria 1938
224 Ga0105241_10006140 3300009174 Bacteria 8858
225 Ga0105241_10007897 3300009174 Bacteria 7821
226 Ga0105241_10059455 3300009174 Bacteria 2939
227 Ga0105242_10022664 3300009176 Bacteria 4943
228 Ga0105242_10052108 3300009176 Bacteria 3338
229 Ga0105242_10060924 3300009176 Bacteria 3103
230 Ga0105242_10149662 3300009176 Bacteria 2034
231 Ga0105248_10004175 3300009177 Bacteria 15956
232 Ga0105248_10040840 3300009177 Bacteria 5200
233 Ga0105248_10067640 3300009177 Bacteria 4011
234 Ga0105248_10094248 3300009177 Bacteria 3372
235 Ga0105248_10108951 3300009177 Bacteria 3123
236 Ga0105248_10429971 3300009177 Bacteria 1487
237 Ga0105237_10028631 3300009545 Bacteria 5672
238 Ga0105237_10175822 3300009545 Bacteria 2141
239 Ga0105237_10298921 3300009545 Bacteria 1613
240 Ga0105238_10017862 3300009551 Bacteria 7211
241 Ga0105249_10284899 3300009553 Bacteria 1651
242 Ga0105249_10470997 3300009553 Bacteria 1297
243 Ga0105249_10818706 3300009553 Bacteria 996
244 Ga0105239_10008518 3300010375 Bacteria 11657
245 Ga0105239_10112145 3300010375 Bacteria 3023
246 Ga0105239_10254640 3300010375 Bacteria 1972
247 Ga0105239_10262008 3300010375 Unclassified 1943
248 Ga0105239_10302045 3300010375 Bacteria 1803
249 Ga0105239_10656968 3300010375 Unclassified 1198
250 Ga0105246_10366185 3300011119 Unclassified 1186
251 Ga0157373_10003370 3300013100 Bacteria 12086
252 Ga0157371_10045554 3300013102 Bacteria 3120
253 Ga0157371_10199256 3300013102 Bacteria 1435
254 Ga0157369_10011367 3300013105 Bacteria 10110
255 Ga0157369_10021060 3300013105 Bacteria 7289
256 Ga0157369_10061575 3300013105 Bacteria 4045
257 Ga0157369_10141250 3300013105 Unclassified 2548
258 Ga0157374_10004715 3300013296 Bacteria 11447
259 Ga0157374_10038681 3300013296 Bacteria 4386
260 Ga0157374_10058243 3300013296 Bacteria 3610
261 Ga0157374_10096016 3300013296 Bacteria 2835
262 Ga0157374_10172547 3300013296 Unclassified 2110
263 Ga0157374_10259549 3300013296 Bacteria 1711
264 Ga0157378_10045131 3300013297 Bacteria 3916
265 Ga0163162_10004710 3300013306 Bacteria 13151
266 Ga0163162_10044511 3300013306 Bacteria 4446
267 Ga0157372_10000772 3300013307 Bacteria 34627
268 Ga0157372_10066245 3300013307 Bacteria 4057
269 Ga0157372_10129678 3300013307 Bacteria 2900
270 Ga0157372_10221264 3300013307 Bacteria 2194
271 Ga0157375_10002273 3300013308 Bacteria 16621
272 Ga0157375_10012321 3300013308 Bacteria 7582
273 Ga0157375_10037064 3300013308 Bacteria 4669
274 Ga0157375_10153709 3300013308 Bacteria 2438
275 Ga0157375_10308929 3300013308 Bacteria 1745
276 Ga0163163_10023232 3300014325 Bacteria 5883
277 Ga0163163_10024858 3300014325 Bacteria 5703
278 Ga0163163_10233627 3300014325 Bacteria 1888
279 Ga0157380_10055669 3300014326 Bacteria 3142
280 Ga0157380_10331306 3300014326 Bacteria 1416
281 Ga0157379_10177273 3300014968 Bacteria 1925
282 Ga0157379_10305173 3300014968 Bacteria 1451
283 Ga0157376_10044894 3300014969 Bacteria 3635
284 Ga0157376_10059185 3300014969 Bacteria 3212
285 Ga0157376_10173493 3300014969 Bacteria 1965
286 Ga0213875_10004377 3300021388 Bacteria 7770
287 Ga0207653_10010616 3300025885 Bacteria 2874
288 Ga0207653_10030856 3300025885 Bacteria 1730
289 Ga0207682_10009852 3300025893 Bacteria 3758
290 Ga0207692_10119676 3300025898 Bacteria 1473
291 Ga0207688_10033317 3300025901 Bacteria 2849
292 Ga0207680_10158736 3300025903 Bacteria 1514
293 Ga0207647_10071133 3300025904 Bacteria 2099
294 Ga0207645_10000264 3300025907 Bacteria 43356
295 Ga0207645_10006406 3300025907 Bacteria 8451
296 Ga0207645_10092570 3300025907 Bacteria 1944
297 Ga0207645_10093805 3300025907 Bacteria 1931
298 Ga0207645_10147954 3300025907 Bacteria 1532
299 Ga0207643_10000077 3300025908 Bacteria 64121
300 Ga0207643_10151514 3300025908 Bacteria 1390
301 Ga0207705_10320186 3300025909 Bacteria 1191
302 Ga0207684_10004520 3300025910 Bacteria 13068
303 Ga0207684_10037843 3300025910 Bacteria 4093
304 Ga0207684_10107154 3300025910 Bacteria 2391
305 Ga0207684_10120716 3300025910 Bacteria 2247
306 Ga0207684_10147368 3300025910 Bacteria 2025
307 Ga0207654_10076520 3300025911 Bacteria 2003
308 Ga0207707_10000735 3300025912 Bacteria 32417
309 Ga0207695_10000218 3300025913 Bacteria 154723
310 Ga0207695_10091379 3300025913 Bacteria 3058
311 Ga0207671_10077026 3300025914 Bacteria 2496
312 Ga0207671_10185345 3300025914 Bacteria 1621
313 Ga0207663_10042865 3300025916 Bacteria 2767
314 Ga0207660_10004022 3300025917 Bacteria 9592
315 Ga0207660_10031818 3300025917 Bacteria 3638
316 Ga0207657_10000945 3300025919 Bacteria 30776
317 Ga0207657_10038919 3300025919 Bacteria 4229
318 Ga0207657_10078784 3300025919 Bacteria 2773
319 Ga0207657_10150509 3300025919 Bacteria 1896
320 Ga0207649_10087453 3300025920 Bacteria 2033
321 Ga0207649_10144568 3300025920 Bacteria 1631
322 Ga0207652_10003698 3300025921 Bacteria 12554
323 Ga0207646_10003037 3300025922 Bacteria 19308
324 Ga0207646_10007587 3300025922 Bacteria 10991
325 Ga0207646_10106304 3300025922 Bacteria 2517
326 Ga0207646_10453312 3300025922 Bacteria 1157
327 Ga0207681_10006787 3300025923 Bacteria 7018
328 Ga0207681_10038788 3300025923 Bacteria 3159
329 Ga0207681_10145750 3300025923 Bacteria 1769
330 Ga0207681_10267723 3300025923 Bacteria 1340
331 Ga0207694_10004160 3300025924 Bacteria 11360
332 Ga0207650_10027527 3300025925 Bacteria 4070
333 Ga0207650_10116572 3300025925 Bacteria 2074
334 Ga0207659_10198591 3300025926 Bacteria 1600
335 Ga0207659_10278900 3300025926 Bacteria 1366
336 Ga0207687_10241076 3300025927 Unclassified 1433
337 Ga0207700_10115321 3300025928 Unclassified 2169
338 Ga0207644_10000271 3300025931 Bacteria 34644
339 Ga0207644_10060593 3300025931 Bacteria 2739
340 Ga0207644_10142348 3300025931 Bacteria 1848
341 Ga0207644_10272561 3300025931 Bacteria 1356
342 Ga0207690_10006128 3300025932 Bacteria 7126
343 Ga0207690_10032218 3300025932 Bacteria 3361
344 Ga0207706_10006615 3300025933 Bacteria 10733
345 Ga0207706_10068634 3300025933 Bacteria 3119
346 Ga0207706_10146187 3300025933 Bacteria 2079
347 Ga0207686_10015869 3300025934 Bacteria 4220
348 Ga0207686_10017363 3300025934 Bacteria 4054
349 Ga0207686_10046802 3300025934 Bacteria 2671
350 Ga0207686_10245946 3300025934 Bacteria 1304
351 Ga0207686_10298852 3300025934 Bacteria 1195
352 Ga0207670_10024580 3300025936 Bacteria 3767
353 Ga0207669_10279973 3300025937 Bacteria 1257
354 Ga0207665_10130201 3300025939 Bacteria 1785
355 Ga0207691_10000864 3300025940 Bacteria 30113
356 Ga0207691_10015460 3300025940 Bacteria 7257
357 Ga0207691_10019844 3300025940 Bacteria 6358
358 Ga0207691_10028831 3300025940 Bacteria 5195
359 Ga0207691_10073015 3300025940 Bacteria 3094
360 Ga0207691_10409171 3300025940 Bacteria 1156
361 Ga0207711_10001466 3300025941 Bacteria 21996
362 Ga0207711_10031398 3300025941 Bacteria 4483
363 Ga0207711_10183427 3300025941 Bacteria 1904
364 Ga0207711_10206727 3300025941 Bacteria 1792
365 Ga0207711_10234802 3300025941 Bacteria 1680
366 Ga0207689_10000138 3300025942 Bacteria 62632
367 Ga0207689_10010320 3300025942 Bacteria 8045
368 Ga0207689_10017186 3300025942 Bacteria 6123
369 Ga0207689_10071479 3300025942 Bacteria 2850
370 Ga0207689_10167398 3300025942 Bacteria 1811
371 Ga0207661_10273045 3300025944 Bacteria 1509
372 Ga0207679_10003189 3300025945 Bacteria 10117
373 Ga0207679_10237651 3300025945 Bacteria 1542
374 Ga0207679_10325629 3300025945 Bacteria 1332
375 Ga0207667_10000287 3300025949 Bacteria 69607
376 Ga0207651_10110500 3300025960 Bacteria 2062
377 Ga0207651_10150468 3300025960 Bacteria 1811
378 Ga0207712_10337922 3300025961 Bacteria 1248
379 Ga0207668_10391402 3300025972 Bacteria 1173
380 Ga0207640_10010902 3300025981 Bacteria 5128
381 Ga0207640_10395316 3300025981 Bacteria 1124
382 Ga0207677_10006708 3300026023 Bacteria 6324
383 Ga0207677_10014656 3300026023 Bacteria 4586
384 Ga0207677_10240857 3300026023 Unclassified 1463
385 Ga0207703_10055355 3300026035 Bacteria 3227
386 Ga0207703_10057245 3300026035 Bacteria 3178
387 Ga0207639_10009569 3300026041 Bacteria 6691
388 Ga0207639_10044233 3300026041 Bacteria 3348
389 Ga0207639_10191025 3300026041 Bacteria 1749
390 Ga0207678_10031566 3300026067 Bacteria 4621
391 Ga0207708_10095567 3300026075 Bacteria 2295
392 Ga0207708_10098173 3300026075 Bacteria 2264
393 Ga0207702_10002756 3300026078 Bacteria 16442
394 Ga0207641_10035762 3300026088 Bacteria 4141
395 Ga0207641_10046669 3300026088 Bacteria 3652
396 Ga0207641_10203571 3300026088 Bacteria 1826
397 Ga0207641_10512199 3300026088 Bacteria 1166
398 Ga0207648_10002226 3300026089 Bacteria 21008
399 Ga0207648_10038190 3300026089 Bacteria 4226
400 Ga0207648_10082904 3300026089 Bacteria 2796
401 Ga0207676_10017021 3300026095 Bacteria 5266
402 Ga0207676_10027032 3300026095 Bacteria 4270
403 Ga0207676_10067415 3300026095 Bacteria 2858
404 Ga0207676_10229911 3300026095 Bacteria 1657
405 Ga0207674_10002540 3300026116 Bacteria 22993
406 Ga0207674_10101241 3300026116 Bacteria 2862
407 Ga0207675_100003508 3300026118 Bacteria 15310
408 Ga0207675_100015025 3300026118 Bacteria 7224
409 Ga0207675_100027968 3300026118 Bacteria 5251
410 Ga0207683_10036084 3300026121 Bacteria 4302
411 Ga0207683_10143272 3300026121 Bacteria 2154
412 Ga0207698_10017804 3300026142 Bacteria 4829
413 Ga0207698_10090707 3300026142 Bacteria 2500
414 Ga0207698_10368491 3300026142 Bacteria 1363
415 Ga0209588_1010402 3300027671 Bacteria 2797
416 Ga0268266_10241390 3300028379 Bacteria 1668
417 Ga0268265_10082813 3300028380 Bacteria 2538
418 Ga0268265_10215386 3300028380 Bacteria 1677
419 Ga0268264_10009943 3300028381 Bacteria 7876
420 Ga0268264_10021396 3300028381 Bacteria 5282
421 Ga0268264_10051560 3300028381 Bacteria 3428
422 Ga0268264_10240139 3300028381 Bacteria 1678
423 Ga0307517_10003248 3300028786 Bacteria 25445
424 Ga0265338_10013185 3300028800 Bacteria 9354
425 Ga0265338_10338418 3300028800 Bacteria 1085
426 Ga0307512_10073923 3300030522 Bacteria 2507
427 Ga0265330_10032686 3300031235 Bacteria 2330
428 Ga0265325_10044157 3300031241 Bacteria 2323
429 Ga0265340_10010722 3300031247 Bacteria 4896
430 Ga0265339_10040235 3300031249 Bacteria 2599
431 Ga0265339_10088503 3300031249 Bacteria 1626
432 Ga0265316_10050175 3300031344 Bacteria 3283
433 Ga0307509_10000092 3300031507 Bacteria 124019
434 Ga0307408_100175137 3300031548 Bacteria 1716
435 Ga0307408_100243738 3300031548 Bacteria 1479
436 Ga0307508_10007413 3300031616 Bacteria 10216
437 Ga0307514_10093159 3300031649 Bacteria 2189
438 Ga0307514_10161061 3300031649 Bacteria 1485
439 Ga0265314_10007656 3300031711 Bacteria 9339
440 Ga0265342_10010809 3300031712 Bacteria 6289
441 Ga0265342_10024249 3300031712 Bacteria 3831
442 Ga0307516_10208071 3300031730 Bacteria 1672
443 Ga0307415_100168806 3300032126 Bacteria 1704
444 Ga0307510_10043389 3300033180 Bacteria 4889
445 Ga0307510_10043899 3300033180 Bacteria 4851
446 Ga0373930_0024565 3300034816 Bacteria 1205
447 Ga0373959_0021689 3300034820 Bacteria 1235
448 Ga0373949_0032935 3300035090 Bacteria 1243
449 Ga0373923_0019059 3300035111 Bacteria 2651
450 Ga0373956_0111257 3300035119 Bacteria 1275
451 Ga0373960_0005470 3300035121 Bacteria 2945
452 Ga0373943_0078064 3300035170 Bacteria 1692
453 Ga0373961_0002659 3300035241 Bacteria 4585
454 Ga0373931_0003021 3300035691 Bacteria 7514
455 Ga0373931_0026432 3300035691 Bacteria 2954
456 Ga0373935_0044289 3300035692 Bacteria 2804
457 Ga0373927_0136030 3300035695 Bacteria 1606
458 Ga0373947_0111750 3300035725 Bacteria 1727
459 Ga0373937_0047110 3300036401 Bacteria 3944
460 Ga0373937_0509685 3300036401 Bacteria 1143
461 Ga0373925_0127999 3300037068 Bacteria 1977
462 Ga0395900_0604047 3300037418 Bacteria 1037
463 Ga0395898_0085876 3300037466 Bacteria 3033
464 Ga0436364_0256648 3300037853 Bacteria 1389
465 Ga0436364_0765665 3300037853 Bacteria 29481
466 Ga0436363_0738498 3300039450 Bacteria 2722
467 Ga0436362_0699105 3300039453 Bacteria 1200
468 Ga0451835_0717063 3300041492 Bacteria 793
469 Ga0439441_002840 3300042001 Bacteria 2483
470 Ga0439459_0001330 3300042438 Bacteria 3605
471 Ga0451577_0007268 3300042876 Bacteria 10907
472 Ga0451577_0087951 3300042876 Bacteria 2772
473 Ga0453683_0018267 3300044673 Bacteria 4502
474 Ga0453683_0084975 3300044673 Bacteria 1982
475 Ga0466963_0456809 3300044694 Bacteria 901
476 Ga0453684_0024772 3300044712 Bacteria 8747
477 Ga0453684_0145312 3300044712 Bacteria 2826
478 Ga0466960_0343352 3300044901 Bacteria 850
479 Ga0451576_0007580 3300045051 Bacteria 12932
480 Ga0451576_0013730 3300045051 Bacteria 9047
481 Ga0451576_0021831 3300045051 Bacteria 6950
482 Ga0451576_0136798 3300045051 Bacteria 2555
483 Ga0451576_0480802 3300045051 Bacteria 1304
484 Ga0466967_0655563 3300045976 Bacteria 1038
485 Ga0495592_0000413 3300046454 Bacteria 32677
486 Ga0495629_0092335 3300046459 Bacteria 2113
487 Ga0495629_0239371 3300046459 Bacteria 1250
488 Ga0495638_0085396 3300046460 Bacteria 1909
489 Ga0495638_0217523 3300046460 Bacteria 1069
490 Ga0495580_0226633 3300046472 Bacteria 1283
491 Ga0495662_0155155 3300046476 Bacteria 1128
492 Ga0495664_0301544 3300046477 Bacteria 967
493 Ga0495594_0011618 3300046499 Bacteria 4579
494 Ga0495583_0019443 3300046506 Bacteria 3546
495 Ga0495606_0039441 3300046507 Bacteria 3183
496 Ga0495606_0141073 3300046507 Bacteria 1423
497 Ga0495618_0347230 3300046514 Bacteria 915
498 Ga0495628_0137807 3300046516 Bacteria 1864
499 Ga0495648_0052817 3300046524 Bacteria 2466
500 Ga0495642_0096837 3300046528 Bacteria 1253
501 Ga0495640_0090122 3300046533 Bacteria 2025
502 Ga0495640_0107018 3300046533 Bacteria 1831
503 Ga0495587_0191246 3300046536 Bacteria 1159
504 Ga0495587_0358116 3300046536 Unclassified 813
505 Ga0495645_0106318 3300046543 Bacteria 1990
506 Ga0495634_0167769 3300046642 Bacteria 1381
507 Ga0495625_0000985 3300046660 Bacteria 37750
508 Ga0495625_0058420 3300046660 Bacteria 2741
509 Ga0495635_0301815 3300046663 Unclassified 1074
510 Ga0495623_0269179 3300046679 Bacteria 952
511 Ga0495647_0013398 3300046681 Bacteria 2840
512 Ga0495658_0011510 3300046683 Bacteria 4452
513 Ga0495658_0012754 3300046683 Bacteria 4266
514 Ga0495658_0020013 3300046683 Bacteria 3503
515 Ga0495613_0055655 3300046689 Bacteria 2906
516 Ga0495613_0231226 3300046689 Bacteria 1295
517 Ga0495613_0312243 3300046689 Bacteria 1086
518 Ga0495670_0213124 3300046691 Bacteria 1025
519 Ga0495581_0138844 3300047315 Bacteria 1417
520 Ga0495581_0293840 3300047315 Unclassified 950
521 Ga0495604_0239928 3300047317 Bacteria 1240
522 Ga0495674_0023752 3300047319 Bacteria 5645
523 Ga0495674_0522487 3300047319 Bacteria 947
524 Ga0495672_0002568 3300047320 Bacteria 16521
525 Ga0495672_0056366 3300047320 Bacteria 2287
526 Ga0495683_0026390 3300047323 Bacteria 2973
527 Ga0495684_0154045 3300047471 Bacteria 1717
528 Ga0495686_0049310 3300047472 Bacteria 2650
529 Ga0495686_0059369 3300047472 Bacteria 2381
530 Ga0495593_0145443 3300047673 Bacteria 1200
531 Ga0495602_0083857 3300048088 Bacteria 2668
532 Ga0496101_0211196 3300048904 Bacteria 1504
533 Ga0496102_0006111 3300048905 Bacteria 10263
534 Ga0496102_0034799 3300048905 Bacteria 4533
535 Ga0496104_0095624 3300048907 Bacteria 2842
536 Ga0496104_0115937 3300048907 Bacteria 2571
537 Ga0496104_0181454 3300048907 Bacteria 2015
538 Ga0496104_0260114 3300048907 Bacteria 1648
539 Ga0496105_0136226 3300048908 Bacteria 2023
540 Ga0496105_0167032 3300048908 Bacteria 1805
541 Ga0496105_0232474 3300048908 Bacteria 1498
542 Ga0496106_0273692 3300048909 Bacteria 1352
543 Ga0496107_0057526 3300048910 Bacteria 2811
544 Ga0496108_0139392 3300048911 Bacteria 2089
545 Ga0496108_0261150 3300048911 Bacteria 1507
546 Ga0496109_0081796 3300048912 Bacteria 2976
547 Ga0496110_0090542 3300048913 Bacteria 2735
548 Ga0496112_0073967 3300048915 Bacteria 3369
549 Ga0496114_0035148 3300048917 Bacteria 4137
550 Ga0496114_0194666 3300048917 Bacteria 1774
551 Ga0496114_0449362 3300048917 Bacteria 1141
552 Ga0496115_0202432 3300048918 Bacteria 1640
553 Ga0496115_0204157 3300048918 Bacteria 1632
554 Ga0496115_0295236 3300048918 Bacteria 1328
555 Ga0496126_0000154 3300048929 Bacteria 159983
556 Ga0501033_0146215 3300049570 Bacteria 1707
557 Ga0501037_0272102 3300049573 Bacteria 1182
558 Ga0501042_0048927 3300049578 Bacteria 3015
559 Ga0501068_0073484 3300049584 Bacteria 2089
560 Ga0501074_0019452 3300049590 Bacteria 4932
561 Ga0501074_0104761 3300049590 Bacteria 2025
562 Ga0501075_0577334 3300049591 Bacteria 858
563 Ga0501076_0125990 3300049592 Bacteria 2075
564 Ga0501077_0003458 3300049593 Bacteria 9477
565 Ga0501079_0202946 3300049741 Bacteria 1549
566 Ga0501080_0278099 3300049742 Bacteria 1522
567 Ga0501081_0002752 3300049743 Bacteria 11147
568 Ga0501081_0007400 3300049743 Bacteria 7127
569 Ga0501045_0120478 3300049824 Bacteria 1948
570 nmdc:mga05p37_20381_c1 3300050507 Bacteria 8021
571 nmdc:mga05p37_33857_c1 3300050507 Bacteria 6258
572 nmdc:mga05p37_36638_c1 3300050507 Bacteria 6016
573 nmdc:mga05p37_396420_c1 3300050507 Bacteria 1613
574 nmdc:mga05p37_400312_c1 3300050507 Bacteria 1603
575 nmdc:mga05p37_469612_c1 3300050507 Bacteria 1452
576 nmdc:mga05p37_91092_c1 3300050507 Bacteria 3758
577 nmdc:mga09592_129281_c1 3300050508 Bacteria 2172
578 nmdc:mga09592_83929_c1 3300050508 Bacteria 2716
579 nmdc:mga09592_8779_c1 3300050508 Bacteria 8224
580 nmdc:mga0qj67_72052_c1 3300050509 Bacteria 2758
581 nmdc:mga06r32_211668_c1 3300050510 Bacteria 1926
582 nmdc:mga06r32_23937_c1 3300050510 Bacteria 5659
583 nmdc:mga08y16_60956_c1 3300050511 Bacteria 3939
584 nmdc:mga08y16_615580_c1 3300050511 Bacteria 1093
585 nmdc:mga0n895_12159_c1 3300050512 Bacteria 7706
586 nmdc:mga0n895_1264_c1 3300050512 Bacteria 18682
587 nmdc:mga0n895_153197_c1 3300050512 Bacteria 2336
588 nmdc:mga0n895_176722_c1 3300050512 Bacteria 2166
589 nmdc:mga0n895_23132_c1 3300050512 Bacteria 5837
590 nmdc:mga0n895_33464_c1 3300050512 Bacteria 4941
591 nmdc:mga0n895_9784_c1 3300050512 Bacteria 8419
592 nmdc:mga0rr50_10888_c1 3300050513 Bacteria 5798
593 nmdc:mga0rr50_13303_c1 3300050513 Bacteria 5353
594 nmdc:mga0rr50_149645_c1 3300050513 Bacteria 1885
595 nmdc:mga0rr50_218856_c1 3300050513 Bacteria 1572
596 nmdc:mga0rr50_3106_c1 3300050513 Bacteria 9496
597 nmdc:mga0rr50_39870_c1 3300050513 Bacteria 3410
598 nmdc:mga0rr50_9606_c1 3300050513 Bacteria 6093
599 nmdc:mga08x19_33359_c1 3300050514 Bacteria 3249
600 nmdc:mga08x19_3536_c1 3300050514 Bacteria 9293
601 nmdc:mga08x19_45119_c1 3300050514 Bacteria 1618
602 nmdc:mga08x19_56588_c1 3300050514 Bacteria 2532
603 nmdc:mga0a205_10809_c1 3300050515 Bacteria 8399
604 nmdc:mga0a205_11354_c1 3300050515 Bacteria 8199
605 nmdc:mga0a205_21806_c1 3300050515 Bacteria 6058
606 nmdc:mga0a205_22896_c1 3300050515 Bacteria 5924
607 nmdc:mga0a205_30402_c1 3300050515 Bacteria 5171
608 nmdc:mga0a205_66318_c1 3300050515 Bacteria 3488
609 nmdc:mga0a205_8400_c1 3300050515 Bacteria 9396
610 Ga0495612_0054867 3300053078 Bacteria 1642
611 Ga0495619_0154274 3300053085 Bacteria 1584
612 Ga0495619_0175910 3300053085 Bacteria 1480
613 Ga0500644_0025892 3300053088 Bacteria 1810
614 Ga0500651_0000005 3300053093 Bacteria 384761
615 Ga0500651_0102749 3300053093 Bacteria 1751
616 Ga0500594_0002206 3300053118 Bacteria 4217
617 Ga0500595_014740 3300053119 Bacteria 2956
618 Ga0500559_0000017 3300053136 Bacteria 143646
619 Ga0500604_0033204 3300053151 Bacteria 1525
620 Ga0500619_074584 3300053154 Bacteria 1132
621 Ga0500622_0002775 3300053156 Bacteria 12319
622 Ga0500636_0111057 3300053177 Bacteria 1549
623 Ga0500587_001529 3300053739 Bacteria 3282
624 Ga0500661_011154 3300055283 Bacteria 1628
625 Ga0501082_0154274 3300060353 Bacteria 1995
626 Ga0530510_0083724 3300061734 Bacteria 2323
627 2596373916 2595698237 Bacteria 6712432
628 2842700836 2842698319 Bacteria 5190321
629 2889308180 2889306138 Bacteria 6358934
630 2889311196 2889306138 Bacteria 6358934
631 2902335927 2902330777 Bacteria 6395352
632 2902336095 2902330777 Bacteria 6395352
633 2902407762 2902405164 Bacteria 6784948
634 2928129484 2928125067 Bacteria 5937560
635 Ga0307410_10335876
636 rootH2_10130113
637 rootH2_10207294
638 Ga0070658_10217556
639 Ga0070676_10005349
640 Ga0070676_10007227
641 Ga0070676_10024488
642 Ga0070683_100341514
643 Ga0070683_100489953
644 Ga0070670_100004301
645 Ga0070670_100129992
646 Ga0070677_10126667
647 Ga0068869_100001279
648 Ga0068869_100001892
649 Ga0068869_100091929
650 Ga0068869_100124587
651 Ga0070666_10038722
652 Ga0070666_10082785
653 Ga0070680_100001876
654 Ga0070680_100047771
655 Ga0070682_100001070
656 Ga0070660_100012388
657 Ga0070660_100013053
658 Ga0070660_100155308
659 Ga0070689_100033972
660 Ga0070689_100314139
661 Ga0070661_100000504
662 Ga0070661_100190154
663 Ga0070692_10001107
664 Ga0070692_10064056
665 Ga0070668_100010681
666 Ga0070668_100245119
667 Ga0070669_100015563
668 Ga0070669_100061925
669 Ga0070669_100065533
670 Ga0070675_100115509
671 Ga0070671_100027995
672 Ga0070671_100045085
673 Ga0070671_100064437
674 Ga0070671_100155812
675 Ga0070671_100162380
676 Ga0070671_100341264
677 Ga0070674_100041236
678 Ga0070674_100091112
679 Ga0070674_100100229
680 Ga0070673_100000849
681 Ga0070673_100171325
682 Ga0070659_100003709
683 Ga0070659_100060963
684 Ga0070667_100044686
685 Ga0070667_100147561
686 Ga0070703_10011385
687 Ga0070714_100032689
688 Ga0070714_100423723
689 Ga0070713_100075988
690 Ga0070713_100088586
691 Ga0070701_10036086
692 Ga0070711_100058392
693 Ga0070705_100009123
694 Ga0070705_100039622
695 Ga0070700_100050756
696 Ga0070700_100065988
697 Ga0070694_100000078
698 Ga0070694_100054850
699 Ga0070694_100071716
700 Ga0070694_100155926
701 Ga0070708_100006158
702 Ga0070708_100169359
703 Ga0070663_100052556
704 Ga0070678_100004644
705 Ga0070678_100122837
706 Ga0070678_100329621
707 Ga0070662_100009292
708 Ga0070662_100025694
709 Ga0070662_100190087
710 Ga0070681_10038941
711 Ga0068867_100001164
712 Ga0068867_100016694
713 Ga0068867_100063792
714 Ga0070706_100028601
715 Ga0070706_100028865
716 Ga0070706_100053010
717 Ga0070706_100160913
718 Ga0070706_100186523
719 Ga0070707_100031204
720 Ga0070707_100046289
721 Ga0070707_100055671
722 Ga0070707_100061038
723 Ga0070707_100352454
724 Ga0070698_100005791
725 Ga0070698_100034982
726 Ga0070698_100037944
727 Ga0070698_100128976
728 Ga0070698_100139269
729 Ga0070698_100140087
730 Ga0070698_100173476
731 Ga0070699_100006895
732 Ga0070699_100024693
733 Ga0070699_100035480
734 Ga0070699_100149183
735 Ga0070699_100167196
736 Ga0070699_100226557
737 Ga0070699_100272760
738 Ga0070679_100003671
739 Ga0070697_100007154
740 Ga0070697_100008872
741 Ga0070697_100038642
742 Ga0070697_100255545
743 Ga0070697_100318759
744 Ga0070697_100495839
745 Ga0068853_100001886
746 Ga0068853_100233455
747 Ga0068853_100328313
748 Ga0068853_100536320
749 Ga0070672_100018224
750 Ga0070672_100033474
751 Ga0070672_100201506
752 Ga0070672_100316605
753 Ga0070695_100001053
754 Ga0070695_100015297
755 Ga0070695_100189435
756 Ga0070696_100001856
757 Ga0070696_100094622
758 Ga0070696_100116228
759 Ga0070693_100000468
760 Ga0070693_100057726
761 Ga0070693_100285096
762 Ga0070665_100185057
763 Ga0070704_100001294
764 Ga0070704_100018104
765 Ga0070704_100145590
766 Ga0068855_100373922
767 Ga0070664_100004039
768 Ga0068857_100067114
769 Ga0068854_100002457
770 Ga0068856_100003246
771 Ga0068856_100160591
772 Ga0068856_100455109
773 Ga0070702_100011080
774 Ga0068852_100006482
775 Ga0068852_100110985
776 Ga0068852_100128378
777 Ga0068852_100185007
778 Ga0068852_100196560
779 Ga0068852_100315671
780 Ga0068859_100005409
781 Ga0068859_100090615
782 Ga0068864_100081712
783 Ga0068866_10011277
784 Ga0068866_10052929
785 Ga0068866_10090428
786 Ga0068861_100001625
787 Ga0068861_100020523
788 Ga0068861_100053741
789 Ga0068861_100287761
790 Ga0068851_10086810
791 Ga0068851_10100886
792 Ga0068870_10000045
793 Ga0068870_10111706
794 Ga0068863_100015679
795 Ga0068863_100030749
796 Ga0068863_100047851
797 Ga0068858_100001778
798 Ga0068858_100014514
799 Ga0068858_100034171
800 Ga0068860_100032641
801 Ga0068860_100072929
802 Ga0068860_100119584
803 Ga0068860_100716945
804 Ga0068862_100035825
805 Ga0070717_10007402
806 Ga0070715_10076198
807 Ga0097621_100010835
808 Ga0097621_100114078
809 Ga0068871_100022478
810 Ga0068871_100200288
811 Ga0068871_100397000
812 Ga0068871_100504533
813 Ga0075428_100040116
814 Ga0075428_100152375
815 Ga0075428_100376112
816 Ga0075430_100016287
817 Ga0075431_100026522
818 Ga0075433_10056793
819 Ga0075433_10111985
820 Ga0075433_10230551
821 Ga0075433_10236028
822 Ga0075434_100012903
823 Ga0075434_100036492
824 Ga0075434_100052026
825 Ga0075434_100060624
826 Ga0075434_100188723
827 Ga0075429_100010351
828 Ga0075429_100023806
829 Ga0075429_100038802
830 Ga0075429_100064546
831 Ga0068865_100009668
832 Ga0075436_100018647
833 Ga0075436_100040576
834 Ga0097620_100005409
835 Ga0097620_100090613
836 Ga0075435_100008448
837 Ga0075435_100048009
838 Ga0075435_100072472
839 Ga0099794_10004497
840 Ga0099794_10024740
841 Ga0099794_10055535
842 Ga0105240_10012842
843 Ga0105240_10527100
844 Ga0111539_10180060
845 Ga0111539_10297610
846 Ga0111539_10361913
847 Ga0105245_10007658
848 Ga0105245_10105182
849 Ga0105245_10105631
850 Ga0105245_10119601
851 Ga0105245_10604441
852 Ga0114129_10042481
853 Ga0114129_10042555
854 Ga0114129_10050104
855 Ga0114129_10050641
856 Ga0114129_10371935
857 Ga0105243_10160417
858 Ga0105241_10006140
859 Ga0105241_10007897
860 Ga0105241_10059455
861 Ga0105242_10022664
862 Ga0105242_10052108
863 Ga0105242_10060924
864 Ga0105242_10149662
865 Ga0105248_10004175
866 Ga0105248_10040840
867 Ga0105248_10067640
868 Ga0105248_10094248
869 Ga0105248_10108951
870 Ga0105248_10429971
871 Ga0105237_10028631
872 Ga0105237_10175822
873 Ga0105237_10298921
874 Ga0105238_10017862
875 Ga0105249_10284899
876 Ga0105249_10470997
877 Ga0105249_10818706
878 Ga0105239_10008518
879 Ga0105239_10112145
880 Ga0105239_10254640
881 Ga0105239_10262008
882 Ga0105239_10302045
883 Ga0105239_10656968
884 Ga0105246_10366185
885 Ga0157373_10003370
886 Ga0157371_10045554
887 Ga0157371_10199256
888 Ga0157369_10011367
889 Ga0157369_10021060
890 Ga0157369_10061575
891 Ga0157369_10141250
892 Ga0157374_10004715
893 Ga0157374_10038681
894 Ga0157374_10058243
895 Ga0157374_10096016
896 Ga0157374_10172547
897 Ga0157374_10259549
898 Ga0157378_10045131
899 Ga0163162_10004710
900 Ga0163162_10044511
901 Ga0157372_10000772
902 Ga0157372_10066245
903 Ga0157372_10129678
904 Ga0157372_10221264
905 Ga0157375_10002273
906 Ga0157375_10012321
907 Ga0157375_10037064
908 Ga0157375_10153709
909 Ga0157375_10308929
910 Ga0163163_10023232
911 Ga0163163_10024858
912 Ga0163163_10233627
913 Ga0157380_10055669
914 Ga0157380_10331306
915 Ga0157379_10177273
916 Ga0157379_10305173
917 Ga0157376_10044894
918 Ga0157376_10059185
919 Ga0157376_10173493
920 Ga0213875_10004377
921 Ga0207653_10010616
922 Ga0207653_10030856
923 Ga0207682_10009852
924 Ga0207692_10119676
925 Ga0207688_10033317
926 Ga0207680_10158736
927 Ga0207647_10071133
928 Ga0207645_10000264
929 Ga0207645_10006406
930 Ga0207645_10092570
931 Ga0207645_10093805
932 Ga0207645_10147954
933 Ga0207643_10000077
934 Ga0207643_10151514
935 Ga0207705_10320186
936 Ga0207684_10004520
937 Ga0207684_10037843
938 Ga0207684_10107154
939 Ga0207684_10120716
940 Ga0207684_10147368
941 Ga0207654_10076520
942 Ga0207707_10000735
943 Ga0207695_10000218
944 Ga0207695_10091379
945 Ga0207671_10077026
946 Ga0207671_10185345
947 Ga0207663_10042865
948 Ga0207660_10004022
949 Ga0207660_10031818
950 Ga0207657_10000945
951 Ga0207657_10038919
952 Ga0207657_10078784
953 Ga0207657_10150509
954 Ga0207649_10087453
955 Ga0207649_10144568
956 Ga0207652_10003698
957 Ga0207646_10003037
958 Ga0207646_10007587
959 Ga0207646_10106304
960 Ga0207646_10453312
961 Ga0207681_10006787
962 Ga0207681_10038788
963 Ga0207681_10145750
964 Ga0207681_10267723
965 Ga0207694_10004160
966 Ga0207650_10027527
967 Ga0207650_10116572
968 Ga0207659_10198591
969 Ga0207659_10278900
970 Ga0207687_10241076
971 Ga0207700_10115321
972 Ga0207644_10000271
973 Ga0207644_10060593
974 Ga0207644_10142348
975 Ga0207644_10272561
976 Ga0207690_10006128
977 Ga0207690_10032218
978 Ga0207706_10006615
979 Ga0207706_10068634
980 Ga0207706_10146187
981 Ga0207686_10015869
982 Ga0207686_10017363
983 Ga0207686_10046802
984 Ga0207686_10245946
985 Ga0207686_10298852
986 Ga0207670_10024580
987 Ga0207669_10279973
988 Ga0207665_10130201
989 Ga0207691_10000864
990 Ga0207691_10015460
991 Ga0207691_10019844
992 Ga0207691_10028831
993 Ga0207691_10073015
994 Ga0207691_10409171
995 Ga0207711_10001466
996 Ga0207711_10031398
997 Ga0207711_10183427
998 Ga0207711_10206727
999 Ga0207711_10234802
1000 Ga0207689_10000138
1001 Ga0207689_10010320
1002 Ga0207689_10017186
1003 Ga0207689_10071479
1004 Ga0207689_10167398
1005 Ga0207661_10273045
1006 Ga0207679_10003189
1007 Ga0207679_10237651
1008 Ga0207679_10325629
1009 Ga0207667_10000287
1010 Ga0207651_10110500
1011 Ga0207651_10150468
1012 Ga0207712_10337922
1013 Ga0207668_10391402
1014 Ga0207640_10010902
1015 Ga0207640_10395316
1016 Ga0207677_10006708
1017 Ga0207677_10014656
1018 Ga0207677_10240857
1019 Ga0207703_10055355
1020 Ga0207703_10057245
1021 Ga0207639_10009569
1022 Ga0207639_10044233
1023 Ga0207639_10191025
1024 Ga0207678_10031566
1025 Ga0207708_10095567
1026 Ga0207708_10098173
1027 Ga0207702_10002756
1028 Ga0207641_10035762
1029 Ga0207641_10046669
1030 Ga0207641_10203571
1031 Ga0207641_10512199
1032 Ga0207648_10002226
1033 Ga0207648_10038190
1034 Ga0207648_10082904
1035 Ga0207676_10017021
1036 Ga0207676_10027032
1037 Ga0207676_10067415
1038 Ga0207676_10229911
1039 Ga0207674_10002540
1040 Ga0207674_10101241
1041 Ga0207675_100003508
1042 Ga0207675_100015025
1043 Ga0207675_100027968
1044 Ga0207683_10036084
1045 Ga0207683_10143272
1046 Ga0207698_10017804
1047 Ga0207698_10090707
1048 Ga0207698_10368491
1049 Ga0209588_1010402
1050 Ga0268266_10241390
1051 Ga0268265_10082813
1052 Ga0268265_10215386
1053 Ga0268264_10009943
1054 Ga0268264_10021396
1055 Ga0268264_10051560
1056 Ga0268264_10240139
1057 Ga0307517_10003248
1058 Ga0265338_10013185
1059 Ga0265338_10338418
1060 Ga0307512_10073923
1061 Ga0265330_10032686
1062 Ga0265325_10044157
1063 Ga0265340_10010722
1064 Ga0265339_10040235
1065 Ga0265339_10088503
1066 Ga0265316_10050175
1067 Ga0307509_10000092
1068 Ga0307408_100175137
1069 Ga0307408_100243738
1070 Ga0307508_10007413
1071 Ga0307514_10093159
1072 Ga0307514_10161061
1073 Ga0265314_10007656
1074 Ga0265342_10010809
1075 Ga0265342_10024249
1076 Ga0307516_10208071
1077 Ga0307415_100168806
1078 Ga0307510_10043389
1079 Ga0307510_10043899
1080 Ga0373930_0024565
1081 Ga0373959_0021689
1082 Ga0373949_0032935
1083 Ga0373923_0019059
1084 Ga0373956_0111257
1085 Ga0373960_0005470
1086 Ga0373943_0078064
1087 Ga0373961_0002659
1088 Ga0373931_0003021
1089 Ga0373931_0026432
1090 Ga0373935_0044289
1091 Ga0373927_0136030
1092 Ga0373947_0111750
1093 Ga0373937_0047110
1094 Ga0373937_0509685
1095 Ga0373925_0127999
1096 Ga0395900_0604047
1097 Ga0395898_0085876
1098 Ga0436364_0256648
1099 Ga0436364_0765665
1100 Ga0436363_0738498
1101 Ga0436362_0699105
1102 Ga0451835_0717063
1103 Ga0439441_002840
1104 Ga0439459_0001330
1105 Ga0451577_0007268
1106 Ga0451577_0087951
1107 Ga0453683_0018267
1108 Ga0453683_0084975
1109 Ga0466963_0456809
1110 Ga0453684_0024772
1111 Ga0453684_0145312
1112 Ga0466960_0343352
1113 Ga0451576_0007580
1114 Ga0451576_0013730
1115 Ga0451576_0021831
1116 Ga0451576_0136798
1117 Ga0451576_0480802
1118 Ga0466967_0655563
1119 Ga0495592_0000413
1120 Ga0495629_0092335
1121 Ga0495629_0239371
1122 Ga0495638_0085396
1123 Ga0495638_0217523
1124 Ga0495580_0226633
1125 Ga0495662_0155155
1126 Ga0495664_0301544
1127 Ga0495594_0011618
1128 Ga0495583_0019443
1129 Ga0495606_0039441
1130 Ga0495606_0141073
1131 Ga0495618_0347230
1132 Ga0495628_0137807
1133 Ga0495648_0052817
1134 Ga0495642_0096837
1135 Ga0495640_0090122
1136 Ga0495640_0107018
1137 Ga0495587_0191246
1138 Ga0495587_0358116
1139 Ga0495645_0106318
1140 Ga0495634_0167769
1141 Ga0495625_0000985
1142 Ga0495625_0058420
1143 Ga0495635_0301815
1144 Ga0495623_0269179
1145 Ga0495647_0013398
1146 Ga0495658_0011510
1147 Ga0495658_0012754
1148 Ga0495658_0020013
1149 Ga0495613_0055655
1150 Ga0495613_0231226
1151 Ga0495613_0312243
1152 Ga0495670_0213124
1153 Ga0495581_0138844
1154 Ga0495581_0293840
1155 Ga0495604_0239928
1156 Ga0495674_0023752
1157 Ga0495674_0522487
1158 Ga0495672_0002568
1159 Ga0495672_0056366
1160 Ga0495683_0026390
1161 Ga0495684_0154045
1162 Ga0495686_0049310
1163 Ga0495686_0059369
1164 Ga0495593_0145443
1165 Ga0495602_0083857
1166 Ga0496101_0211196
1167 Ga0496102_0006111
1168 Ga0496102_0034799
1169 Ga0496104_0095624
1170 Ga0496104_0115937
1171 Ga0496104_0181454
1172 Ga0496104_0260114
1173 Ga0496105_0136226
1174 Ga0496105_0167032
1175 Ga0496105_0232474
1176 Ga0496106_0273692
1177 Ga0496107_0057526
1178 Ga0496108_0139392
1179 Ga0496108_0261150
1180 Ga0496109_0081796
1181 Ga0496110_0090542
1182 Ga0496112_0073967
1183 Ga0496114_0035148
1184 Ga0496114_0194666
1185 Ga0496114_0449362
1186 Ga0496115_0202432
1187 Ga0496115_0204157
1188 Ga0496115_0295236
1189 Ga0496126_0000154
1190 Ga0501033_0146215
1191 Ga0501037_0272102
1192 Ga0501042_0048927
1193 Ga0501068_0073484
1194 Ga0501074_0019452
1195 Ga0501074_0104761
1196 Ga0501075_0577334
1197 Ga0501076_0125990
1198 Ga0501077_0003458
1199 Ga0501079_0202946
1200 Ga0501080_0278099
1201 Ga0501081_0002752
1202 Ga0501081_0007400
1203 Ga0501045_0120478
1204 nmdc:mga05p37_20381_c1
1205 nmdc:mga05p37_33857_c1
1206 nmdc:mga05p37_36638_c1
1207 nmdc:mga05p37_396420_c1
1208 nmdc:mga05p37_400312_c1
1209 nmdc:mga05p37_469612_c1
1210 nmdc:mga05p37_91092_c1
1211 nmdc:mga09592_129281_c1
1212 nmdc:mga09592_83929_c1
1213 nmdc:mga09592_8779_c1
1214 nmdc:mga0qj67_72052_c1
1215 nmdc:mga06r32_211668_c1
1216 nmdc:mga06r32_23937_c1
1217 nmdc:mga08y16_60956_c1
1218 nmdc:mga08y16_615580_c1
1219 nmdc:mga0n895_12159_c1
1220 nmdc:mga0n895_1264_c1
1221 nmdc:mga0n895_153197_c1
1222 nmdc:mga0n895_176722_c1
1223 nmdc:mga0n895_23132_c1
1224 nmdc:mga0n895_33464_c1
1225 nmdc:mga0n895_9784_c1
1226 nmdc:mga0rr50_10888_c1
1227 nmdc:mga0rr50_13303_c1
1228 nmdc:mga0rr50_149645_c1
1229 nmdc:mga0rr50_218856_c1
1230 nmdc:mga0rr50_3106_c1
1231 nmdc:mga0rr50_39870_c1
1232 nmdc:mga0rr50_9606_c1
1233 nmdc:mga08x19_33359_c1
1234 nmdc:mga08x19_3536_c1
1235 nmdc:mga08x19_45119_c1
1236 nmdc:mga08x19_56588_c1
1237 nmdc:mga0a205_10809_c1
1238 nmdc:mga0a205_11354_c1
1239 nmdc:mga0a205_21806_c1
1240 nmdc:mga0a205_22896_c1
1241 nmdc:mga0a205_30402_c1
1242 nmdc:mga0a205_66318_c1
1243 nmdc:mga0a205_8400_c1
1244 Ga0495612_0054867
1245 Ga0495619_0154274
1246 Ga0495619_0175910
1247 Ga0500644_0025892
1248 Ga0500651_0000005
1249 Ga0500651_0102749
1250 Ga0500594_0002206
1251 Ga0500595_014740
1252 Ga0500559_0000017
1253 Ga0500604_0033204
1254 Ga0500619_074584
1255 Ga0500622_0002775
1256 Ga0500636_0111057
1257 Ga0500587_001529
1258 Ga0500661_011154
1259 Ga0501082_0154274
1260 Ga0530510_0083724
1261 2596373916
1262 2842700836
1263 2889308180
1264 2889311196
1265 2902335927
1266 2902336095
1267 2902407762
1268 2928129484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01841

Transglut_core

Transglutaminase-like superfamily

179

280

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.9004 9 288
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.8259 9 288
4x5y-assembly1.cif.gz_A menin in complex with mi-503 0.6108 135 253
1e2t-assembly1.cif.gz_A arylamine n-acetyltransferase (nat) from salmonella typhimurium 0.5575 137 258
8j07-assembly1.cif.gz_7 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.5523 118 216
ID Description Score Start End Superfamily
af_P9WL93_122_301_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8497 122 267 3.10.620.30
af_A4HSM4_58_281_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8418 155 214 3.10.620.30
af_Q8IY82_115_328_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8416 155 214 3.10.620.30
3isrC01 Alpha Beta;Roll;C8orf32 fold; 0.8354 99 279 3.10.620.30
af_I6XWA9_2_176_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8181 117 246 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A0J7XIW2-F1-model_v4 Transglutaminase 0.9885 102 281
AF-A0A848T6W4-F1-model_v4 Transglutaminase family protein 0.9866 103 274
AF-A0A536DFP2-F1-model_v4 Transglutaminase family protein 0.9851 117 266
AF-X0SF56-F1-model_v4 Transglutaminase-like domain-containing protein 0.9848 104 279
AF-A0A2D8K562-F1-model_v4 Transglutaminase 0.9838 12 287

Map