F471425

General Info

Members Datasets Scaffolds Average Seq Length
637 317 635 143

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10000439|Ga0157380_100004393
Length 163
Sequence MTPVRWSRRWKAPATPEKGVVKALVQRVSQAAVDVEGERVAQIGPGMLILLGVGVGDGPEEADRLAEKVGKLRIFDDAEGRMNEPLGEREVLCVSQFTLYGDARRGNRPSYVAAARPEVAEPLYDRFCERLEAKKGVFGACMGVALINDGPVTLMLEAPPAEG

Samples

Sample ID Description Type Environment
1 2847085930 Erwinia persicina B64 Isolate Bulb
2 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
174 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
175 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
211 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
212 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
309 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
314 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.16
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.16
Endosphere 0.63
Nodule 0
Rhizoplane 10.2
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008173 3300001979 Bacteria 4194
2 JGI24750J21931_1036009 3300002070 Bacteria 740
3 JGI24034J26672_10000085 3300002239 Bacteria 18326
4 JGI24742J22300_10006055 3300002244 Bacteria 1994
5 JGI24751J29686_10025259 3300002459 Bacteria 1233
6 JGI25407J50210_10008370 3300003373 Bacteria 2606
7 JGI25404J52841_10013345 3300003659 Bacteria 1781
8 Ga0070658_10035203 3300005327 Bacteria 4033
9 Ga0070676_10522537 3300005328 Bacteria 846
10 Ga0070683_100022732 3300005329 Bacteria 5608
11 Ga0070683_100287103 3300005329 Bacteria 1565
12 Ga0070670_100005551 3300005331 Bacteria 10640
13 Ga0070670_100209403 3300005331 Bacteria 1695
14 Ga0070670_100263676 3300005331 Bacteria 1502
15 Ga0070677_10000004 3300005333 Bacteria 81101
16 Ga0068869_100141084 3300005334 Bacteria 1860
17 Ga0070680_100028938 3300005336 Bacteria 4447
18 Ga0070682_100000013 3300005337 Bacteria 254641
19 Ga0070682_100024017 3300005337 Bacteria 3624
20 Ga0070682_100216332 3300005337 Bacteria 1361
21 Ga0068868_100000082 3300005338 Bacteria 57070
22 Ga0068868_100022416 3300005338 Bacteria 4765
23 Ga0068868_101219778 3300005338 Bacteria 696
24 Ga0070660_100346369 3300005339 Bacteria 1223
25 Ga0070691_10029194 3300005341 Bacteria 2579
26 Ga0070691_10209840 3300005341 Bacteria 1027
27 Ga0070687_100194309 3300005343 Bacteria 1225
28 Ga0070661_100000145 3300005344 Bacteria 58346
29 Ga0070692_10018299 3300005345 Bacteria 3367
30 Ga0070692_10184527 3300005345 Bacteria 1211
31 Ga0070668_100017212 3300005347 Bacteria 5410
32 Ga0070668_100137978 3300005347 Bacteria 1963
33 Ga0070668_100381788 3300005347 Bacteria 1199
34 Ga0070668_102034382 3300005347 Bacteria 530
35 Ga0070675_100000545 3300005354 Bacteria 25840
36 Ga0070675_100002723 3300005354 Bacteria 13282
37 Ga0070674_100000008 3300005356 Bacteria 143844
38 Ga0070674_100506692 3300005356 Bacteria 1006
39 Ga0070674_100759915 3300005356 Bacteria 834
40 Ga0070673_100009470 3300005364 Bacteria 6538
41 Ga0070688_100005250 3300005365 Bacteria 6808
42 Ga0070659_100001975 3300005366 Bacteria 14651
43 Ga0070659_100182533 3300005366 Bacteria 1722
44 Ga0070667_100005152 3300005367 Bacteria 10933
45 Ga0070703_10040040 3300005406 Bacteria 1455
46 Ga0070714_100412800 3300005435 Bacteria 1278
47 Ga0070714_101339078 3300005435 Bacteria 699
48 Ga0070713_100000568 3300005436 Bacteria 23380
49 Ga0070713_100114241 3300005436 Bacteria 2359
50 Ga0070713_100491384 3300005436 Bacteria 1157
51 Ga0070701_10155648 3300005438 Bacteria 1320
52 Ga0070711_100001852 3300005439 Bacteria 11802
53 Ga0070705_100280140 3300005440 Bacteria 1185
54 Ga0070708_100012387 3300005445 Bacteria 6959
55 Ga0070678_100011699 3300005456 Bacteria 5426
56 Ga0070678_100013404 3300005456 Bacteria 5139
57 Ga0070662_100000004 3300005457 Bacteria 195534
58 Ga0070681_10034225 3300005458 Bacteria 5102
59 Ga0068867_100000281 3300005459 Bacteria 33623
60 Ga0068867_100064271 3300005459 Bacteria 2728
61 Ga0068867_100781521 3300005459 Bacteria 850
62 Ga0070685_10000013 3300005466 Bacteria 120875
63 Ga0070706_100046850 3300005467 Bacteria 3991
64 Ga0070698_100689781 3300005471 Bacteria 963
65 Ga0070684_100100647 3300005535 Bacteria 2581
66 Ga0068853_100025611 3300005539 Bacteria 4952
67 Ga0068853_100031357 3300005539 Bacteria 4496
68 Ga0070672_100000083 3300005543 Bacteria 44812
69 Ga0070672_100005652 3300005543 Bacteria 8321
70 Ga0070686_100132540 3300005544 Bacteria 1725
71 Ga0070693_100091178 3300005547 Bacteria 1837
72 Ga0070665_100000106 3300005548 Bacteria 157315
73 Ga0070665_100030347 3300005548 Bacteria 5441
74 Ga0070665_100039291 3300005548 Bacteria 4758
75 Ga0070704_100127008 3300005549 Bacteria 1969
76 Ga0068855_100168363 3300005563 Bacteria 2482
77 Ga0068855_100583623 3300005563 Bacteria 1207
78 Ga0070664_100005074 3300005564 Bacteria 10556
79 Ga0070664_100051733 3300005564 Bacteria 3478
80 Ga0070664_100369954 3300005564 Bacteria 1306
81 Ga0068857_100223878 3300005577 Bacteria 1719
82 Ga0068857_100273152 3300005577 Bacteria 1554
83 Ga0068854_100000113 3300005578 Bacteria 55436
84 Ga0068854_100011765 3300005578 Bacteria 5712
85 Ga0068854_100125435 3300005578 Bacteria 1954
86 Ga0068856_100009507 3300005614 Bacteria 9442
87 Ga0068856_100134588 3300005614 Bacteria 2477
88 Ga0068856_100736992 3300005614 Bacteria 1005
89 Ga0070702_100046441 3300005615 Bacteria 2461
90 Ga0070702_100103762 3300005615 Bacteria 1749
91 Ga0068852_100000002 3300005616 Bacteria 268221
92 Ga0068852_100157330 3300005616 Bacteria 2118
93 Ga0068852_100202247 3300005616 Bacteria 1880
94 Ga0068852_101405333 3300005616 Bacteria 720
95 Ga0068864_100000045 3300005618 Bacteria 154739
96 Ga0068866_10000001 3300005718 Bacteria 519680
97 Ga0068866_10000237 3300005718 Bacteria 25933
98 Ga0068866_10018951 3300005718 Bacteria 3122
99 Ga0068866_10042099 3300005718 Bacteria 2271
100 Ga0068866_10099259 3300005718 Bacteria 1603
101 Ga0068866_10463691 3300005718 Bacteria 831
102 Ga0068851_10000873 3300005834 Bacteria 12997
103 Ga0068851_10015611 3300005834 Bacteria 3620
104 Ga0068851_10266747 3300005834 Bacteria 975
105 Ga0068863_100000021 3300005841 Bacteria 198088
106 Ga0068863_100377430 3300005841 Bacteria 1384
107 Ga0068863_100948972 3300005841 Bacteria 862
108 Ga0068858_100000091 3300005842 Bacteria 93802
109 Ga0068858_100000216 3300005842 Bacteria 62188
110 Ga0068858_100317404 3300005842 Bacteria 1489
111 Ga0068858_100842029 3300005842 Bacteria 896
112 Ga0068860_100009131 3300005843 Bacteria 9862
113 Ga0068860_100057876 3300005843 Bacteria 3685
114 Ga0068860_100060916 3300005843 Bacteria 3586
115 Ga0068862_100000492 3300005844 Bacteria 42127
116 Ga0081455_10018277 3300005937 Bacteria 6685
117 Ga0081538_10000141 3300005981 Bacteria 74085
118 Ga0081538_10085540 3300005981 Bacteria 1656
119 Ga0081538_10116129 3300005981 Bacteria 1299
120 Ga0081540_1000366 3300005983 Bacteria 45428
121 Ga0081540_1001258 3300005983 Bacteria 22098
122 Ga0081540_1026029 3300005983 Bacteria 3350
123 Ga0081539_10321743 3300005985 Bacteria 658
124 Ga0070716_100213309 3300006173 Bacteria 1292
125 Ga0070716_101419464 3300006173 Bacteria 565
126 Ga0097621_101082771 3300006237 Bacteria 752
127 Ga0097621_101256222 3300006237 Bacteria 698
128 Ga0068871_100017538 3300006358 Bacteria 5421
129 Ga0075428_100003912 3300006844 Bacteria 16370
130 Ga0075428_100520833 3300006844 Bacteria 1272
131 Ga0075433_10204107 3300006852 Bacteria 1757
132 Ga0075433_11404451 3300006852 Bacteria 604
133 Ga0075434_100006906 3300006871 Bacteria 10460
134 Ga0075434_100017126 3300006871 Bacteria 6974
135 Ga0068865_100000094 3300006881 Bacteria 46651
136 Ga0068865_100015512 3300006881 Bacteria 4861
137 Ga0068865_100391443 3300006881 Bacteria 1136
138 Ga0075436_100020779 3300006914 Bacteria 4504
139 Ga0075436_100159178 3300006914 Bacteria 1591
140 Ga0075436_100409490 3300006914 Bacteria 983
141 Ga0075435_100000729 3300007076 Bacteria 20397
142 Ga0075435_100048865 3300007076 Bacteria 3400
143 Ga0099794_10015383 3300007265 Bacteria 3376
144 Ga0099794_10022724 3300007265 Bacteria 2861
145 Ga0105240_10494353 3300009093 Bacteria 1361
146 Ga0111539_10039672 3300009094 Bacteria 5673
147 Ga0105245_10000016 3300009098 Bacteria 204372
148 Ga0105245_10000026 3300009098 Bacteria 163660
149 Ga0105245_10009926 3300009098 Bacteria 8293
150 Ga0105245_10035202 3300009098 Bacteria 4444
151 Ga0105245_10525578 3300009098 Bacteria 1202
152 Ga0105245_11226870 3300009098 Bacteria 798
153 Ga0105247_10000347 3300009101 Bacteria 40377
154 Ga0105247_10033210 3300009101 Bacteria 3138
155 Ga0105247_10233679 3300009101 Bacteria 1249
156 Ga0105247_10369404 3300009101 Bacteria 1014
157 Ga0114129_10478001 3300009147 Unclassified 1631
158 Ga0105243_10057794 3300009148 Bacteria 3090
159 Ga0105243_10069049 3300009148 Bacteria 2850
160 Ga0105243_12262337 3300009148 Bacteria 581
161 Ga0105241_10016196 3300009174 Bacteria 5462
162 Ga0105242_10001472 3300009176 Bacteria 18524
163 Ga0105242_10502078 3300009176 Bacteria 1154
164 Ga0105242_11345364 3300009176 Bacteria 740
165 Ga0105248_10000020 3300009177 Bacteria 284637
166 Ga0105248_10296648 3300009177 Bacteria 1820
167 Ga0105248_11982916 3300009177 Bacteria 661
168 Ga0105237_10070970 3300009545 Bacteria 3478
169 Ga0105237_10292634 3300009545 Bacteria 1631
170 Ga0105237_12670138 3300009545 Bacteria 510
171 Ga0105238_10015329 3300009551 Bacteria 7764
172 Ga0105238_10370170 3300009551 Bacteria 1423
173 Ga0105249_10000616 3300009553 Bacteria 32470
174 Ga0105249_10006098 3300009553 Bacteria 10451
175 Ga0105249_10197715 3300009553 Bacteria 1966
176 Ga0105249_11654423 3300009553 Bacteria 713
177 Ga0105239_10050697 3300010375 Bacteria 4552
178 Ga0105239_10084036 3300010375 Bacteria 3506
179 Ga0157345_1012372 3300012498 Bacteria 770
180 Ga0157371_10002155 3300013102 Bacteria 19193
181 Ga0157370_10034103 3300013104 Bacteria 4959
182 Ga0157370_10140771 3300013104 Bacteria 2248
183 Ga0157370_10439339 3300013104 Bacteria 1200
184 Ga0157369_10000014 3300013105 Bacteria 266411
185 Ga0157369_10060569 3300013105 Bacteria 4082
186 Ga0157369_10476907 3300013105 Bacteria 1291
187 Ga0157374_10003475 3300013296 Bacteria 13240
188 Ga0157374_11980598 3300013296 Bacteria 609
189 Ga0157378_10002710 3300013297 Bacteria 15778
190 Ga0157378_10003573 3300013297 Bacteria 13763
191 Ga0157378_10018525 3300013297 Bacteria 6119
192 Ga0157378_12293378 3300013297 Bacteria 591
193 Ga0163162_10247369 3300013306 Bacteria 1915
194 Ga0157372_10160141 3300013307 Bacteria 2601
195 Ga0157372_10520541 3300013307 Bacteria 1386
196 Ga0157375_10339304 3300013308 Bacteria 1668
197 Ga0157375_10994137 3300013308 Bacteria 979
198 Ga0163163_10891230 3300014325 Bacteria 953
199 Ga0163163_11614937 3300014325 Bacteria 709
200 Ga0163163_12270349 3300014325 Bacteria 601
201 Ga0157380_10000281 3300014326 Bacteria 30636
202 Ga0157380_10000439 3300014326 Bacteria 25370
203 Ga0157380_10157334 3300014326 Bacteria 1971
204 Ga0182008_10171224 3300014497 Bacteria 1096
205 Ga0157379_10020146 3300014968 Bacteria 5894
206 Ga0157379_10070389 3300014968 Bacteria 3129
207 Ga0157379_10103334 3300014968 Bacteria 2557
208 Ga0157379_10174198 3300014968 Bacteria 1942
209 Ga0157379_10969744 3300014968 Bacteria 809
210 Ga0157379_11400973 3300014968 Bacteria 678
211 Ga0157376_10036908 3300014969 Bacteria 3962
212 Ga0157376_10090119 3300014969 Bacteria 2653
213 Ga0163161_10000035 3300017792 Bacteria 155979
214 Ga0163161_10239511 3300017792 Bacteria 1411
215 Ga0206353_10300031 3300020082 Bacteria 1168
216 Ga0213872_10000098 3300021361 Bacteria 80168
217 Ga0213874_10031019 3300021377 Unclassified 1544
218 Ga0207656_10003710 3300025321 Bacteria 5286
219 Ga0207656_10008922 3300025321 Bacteria 3714
220 Ga0207653_10076640 3300025885 Bacteria 1151
221 Ga0207682_10000031 3300025893 Bacteria 57806
222 Ga0207692_10094888 3300025898 Bacteria 1625
223 Ga0207642_10000002 3300025899 Bacteria 658166
224 Ga0207642_10000719 3300025899 Bacteria 10249
225 Ga0207642_10045766 3300025899 Bacteria 1945
226 Ga0207642_10186346 3300025899 Bacteria 1135
227 Ga0207642_10255710 3300025899 Bacteria 996
228 Ga0207710_10000586 3300025900 Bacteria 21496
229 Ga0207710_10060221 3300025900 Bacteria 1720
230 Ga0207685_10000082 3300025905 Bacteria 18011
231 Ga0207645_10070724 3300025907 Bacteria 2232
232 Ga0207705_10791699 3300025909 Bacteria 736
233 Ga0207684_10039098 3300025910 Bacteria 4025
234 Ga0207707_10247318 3300025912 Bacteria 1549
235 Ga0207695_10144779 3300025913 Bacteria 2321
236 Ga0207671_10351007 3300025914 Bacteria 1170
237 Ga0207693_10577556 3300025915 Bacteria 876
238 Ga0207663_10006360 3300025916 Bacteria 6040
239 Ga0207663_10098510 3300025916 Bacteria 1958
240 Ga0207663_10942503 3300025916 Bacteria 691
241 Ga0207663_11040650 3300025916 Bacteria 657
242 Ga0207660_10122158 3300025917 Bacteria 1973
243 Ga0207660_10210123 3300025917 Bacteria 1523
244 Ga0207662_10195918 3300025918 Bacteria 1306
245 Ga0207662_10815786 3300025918 Bacteria 658
246 Ga0207657_10042053 3300025919 Bacteria 4035
247 Ga0207649_10000003 3300025920 Bacteria 388908
248 Ga0207652_10074731 3300025921 Bacteria 2951
249 Ga0207646_10556930 3300025922 Unclassified 1031
250 Ga0207694_10000004 3300025924 Bacteria 967075
251 Ga0207694_10082230 3300025924 Bacteria 2531
252 Ga0207650_10010427 3300025925 Bacteria 6369
253 Ga0207650_10145116 3300025925 Bacteria 1869
254 Ga0207650_10540173 3300025925 Bacteria 977
255 Ga0207659_10213968 3300025926 Bacteria 1546
256 Ga0207687_10000017 3300025927 Bacteria 237310
257 Ga0207687_10000018 3300025927 Bacteria 236159
258 Ga0207687_10024992 3300025927 Bacteria 3995
259 Ga0207700_10000384 3300025928 Bacteria 25706
260 Ga0207700_10089561 3300025928 Bacteria 2426
261 Ga0207700_10900642 3300025928 Bacteria 792
262 Ga0207664_10416642 3300025929 Unclassified 1196
263 Ga0207664_10905986 3300025929 Bacteria 792
264 Ga0207644_10426795 3300025931 Bacteria 1087
265 Ga0207690_10002059 3300025932 Bacteria 12325
266 Ga0207706_10000012 3300025933 Bacteria 195475
267 Ga0207706_10317639 3300025933 Bacteria 1356
268 Ga0207706_10442269 3300025933 Bacteria 1125
269 Ga0207686_10000888 3300025934 Bacteria 18054
270 Ga0207686_10017304 3300025934 Bacteria 4061
271 Ga0207686_10183716 3300025934 Bacteria 1485
272 Ga0207686_10560482 3300025934 Bacteria 894
273 Ga0207709_10003576 3300025935 Bacteria 9188
274 Ga0207669_10000004 3300025937 Bacteria 196828
275 Ga0207669_10000018 3300025937 Bacteria 114254
276 Ga0207669_10693476 3300025937 Bacteria 836
277 Ga0207704_10000088 3300025938 Bacteria 53926
278 Ga0207704_10155056 3300025938 Bacteria 1622
279 Ga0207704_10352234 3300025938 Bacteria 1147
280 Ga0207704_10382762 3300025938 Bacteria 1105
281 Ga0207704_10688562 3300025938 Bacteria 845
282 Ga0207704_10699866 3300025938 Bacteria 839
283 Ga0207665_10621997 3300025939 Bacteria 844
284 Ga0207691_10007934 3300025940 Bacteria 10214
285 Ga0207691_10008177 3300025940 Bacteria 10044
286 Ga0207691_10190751 3300025940 Bacteria 1787
287 Ga0207711_10000006 3300025941 Bacteria 792692
288 Ga0207689_10043334 3300025942 Bacteria 3720
289 Ga0207661_10029998 3300025944 Bacteria 4183
290 Ga0207661_10073958 3300025944 Bacteria 2792
291 Ga0207661_10109173 3300025944 Bacteria 2337
292 Ga0207661_10387827 3300025944 Bacteria 1265
293 Ga0207679_10014078 3300025945 Bacteria 5248
294 Ga0207679_10014260 3300025945 Bacteria 5221
295 Ga0207679_10051165 3300025945 Bacteria 3023
296 Ga0207679_10264528 3300025945 Bacteria 1468
297 Ga0207679_10846208 3300025945 Bacteria 835
298 Ga0207667_10301303 3300025949 Bacteria 1638
299 Ga0207667_10446954 3300025949 Bacteria 1314
300 Ga0207667_11193547 3300025949 Bacteria 741
301 Ga0207651_10104264 3300025960 Bacteria 2112
302 Ga0207712_10000007 3300025961 Bacteria 539589
303 Ga0207712_10003277 3300025961 Bacteria 10276
304 Ga0207712_10181569 3300025961 Bacteria 1653
305 Ga0207668_10017566 3300025972 Bacteria 4484
306 Ga0207668_10049936 3300025972 Bacteria 2879
307 Ga0207640_10000278 3300025981 Bacteria 34363
308 Ga0207640_10011876 3300025981 Bacteria 4945
309 Ga0207640_10147335 3300025981 Bacteria 1724
310 Ga0207658_10010674 3300025986 Bacteria 6243
311 Ga0207658_10039026 3300025986 Bacteria 3425
312 Ga0207677_10000519 3300026023 Bacteria 24757
313 Ga0207677_10134833 3300026023 Bacteria 1881
314 Ga0207703_10000023 3300026035 Bacteria 222018
315 Ga0207703_10000152 3300026035 Bacteria 79658
316 Ga0207703_10063806 3300026035 Bacteria 3021
317 Ga0207703_10250503 3300026035 Bacteria 1596
318 Ga0207703_10835328 3300026035 Bacteria 880
319 Ga0207703_11596575 3300026035 Bacteria 627
320 Ga0207639_10001493 3300026041 Bacteria 15745
321 Ga0207639_10037170 3300026041 Bacteria 3615
322 Ga0207639_10114118 3300026041 Bacteria 2207
323 Ga0207678_10287878 3300026067 Bacteria 1411
324 Ga0207708_10134054 3300026075 Bacteria 1938
325 Ga0207708_10236970 3300026075 Bacteria 1466
326 Ga0207708_10310874 3300026075 Bacteria 1284
327 Ga0207702_10014818 3300026078 Bacteria 6466
328 Ga0207702_10093924 3300026078 Bacteria 2632
329 Ga0207641_10000151 3300026088 Bacteria 99225
330 Ga0207641_10153602 3300026088 Bacteria 2087
331 Ga0207641_11190415 3300026088 Bacteria 761
332 Ga0207648_10000872 3300026089 Bacteria 33984
333 Ga0207648_10141419 3300026089 Bacteria 2121
334 Ga0207648_10719680 3300026089 Bacteria 926
335 Ga0207676_10000016 3300026095 Bacteria 311561
336 Ga0207674_10020885 3300026116 Bacteria 7066
337 Ga0207674_10103847 3300026116 Bacteria 2821
338 Ga0207683_10021226 3300026121 Bacteria 5557
339 Ga0207683_10092674 3300026121 Bacteria 2692
340 Ga0207683_10237463 3300026121 Bacteria 1662
341 Ga0207698_10000004 3300026142 Bacteria 313614
342 Ga0207698_10223428 3300026142 Bacteria 1704
343 Ga0207698_11111638 3300026142 Bacteria 803
344 Ga0209588_1027045 3300027671 Bacteria 1824
345 Ga0209588_1056343 3300027671 Bacteria 1271
346 Ga0268266_10000047 3300028379 Bacteria 310996
347 Ga0268266_10022551 3300028379 Bacteria 5363
348 Ga0268266_11175425 3300028379 Bacteria 742
349 Ga0268265_10001435 3300028380 Bacteria 20111
350 Ga0268264_10006050 3300028381 Bacteria 10226
351 Ga0268264_10035372 3300028381 Bacteria 4112
352 Ga0265326_10000515 3300028558 Bacteria 14849
353 Ga0265319_1001877 3300028563 Bacteria 11951
354 Ga0265319_1011985 3300028563 Bacteria 3524
355 Ga0265334_10121632 3300028573 Bacteria 933
356 Ga0265318_10012595 3300028577 Bacteria 3593
357 Ga0265318_10041182 3300028577 Bacteria 1757
358 Ga0265336_10000005 3300028666 Bacteria 399349
359 Ga0265336_10051010 3300028666 Bacteria 1250
360 Ga0265336_10053720 3300028666 Bacteria 1214
361 Ga0265338_10000001 3300028800 Bacteria 1177449
362 Ga0265338_10000185 3300028800 Bacteria 116333
363 Ga0265324_10004931 3300029957 Bacteria 5869
364 Ga0307511_10298276 3300030521 Unclassified 730
365 Ga0265328_10115316 3300031239 Bacteria 1000
366 Ga0265320_10044969 3300031240 Bacteria 2172
367 Ga0265320_10166384 3300031240 Bacteria 991
368 Ga0265325_10248162 3300031241 Bacteria 807
369 Ga0265340_10000001 3300031247 Bacteria 1647668
370 Ga0265339_10186865 3300031249 Bacteria 1029
371 Ga0265331_10024934 3300031250 Bacteria 3021
372 Ga0265327_10045033 3300031251 Bacteria 2347
373 Ga0265316_10378637 3300031344 Bacteria 1021
374 Ga0265313_10073764 3300031595 Bacteria 1566
375 Ga0265314_10120301 3300031711 Bacteria 1654
376 Ga0316576_10257903 3300031727 Bacteria 1308
377 Ga0307410_10682923 3300031852 Bacteria 864
378 Ga0307409_100251145 3300031995 Bacteria 1617
379 Ga0307416_102136299 3300032002 Bacteria 662
380 Ga0307416_102644878 3300032002 Bacteria 599
381 Ga0307415_100017980 3300032126 Bacteria 4255
382 Ga0316580_10016355 3300032139 Bacteria 2276
383 Ga0373933_1074408 3300035724 Bacteria 530
384 Ga0373933_1159050 3300035724 Bacteria 509
385 Ga0373937_0230833 3300036401 Bacteria 1743
386 Ga0373937_0515827 3300036401 Unclassified 1136
387 Ga0316582_0062455 3300036647 Bacteria 2392
388 Ga0316584_0001138 3300036712 Bacteria 15619
389 Ga0316584_0119883 3300036712 Bacteria 1966
390 Ga0373925_0477831 3300037068 Bacteria 1022
391 Ga0395900_0139332 3300037418 Bacteria 2485
392 Ga0395900_0297602 3300037418 Bacteria 1601
393 Ga0395898_0069843 3300037466 Bacteria 3397
394 Ga0395898_0141655 3300037466 Bacteria 2302
395 Ga0395898_0426121 3300037466 Bacteria 1264
396 Ga0395898_1044399 3300037466 Bacteria 752
397 Ga0395898_1220811 3300037466 Bacteria 683
398 Ga0395905_0178396 3300037471 Bacteria 1994
399 Ga0395905_0575048 3300037471 Bacteria 1028
400 Ga0395905_0825175 3300037471 Bacteria 830
401 Ga0316581_0005128 3300037588 Bacteria 3391
402 Ga0395901_0018398 3300038443 Bacteria 7131
403 Ga0395901_0052502 3300038443 Bacteria 4237
404 Ga0395901_0152207 3300038443 Bacteria 2431
405 Ga0395901_0192138 3300038443 Bacteria 2141
406 Ga0395901_0499757 3300038443 Bacteria 1238
407 Ga0400483_076593 3300039062 Bacteria 3071
408 Ga0400483_185685 3300039062 Bacteria 3871
409 Ga0436365_0418890 3300039437 Bacteria 1005
410 Ga0436362_1065511 3300039453 Bacteria 1514
411 Ga0451789_0083276 3300041443 Bacteria 615
412 Ga0451804_1059469 3300041463 Bacteria 623
413 Ga0451849_1280559 3300041505 Bacteria 962
414 Ga0451849_1303005 3300041505 Bacteria 539
415 Ga0451853_1628146 3300041512 Bacteria 3816
416 Ga0451853_2782007 3300041512 Bacteria 2121
417 Ga0466965_0201876 3300044683 Bacteria 1055
418 Ga0466963_0000001 3300044694 Bacteria 110556
419 Ga0466963_0048694 3300044694 Bacteria 2801
420 Ga0466963_0054081 3300044694 Bacteria 2668
421 Ga0466963_0162512 3300044694 Bacteria 1554
422 Ga0466964_0127729 3300044706 Bacteria 1154
423 Ga0466964_0865855 3300044706 Bacteria 515
424 Ga0466971_0008114 3300044719 Bacteria 4579
425 Ga0466971_0417840 3300044719 Bacteria 655
426 Ga0466968_0090666 3300044735 Unclassified 1354
427 Ga0466957_0000867 3300044842 Bacteria 15537
428 Ga0466957_0050053 3300044842 Bacteria 2542
429 Ga0466957_0134356 3300044842 Bacteria 1588
430 Ga0466960_0234143 3300044901 Unclassified 1015
431 Ga0466959_0008308 3300045049 Bacteria 7331
432 Ga0466958_0054711 3300045836 Bacteria 2420
433 Ga0466958_0082698 3300045836 Bacteria 1978
434 Ga0466967_0013954 3300045976 Bacteria 6234
435 Ga0466967_0029047 3300045976 Bacteria 4623
436 Ga0466967_0097064 3300045976 Bacteria 2689
437 Ga0466967_0101260 3300045976 Bacteria 2633
438 Ga0466967_0375794 3300045976 Bacteria 1379
439 Ga0495592_0081337 3300046454 Bacteria 2342
440 Ga0495592_0133692 3300046454 Bacteria 1732
441 Ga0495603_0472128 3300046455 Bacteria 718
442 Ga0495629_0001048 3300046459 Bacteria 22105
443 Ga0495629_0019036 3300046459 Bacteria 4910
444 Ga0495638_0026563 3300046460 Bacteria 3751
445 Ga0495641_0000044 3300046461 Bacteria 77415
446 Ga0495641_0179217 3300046461 Bacteria 949
447 Ga0495651_0276682 3300046462 Bacteria 1136
448 Ga0495653_0242572 3300046463 Bacteria 1200
449 Ga0495582_0483030 3300046473 Bacteria 716
450 Ga0495605_0298986 3300046474 Bacteria 681
451 Ga0495639_0159059 3300046475 Bacteria 1093
452 Ga0495639_0182680 3300046475 Bacteria 1022
453 Ga0495662_0000061 3300046476 Bacteria 37295
454 Ga0495662_0192616 3300046476 Bacteria 1005
455 Ga0495585_0589985 3300046492 Bacteria 523
456 Ga0495594_0000006 3300046499 Bacteria 167901
457 Ga0495608_0000007 3300046511 Bacteria 313495
458 Ga0495608_0005192 3300046511 Bacteria 9304
459 Ga0495608_0015106 3300046511 Bacteria 5357
460 Ga0495610_0110402 3300046512 Bacteria 1219
461 Ga0495618_0000174 3300046514 Bacteria 45942
462 Ga0495618_0169909 3300046514 Bacteria 1388
463 Ga0495618_0605452 3300046514 Bacteria 652
464 Ga0495620_0000144 3300046515 Bacteria 58204
465 Ga0495628_0002849 3300046516 Bacteria 15497
466 Ga0495628_0012147 3300046516 Bacteria 7259
467 Ga0495628_0035786 3300046516 Bacteria 3989
468 Ga0495628_0123330 3300046516 Bacteria 1986
469 Ga0495628_0837493 3300046516 Bacteria 642
470 Ga0495630_0000014 3300046517 Bacteria 217229
471 Ga0495630_0000408 3300046517 Bacteria 33471
472 Ga0495630_0625594 3300046517 Bacteria 825
473 Ga0495652_0000010 3300046529 Bacteria 261584
474 Ga0495621_0015316 3300046539 Bacteria 2443
475 Ga0495621_0263554 3300046539 Bacteria 706
476 Ga0495645_0009482 3300046543 Bacteria 6803
477 Ga0495645_0513780 3300046543 Bacteria 747
478 Ga0495645_0735645 3300046543 Unclassified 596
479 Ga0495622_0000201 3300046557 Bacteria 47462
480 Ga0495633_0101344 3300046558 Bacteria 1336
481 Ga0495667_0380627 3300046559 Bacteria 890
482 Ga0495656_0001383 3300046615 Bacteria 7931
483 Ga0495668_0393425 3300046616 Bacteria 761
484 Ga0495634_0000018 3300046642 Bacteria 121323
485 Ga0495634_0000247 3300046642 Bacteria 50931
486 Ga0495634_0005521 3300046642 Bacteria 9712
487 Ga0495635_0000016 3300046663 Bacteria 214088
488 Ga0495635_0046415 3300046663 Bacteria 2997
489 Ga0495588_0000992 3300046674 Bacteria 12398
490 Ga0495657_0000001 3300046675 Bacteria 445641
491 Ga0495657_0015946 3300046675 Bacteria 5482
492 Ga0495647_0000136 3300046681 Bacteria 18523
493 Ga0495647_0199127 3300046681 Bacteria 878
494 Ga0495658_0000005 3300046683 Bacteria 149839
495 Ga0495658_0009433 3300046683 Bacteria 4864
496 Ga0495669_0000211 3300046684 Bacteria 35387
497 Ga0495669_0073819 3300046684 Bacteria 1558
498 Ga0495613_0000032 3300046689 Bacteria 139806
499 Ga0495613_0083219 3300046689 Bacteria 2324
500 Ga0495624_0088469 3300046690 Bacteria 1912
501 Ga0495670_0053440 3300046691 Bacteria 2023
502 Ga0495600_0001684 3300046809 Bacteria 12350
503 Ga0495600_0007043 3300046809 Bacteria 6870
504 Ga0495600_0230080 3300046809 Unclassified 1184
505 Ga0495604_0000718 3300047317 Bacteria 28069
506 Ga0495604_0095236 3300047317 Bacteria 2199
507 Ga0495674_0717750 3300047319 Unclassified 783
508 Ga0495672_0074427 3300047320 Bacteria 1913
509 Ga0495676_0018293 3300047321 Bacteria 6178
510 Ga0495676_0027723 3300047321 Bacteria 4853
511 Ga0495676_0286997 3300047321 Bacteria 1113
512 Ga0495680_0000773 3300047322 Bacteria 35829
513 Ga0495680_0157340 3300047322 Bacteria 1652
514 Ga0495675_0000017 3300047444 Bacteria 123394
515 Ga0495679_073860 3300047446 Bacteria 978
516 Ga0495593_0055228 3300047673 Bacteria 2091
517 Ga0495602_0000007 3300048088 Bacteria 273212
518 Ga0495602_0009797 3300048088 Bacteria 9948
519 Ga0496100_0000002 3300048903 Bacteria 489057
520 Ga0496100_1084357 3300048903 Bacteria 631
521 Ga0496100_1695506 3300048903 Bacteria 500
522 Ga0496101_0000001 3300048904 Bacteria 489057
523 Ga0496101_0014452 3300048904 Bacteria 5307
524 Ga0496101_0015579 3300048904 Bacteria 5126
525 Ga0496102_0031518 3300048905 Bacteria 4756
526 Ga0496102_0268743 3300048905 Bacteria 1608
527 Ga0496102_0905609 3300048905 Bacteria 804
528 Ga0496102_1208822 3300048905 Unclassified 675
529 Ga0496103_0213967 3300048906 Bacteria 1239
530 Ga0496104_0000009 3300048907 Bacteria 488055
531 Ga0496104_0000015 3300048907 Bacteria 374530
532 Ga0496104_0249160 3300048907 Bacteria 1689
533 Ga0496105_0000004 3300048908 Bacteria 475798
534 Ga0496105_0000007 3300048908 Bacteria 339658
535 Ga0496106_0000061 3300048909 Bacteria 86524
536 Ga0496106_0000997 3300048909 Bacteria 20676
537 Ga0496106_0010671 3300048909 Bacteria 6788
538 Ga0496106_0134275 3300048909 Bacteria 1942
539 Ga0496106_0676807 3300048909 Bacteria 823
540 Ga0496106_0836425 3300048909 Bacteria 729
541 Ga0496107_0000013 3300048910 Bacteria 178284
542 Ga0496107_0006601 3300048910 Bacteria 7986
543 Ga0496107_0956415 3300048910 Bacteria 623
544 Ga0496108_0000001 3300048911 Bacteria 919044
545 Ga0496108_0000187 3300048911 Bacteria 57568
546 Ga0496108_0000288 3300048911 Bacteria 43361
547 Ga0496108_0011964 3300048911 Bacteria 7059
548 Ga0496108_0076000 3300048911 Bacteria 2838
549 Ga0496108_0084005 3300048911 Bacteria 2701
550 Ga0496109_0000003 3300048912 Bacteria 420862
551 Ga0496109_0000012 3300048912 Bacteria 229699
552 Ga0496109_0000636 3300048912 Bacteria 29254
553 Ga0496109_0022094 3300048912 Bacteria 5631
554 Ga0496109_0061038 3300048912 Bacteria 3446
555 Ga0496109_0426213 3300048912 Bacteria 1253
556 Ga0496109_1172796 3300048912 Bacteria 705
557 Ga0496109_1570275 3300048912 Bacteria 592
558 Ga0496110_0000371 3300048913 Bacteria 30051
559 Ga0496110_0014030 3300048913 Bacteria 6641
560 Ga0496110_0227735 3300048913 Bacteria 1695
561 Ga0496110_0508727 3300048913 Bacteria 1096
562 Ga0496110_0907754 3300048913 Bacteria 787
563 Ga0496111_0000008 3300048914 Bacteria 96148
564 Ga0496111_0017072 3300048914 Bacteria 5011
565 Ga0496111_0726005 3300048914 Bacteria 722
566 Ga0496112_0000003 3300048915 Bacteria 660147
567 Ga0496112_0094261 3300048915 Bacteria 2964
568 Ga0496112_0374073 3300048915 Bacteria 1366
569 Ga0496112_0759185 3300048915 Bacteria 896
570 Ga0496112_1044758 3300048915 Bacteria 736
571 Ga0496113_0037947 3300048916 Bacteria 3539
572 Ga0496113_0095191 3300048916 Bacteria 2301
573 Ga0496113_0418587 3300048916 Bacteria 1076
574 Ga0496113_0737338 3300048916 Bacteria 785
575 Ga0496114_0048234 3300048917 Bacteria 3543
576 Ga0496114_0075680 3300048917 Bacteria 2836
577 Ga0496115_0000232 3300048918 Bacteria 50769
578 Ga0496115_0000429 3300048918 Bacteria 34014
579 Ga0496115_0104399 3300048918 Bacteria 2326
580 Ga0496115_0195232 3300048918 Bacteria 1672
581 Ga0496115_0722411 3300048918 Unclassified 781
582 Ga0496125_0085955 3300048928 Bacteria 2381
583 Ga0496126_0003394 3300048929 Bacteria 20156
584 Ga0496126_0011173 3300048929 Bacteria 9319
585 Ga0501034_0000469 3300049571 Bacteria 66571
586 Ga0501034_0926233 3300049571 Bacteria 758
587 Ga0501034_1183776 3300049571 Unclassified 643
588 Ga0501038_0370782 3300049574 Bacteria 1112
589 Ga0501042_0041312 3300049578 Bacteria 3279
590 Ga0501042_0297961 3300049578 Bacteria 1165
591 Ga0501067_0000073 3300049583 Bacteria 57130
592 Ga0501067_0011503 3300049583 Bacteria 4903
593 Ga0501068_0000683 3300049584 Bacteria 17361
594 Ga0501068_1039508 3300049584 Bacteria 541
595 Ga0501069_0000063 3300049585 Bacteria 59140
596 Ga0501069_0004608 3300049585 Bacteria 7133
597 Ga0501070_0194407 3300049586 Bacteria 1666
598 Ga0501071_0128823 3300049587 Bacteria 1879
599 Ga0501071_0434010 3300049587 Bacteria 1005
600 Ga0501075_0004347 3300049591 Bacteria 9586
601 Ga0501044_1004908 3300049823 Bacteria 706
602 nmdc:mga00v17_1003977_c1 3300050491 Bacteria 525
603 nmdc:mga05p37_1571662_c1 3300050507 Unclassified 650
604 nmdc:mga0qj67_256096_c1 3300050509 Bacteria 1420
605 nmdc:mga06r32_169736_c1 3300050510 Bacteria 2165
606 nmdc:mga08y16_52506_c1 3300050511 Bacteria 4265
607 nmdc:mga0n895_89014_c1 3300050512 Bacteria 3088
608 nmdc:mga0rr50_11358_c1 3300050513 Bacteria 5698
609 nmdc:mga0rr50_45142_c1 3300050513 Bacteria 3236
610 nmdc:mga08x19_111915_c1 3300050514 Bacteria 1822
611 nmdc:mga08x19_433321_c1 3300050514 Bacteria 924
612 Ga0495601_0010373 3300053077 Bacteria 5543
613 Ga0495601_0053946 3300053077 Bacteria 2542
614 Ga0495601_0195665 3300053077 Unclassified 1321
615 Ga0495601_0377896 3300053077 Unclassified 920
616 Ga0495612_0020813 3300053078 Bacteria 2630
617 Ga0495612_0034982 3300053078 Bacteria 2035
618 Ga0495612_0070968 3300053078 Bacteria 1452
619 Ga0495655_0002340 3300053083 Bacteria 2996
620 Ga0495595_0000002 3300053084 Bacteria 445641
621 Ga0495595_0000103 3300053084 Bacteria 38598
622 Ga0495595_0011187 3300053084 Bacteria 3748
623 Ga0495619_0000025 3300053085 Bacteria 167905
624 Ga0495619_0000053 3300053085 Bacteria 98761
625 Ga0495619_0000081 3300053085 Bacteria 72034
626 Ga0495619_0001003 3300053085 Bacteria 18481
627 Ga0495619_0003474 3300053085 Bacteria 10169
628 Ga0495619_0005151 3300053085 Bacteria 8297
629 Ga0495619_0040287 3300053085 Bacteria 3054
630 Ga0500641_0001810 3300053096 Bacteria 7579
631 Ga0500554_065422 3300053102 Bacteria 1174
632 Ga0500614_000117 3300053123 Bacteria 19001
633 Ga0501084_0107659 3300054114 Bacteria 2342
634 Ga0466962_0043913 3300061719 Bacteria 2138
635 Ga0530510_0036015 3300061734 Bacteria 3567

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100001852 Ga0070711_1000018522 112
2 3300025916 Ga0207663_10006360 Ga0207663_100063605 112
3 3300053085 Ga0495619_0000081 Ga0495619_0000081_3501_3839 112
4 3300005338 Ga0068868_101219778 Ga0068868_1012197781 126
5 3300005347 Ga0070668_100137978 Ga0070668_1001379783 126
6 3300005354 Ga0070675_100000545 Ga0070675_1000005453 126
7 3300005436 Ga0070713_100114241 Ga0070713_1001142412 126
8 3300005440 Ga0070705_100280140 Ga0070705_1002801402 126
9 3300005458 Ga0070681_10034225 Ga0070681_100342255 126
10 3300005459 Ga0068867_100064271 Ga0068867_1000642712 126
11 3300005563 Ga0068855_100583623 Ga0068855_1005836232 126
12 3300005578 Ga0068854_100000113 Ga0068854_10000011315 126
13 3300005615 Ga0070702_100103762 Ga0070702_1001037622 126
14 3300005718 Ga0068866_10463691 Ga0068866_104636912 126
15 3300006852 Ga0075433_11404451 Ga0075433_114044511 126
16 3300009098 Ga0105245_10009926 Ga0105245_100099267 126
17 3300009148 Ga0105243_10057794 Ga0105243_100577942 126
18 3300025918 Ga0207662_10815786 Ga0207662_108157861 126
19 3300025927 Ga0207687_10024992 Ga0207687_100249924 126
20 3300025928 Ga0207700_10089561 Ga0207700_100895613 126
21 3300025933 Ga0207706_10442269 Ga0207706_104422693 126
22 3300025935 Ga0207709_10003576 Ga0207709_100035766 126
23 3300025949 Ga0207667_11193547 Ga0207667_111935472 126
24 3300025972 Ga0207668_10049936 Ga0207668_100499363 126
25 3300025981 Ga0207640_10000278 Ga0207640_1000027821 126
26 3300026023 Ga0207677_10134833 Ga0207677_101348332 126
27 3300026089 Ga0207648_10141419 Ga0207648_101414193 126
28 3300044842 Ga0466957_0000867 Ga0466957_0000867_11682_12122 126
29 3300044842 Ga0466957_0050053 Ga0466957_0050053_1795_2238 126
30 3300046689 Ga0495613_0000032 Ga0495613_0000032_57207_57653 126
31 3300047317 Ga0495604_0000718 Ga0495604_0000718_21969_22412 126
32 3300048907 Ga0496104_0249160 Ga0496104_0249160_1047_1490 126
33 3300049574 Ga0501038_0370782 Ga0501038_0370782_12_419 126
34 3300053083 Ga0495655_0002340 Ga0495655_0002340_1307_1750 126
35 3300046512 Ga0495610_0110402 Ga0495610_0110402_474_914 127
36 3300048913 Ga0496110_0000371 Ga0496110_0000371_10219_10659 127
37 3300048914 Ga0496111_0000008 Ga0496111_0000008_16698_17138 127
38 3300013102 Ga0157371_10002155 Ga0157371_1000215522 128
39 3300041505 Ga0451849_1280559 Ga0451849_1280559_34_465 128
40 3300005435 Ga0070714_101339078 Ga0070714_1013390782 129
41 3300005834 Ga0068851_10000873 Ga0068851_1000087315 129
42 3300025321 Ga0207656_10003710 Ga0207656_100037103 129
43 3300045836 Ga0466958_0082698 Ga0466958_0082698_1487_1930 129
44 3300005329 Ga0070683_100287103 Ga0070683_1002871032 130
45 3300005337 Ga0070682_100216332 Ga0070682_1002163321 130
46 3300014497 Ga0182008_10171224 Ga0182008_101712241 130
47 3300046616 Ga0495668_0393425 Ga0495668_0393425_304_720 130
48 3300007265 Ga0099794_10015383 Ga0099794_100153833 131
49 3300007265 Ga0099794_10022724 Ga0099794_100227241 131
50 3300014325 Ga0163163_10891230 Ga0163163_108912302 131
51 3300044683 Ga0466965_0201876 Ga0466965_0201876_480_878 131
52 3300044694 Ga0466963_0048694 Ga0466963_0048694_382_780 131
53 3300044719 Ga0466971_0008114 Ga0466971_0008114_558_956 131
54 3300045049 Ga0466959_0008308 Ga0466959_0008308_1295_1693 131
55 3300045836 Ga0466958_0054711 Ga0466958_0054711_805_1203 131
56 3300046475 Ga0495639_0159059 Ga0495639_0159059_20_439 131
57 3300047321 Ga0495676_0027723 Ga0495676_0027723_4155_4643 131
58 3300061719 Ga0466962_0043913 Ga0466962_0043913_1209_1607 131
59 3300005445 Ga0070708_100012387 Ga0070708_1000123874 132
60 3300031240 Ga0265320_10044969 Ga0265320_100449692 132
61 3300046674 Ga0495588_0000992 Ga0495588_0000992_3449_3874 133
62 3300053096 Ga0500641_0001810 Ga0500641_0001810_3067_3483 133
63 3300005356 Ga0070674_100000008 Ga0070674_10000000812 134
64 3300005364 Ga0070673_100009470 Ga0070673_1000094704 134
65 3300005718 Ga0068866_10000237 Ga0068866_1000023720 134
66 3300005843 Ga0068860_100009131 Ga0068860_1000091315 134
67 3300005981 Ga0081538_10116129 Ga0081538_101161292 134
68 3300006914 Ga0075436_100409490 Ga0075436_1004094902 134
69 3300013307 Ga0157372_10520541 Ga0157372_105205412 134
70 3300025899 Ga0207642_10000719 Ga0207642_100007193 134
71 3300025937 Ga0207669_10000004 Ga0207669_10000004196 134
72 3300025960 Ga0207651_10104264 Ga0207651_101042642 134
73 3300028381 Ga0268264_10006050 Ga0268264_100060505 134
74 3300049578 Ga0501042_0041312 Ga0501042_0041312_2201_2605 134
75 iso_pu_bacteria 2847085930 2847089783 134
76 iso_pu_bacteria 3000405567 3000407837 134
77 3300014325 Ga0163163_11614937 Ga0163163_116149372 135
78 3300046475 Ga0495639_0182680 Ga0495639_0182680_16_423 135
79 3300046516 Ga0495628_0837493 Ga0495628_0837493_188_595 135
80 3300049584 Ga0501068_1039508 Ga0501068_1039508_115_522 135
81 3300025909 Ga0207705_10791699 Ga0207705_107916992 137
82 3300026035 Ga0207703_11596575 Ga0207703_115965751 137
83 3300049571 Ga0501034_1183776 Ga0501034_1183776_118_555 137
84 3300049823 Ga0501044_1004908 Ga0501044_1004908_234_671 137
85 3300001979 JGI24740J21852_10008173 JGI24740J21852_100081735 138
86 3300002070 JGI24750J21931_1036009 JGI24750J21931_10360091 138
87 3300002239 JGI24034J26672_10000085 JGI24034J26672_1000008516 138
88 3300002244 JGI24742J22300_10006055 JGI24742J22300_100060552 138
89 3300002459 JGI24751J29686_10025259 JGI24751J29686_100252592 138
90 3300003373 JGI25407J50210_10008370 JGI25407J50210_100083703 138
91 3300003659 JGI25404J52841_10013345 JGI25404J52841_100133451 138
92 3300005327 Ga0070658_10035203 Ga0070658_100352033 138
93 3300005328 Ga0070676_10522537 Ga0070676_105225372 138
94 3300005329 Ga0070683_100022732 Ga0070683_1000227323 138
95 3300005331 Ga0070670_100005551 Ga0070670_1000055516 138
96 3300005331 Ga0070670_100209403 Ga0070670_1002094032 138
97 3300005331 Ga0070670_100263676 Ga0070670_1002636761 138
98 3300005333 Ga0070677_10000004 Ga0070677_1000000451 138
99 3300005334 Ga0068869_100141084 Ga0068869_1001410843 138
100 3300005336 Ga0070680_100028938 Ga0070680_1000289385 138
101 3300005337 Ga0070682_100000013 Ga0070682_10000001372 138
102 3300005337 Ga0070682_100024017 Ga0070682_1000240175 138
103 3300005338 Ga0068868_100000082 Ga0068868_10000008218 138
104 3300005338 Ga0068868_100022416 Ga0068868_1000224162 138
105 3300005339 Ga0070660_100346369 Ga0070660_1003463692 138
106 3300005341 Ga0070691_10029194 Ga0070691_100291941 138
107 3300005341 Ga0070691_10209840 Ga0070691_102098401 138
108 3300005343 Ga0070687_100194309 Ga0070687_1001943092 138
109 3300005344 Ga0070661_100000145 Ga0070661_1000001457 138
110 3300005345 Ga0070692_10018299 Ga0070692_100182993 138
111 3300005345 Ga0070692_10184527 Ga0070692_101845272 138
112 3300005347 Ga0070668_100017212 Ga0070668_1000172126 138
113 3300005347 Ga0070668_100381788 Ga0070668_1003817883 138
114 3300005347 Ga0070668_102034382 Ga0070668_1020343821 138
115 3300005354 Ga0070675_100002723 Ga0070675_1000027238 138
116 3300005356 Ga0070674_100506692 Ga0070674_1005066922 138
117 3300005356 Ga0070674_100759915 Ga0070674_1007599151 138
118 3300005365 Ga0070688_100005250 Ga0070688_1000052503 138
119 3300005366 Ga0070659_100001975 Ga0070659_10000197513 138
120 3300005366 Ga0070659_100182533 Ga0070659_1001825332 138
121 3300005367 Ga0070667_100005152 Ga0070667_10000515210 138
122 3300005406 Ga0070703_10040040 Ga0070703_100400402 138
123 3300005435 Ga0070714_100412800 Ga0070714_1004128002 138
124 3300005436 Ga0070713_100000568 Ga0070713_1000005686 138
125 3300005436 Ga0070713_100491384 Ga0070713_1004913842 138
126 3300005438 Ga0070701_10155648 Ga0070701_101556482 138
127 3300005456 Ga0070678_100011699 Ga0070678_1000116992 138
128 3300005456 Ga0070678_100013404 Ga0070678_1000134045 138
129 3300005457 Ga0070662_100000004 Ga0070662_10000000466 138
130 3300005459 Ga0068867_100000281 Ga0068867_1000002813 138
131 3300005459 Ga0068867_100781521 Ga0068867_1007815212 138
132 3300005466 Ga0070685_10000013 Ga0070685_1000001344 138
133 3300005467 Ga0070706_100046850 Ga0070706_1000468502 138
134 3300005471 Ga0070698_100689781 Ga0070698_1006897812 138
135 3300005535 Ga0070684_100100647 Ga0070684_1001006472 138
136 3300005539 Ga0068853_100025611 Ga0068853_1000256115 138
137 3300005539 Ga0068853_100031357 Ga0068853_1000313572 138
138 3300005543 Ga0070672_100000083 Ga0070672_10000008344 138
139 3300005543 Ga0070672_100005652 Ga0070672_1000056527 138
140 3300005544 Ga0070686_100132540 Ga0070686_1001325402 138
141 3300005547 Ga0070693_100091178 Ga0070693_1000911783 138
142 3300005548 Ga0070665_100000106 Ga0070665_100000106109 138
143 3300005548 Ga0070665_100030347 Ga0070665_1000303473 138
144 3300005548 Ga0070665_100039291 Ga0070665_1000392915 138
145 3300005549 Ga0070704_100127008 Ga0070704_1001270082 138
146 3300005563 Ga0068855_100168363 Ga0068855_1001683633 138
147 3300005564 Ga0070664_100005074 Ga0070664_1000050745 138
148 3300005564 Ga0070664_100051733 Ga0070664_1000517337 138
149 3300005564 Ga0070664_100369954 Ga0070664_1003699542 138
150 3300005577 Ga0068857_100223878 Ga0068857_1002238781 138
151 3300005577 Ga0068857_100273152 Ga0068857_1002731523 138
152 3300005578 Ga0068854_100011765 Ga0068854_1000117654 138
153 3300005578 Ga0068854_100125435 Ga0068854_1001254353 138
154 3300005614 Ga0068856_100009507 Ga0068856_1000095079 138
155 3300005614 Ga0068856_100134588 Ga0068856_1001345882 138
156 3300005614 Ga0068856_100736992 Ga0068856_1007369922 138
157 3300005615 Ga0070702_100046441 Ga0070702_1000464411 138
158 3300005616 Ga0068852_100000002 Ga0068852_100000002102 138
159 3300005616 Ga0068852_100157330 Ga0068852_1001573303 138
160 3300005616 Ga0068852_100202247 Ga0068852_1002022474 138
161 3300005616 Ga0068852_101405333 Ga0068852_1014053332 138
162 3300005618 Ga0068864_100000045 Ga0068864_100000045148 138
163 3300005718 Ga0068866_10000001 Ga0068866_10000001338 138
164 3300005718 Ga0068866_10018951 Ga0068866_100189512 138
165 3300005718 Ga0068866_10042099 Ga0068866_100420993 138
166 3300005718 Ga0068866_10099259 Ga0068866_100992591 138
167 3300005834 Ga0068851_10015611 Ga0068851_100156112 138
168 3300005834 Ga0068851_10266747 Ga0068851_102667472 138
169 3300005841 Ga0068863_100000021 Ga0068863_100000021193 138
170 3300005841 Ga0068863_100377430 Ga0068863_1003774302 138
171 3300005841 Ga0068863_100948972 Ga0068863_1009489722 138
172 3300005842 Ga0068858_100000091 Ga0068858_10000009141 138
173 3300005842 Ga0068858_100000216 Ga0068858_10000021625 138
174 3300005842 Ga0068858_100317404 Ga0068858_1003174043 138
175 3300005842 Ga0068858_100842029 Ga0068858_1008420292 138
176 3300005843 Ga0068860_100057876 Ga0068860_1000578764 138
177 3300005843 Ga0068860_100060916 Ga0068860_1000609162 138
178 3300005844 Ga0068862_100000492 Ga0068862_10000049227 138
179 3300005937 Ga0081455_10018277 Ga0081455_100182776 138
180 3300005981 Ga0081538_10000141 Ga0081538_1000014132 138
181 3300005981 Ga0081538_10085540 Ga0081538_100855402 138
182 3300005983 Ga0081540_1000366 Ga0081540_100036646 138
183 3300005983 Ga0081540_1001258 Ga0081540_100125816 138
184 3300005983 Ga0081540_1026029 Ga0081540_10260292 138
185 3300005985 Ga0081539_10321743 Ga0081539_103217431 138
186 3300006173 Ga0070716_100213309 Ga0070716_1002133092 138
187 3300006173 Ga0070716_101419464 Ga0070716_1014194641 138
188 3300006237 Ga0097621_101082771 Ga0097621_1010827712 138
189 3300006237 Ga0097621_101256222 Ga0097621_1012562221 138
190 3300006358 Ga0068871_100017538 Ga0068871_1000175382 138
191 3300006844 Ga0075428_100003912 Ga0075428_1000039125 138
192 3300006844 Ga0075428_100520833 Ga0075428_1005208332 138
193 3300006852 Ga0075433_10204107 Ga0075433_102041073 138
194 3300006871 Ga0075434_100006906 Ga0075434_10000690610 138
195 3300006871 Ga0075434_100017126 Ga0075434_1000171262 138
196 3300006881 Ga0068865_100000094 Ga0068865_10000009416 138
197 3300006881 Ga0068865_100015512 Ga0068865_1000155123 138
198 3300006881 Ga0068865_100391443 Ga0068865_1003914432 138
199 3300006914 Ga0075436_100020779 Ga0075436_1000207793 138
200 3300006914 Ga0075436_100159178 Ga0075436_1001591783 138
201 3300007076 Ga0075435_100000729 Ga0075435_1000007296 138
202 3300007076 Ga0075435_100048865 Ga0075435_1000488654 138
203 3300009093 Ga0105240_10494353 Ga0105240_104943532 138
204 3300009094 Ga0111539_10039672 Ga0111539_100396724 138
205 3300009098 Ga0105245_10000016 Ga0105245_1000001617 138
206 3300009098 Ga0105245_10000026 Ga0105245_10000026132 138
207 3300009098 Ga0105245_10035202 Ga0105245_100352025 138
208 3300009098 Ga0105245_10525578 Ga0105245_105255782 138
209 3300009098 Ga0105245_11226870 Ga0105245_112268702 138
210 3300009101 Ga0105247_10000347 Ga0105247_1000034721 138
211 3300009101 Ga0105247_10033210 Ga0105247_100332102 138
212 3300009101 Ga0105247_10233679 Ga0105247_102336792 138
213 3300009101 Ga0105247_10369404 Ga0105247_103694042 138
214 3300009147 Ga0114129_10478001 Ga0114129_104780013 138
215 3300009148 Ga0105243_10069049 Ga0105243_100690492 138
216 3300009148 Ga0105243_12262337 Ga0105243_122623371 138
217 3300009174 Ga0105241_10016196 Ga0105241_100161965 138
218 3300009176 Ga0105242_10001472 Ga0105242_100014724 138
219 3300009176 Ga0105242_10502078 Ga0105242_105020782 138
220 3300009176 Ga0105242_11345364 Ga0105242_113453641 138
221 3300009177 Ga0105248_10000020 Ga0105248_10000020250 138
222 3300009177 Ga0105248_10296648 Ga0105248_102966482 138
223 3300009177 Ga0105248_11982916 Ga0105248_119829162 138
224 3300009545 Ga0105237_10070970 Ga0105237_100709704 138
225 3300009545 Ga0105237_10292634 Ga0105237_102926341 138
226 3300009545 Ga0105237_12670138 Ga0105237_126701381 138
227 3300009551 Ga0105238_10015329 Ga0105238_100153295 138
228 3300009551 Ga0105238_10370170 Ga0105238_103701702 138
229 3300009553 Ga0105249_10000616 Ga0105249_100006169 138
230 3300009553 Ga0105249_10006098 Ga0105249_100060989 138
231 3300009553 Ga0105249_10197715 Ga0105249_101977152 138
232 3300009553 Ga0105249_11654423 Ga0105249_116544231 138
233 3300010375 Ga0105239_10050697 Ga0105239_100506972 138
234 3300010375 Ga0105239_10084036 Ga0105239_100840364 138
235 3300012498 Ga0157345_1012372 Ga0157345_10123722 138
236 3300013104 Ga0157370_10034103 Ga0157370_100341034 138
237 3300013104 Ga0157370_10140771 Ga0157370_101407713 138
238 3300013104 Ga0157370_10439339 Ga0157370_104393392 138
239 3300013105 Ga0157369_10000014 Ga0157369_1000001445 138
240 3300013105 Ga0157369_10060569 Ga0157369_100605694 138
241 3300013105 Ga0157369_10476907 Ga0157369_104769073 138
242 3300013296 Ga0157374_10003475 Ga0157374_100034758 138
243 3300013296 Ga0157374_11980598 Ga0157374_119805982 138
244 3300013297 Ga0157378_10002710 Ga0157378_1000271012 138
245 3300013297 Ga0157378_10003573 Ga0157378_100035738 138
246 3300013297 Ga0157378_10018525 Ga0157378_100185254 138
247 3300013297 Ga0157378_12293378 Ga0157378_122933782 138
248 3300013306 Ga0163162_10247369 Ga0163162_102473692 138
249 3300013307 Ga0157372_10160141 Ga0157372_101601413 138
250 3300013308 Ga0157375_10339304 Ga0157375_103393042 138
251 3300013308 Ga0157375_10994137 Ga0157375_109941371 138
252 3300014325 Ga0163163_12270349 Ga0163163_122703491 138
253 3300014326 Ga0157380_10000281 Ga0157380_100002816 138
254 3300014326 Ga0157380_10000439 Ga0157380_100004393 138
255 3300014326 Ga0157380_10157334 Ga0157380_101573343 138
256 3300014968 Ga0157379_10020146 Ga0157379_100201462 138
257 3300014968 Ga0157379_10070389 Ga0157379_100703892 138
258 3300014968 Ga0157379_10103334 Ga0157379_101033344 138
259 3300014968 Ga0157379_10174198 Ga0157379_101741982 138
260 3300014968 Ga0157379_10969744 Ga0157379_109697442 138
261 3300014968 Ga0157379_11400973 Ga0157379_114009732 138
262 3300014969 Ga0157376_10036908 Ga0157376_100369083 138
263 3300014969 Ga0157376_10090119 Ga0157376_100901192 138
264 3300017792 Ga0163161_10000035 Ga0163161_10000035114 138
265 3300017792 Ga0163161_10239511 Ga0163161_102395112 138
266 3300020082 Ga0206353_10300031 Ga0206353_103000311 138
267 3300021361 Ga0213872_10000098 Ga0213872_1000009833 138
268 3300021377 Ga0213874_10031019 Ga0213874_100310192 138
269 3300025321 Ga0207656_10008922 Ga0207656_100089222 138
270 3300025885 Ga0207653_10076640 Ga0207653_100766401 138
271 3300025893 Ga0207682_10000031 Ga0207682_1000003116 138
272 3300025898 Ga0207692_10094888 Ga0207692_100948883 138
273 3300025899 Ga0207642_10000002 Ga0207642_1000000258 138
274 3300025899 Ga0207642_10045766 Ga0207642_100457663 138
275 3300025899 Ga0207642_10186346 Ga0207642_101863462 138
276 3300025899 Ga0207642_10255710 Ga0207642_102557102 138
277 3300025900 Ga0207710_10000586 Ga0207710_100005864 138
278 3300025900 Ga0207710_10060221 Ga0207710_100602212 138
279 3300025905 Ga0207685_10000082 Ga0207685_1000008210 138
280 3300025907 Ga0207645_10070724 Ga0207645_100707243 138
281 3300025910 Ga0207684_10039098 Ga0207684_100390982 138
282 3300025912 Ga0207707_10247318 Ga0207707_102473183 138
283 3300025913 Ga0207695_10144779 Ga0207695_101447793 138
284 3300025914 Ga0207671_10351007 Ga0207671_103510073 138
285 3300025915 Ga0207693_10577556 Ga0207693_105775561 138
286 3300025916 Ga0207663_10098510 Ga0207663_100985102 138
287 3300025916 Ga0207663_10942503 Ga0207663_109425031 138
288 3300025916 Ga0207663_11040650 Ga0207663_110406501 138
289 3300025917 Ga0207660_10122158 Ga0207660_101221583 138
290 3300025917 Ga0207660_10210123 Ga0207660_102101231 138
291 3300025918 Ga0207662_10195918 Ga0207662_101959182 138
292 3300025919 Ga0207657_10042053 Ga0207657_100420534 138
293 3300025920 Ga0207649_10000003 Ga0207649_10000003370 138
294 3300025921 Ga0207652_10074731 Ga0207652_100747315 138
295 3300025922 Ga0207646_10556930 Ga0207646_105569302 138
296 3300025924 Ga0207694_10000004 Ga0207694_10000004491 138
297 3300025924 Ga0207694_10082230 Ga0207694_100822302 138
298 3300025925 Ga0207650_10010427 Ga0207650_100104274 138
299 3300025925 Ga0207650_10145116 Ga0207650_101451163 138
300 3300025925 Ga0207650_10540173 Ga0207650_105401732 138
301 3300025926 Ga0207659_10213968 Ga0207659_102139682 138
302 3300025927 Ga0207687_10000017 Ga0207687_1000001750 138
303 3300025927 Ga0207687_10000018 Ga0207687_10000018207 138
304 3300025928 Ga0207700_10000384 Ga0207700_1000038410 138
305 3300025928 Ga0207700_10900642 Ga0207700_109006422 138
306 3300025929 Ga0207664_10416642 Ga0207664_104166421 138
307 3300025929 Ga0207664_10905986 Ga0207664_109059862 138
308 3300025931 Ga0207644_10426795 Ga0207644_104267952 138
309 3300025932 Ga0207690_10002059 Ga0207690_100020594 138
310 3300025933 Ga0207706_10000012 Ga0207706_10000012152 138
311 3300025933 Ga0207706_10317639 Ga0207706_103176392 138
312 3300025934 Ga0207686_10000888 Ga0207686_1000088817 138
313 3300025934 Ga0207686_10017304 Ga0207686_100173042 138
314 3300025934 Ga0207686_10183716 Ga0207686_101837162 138
315 3300025934 Ga0207686_10560482 Ga0207686_105604822 138
316 3300025937 Ga0207669_10000018 Ga0207669_1000001889 138
317 3300025937 Ga0207669_10693476 Ga0207669_106934761 138
318 3300025938 Ga0207704_10000088 Ga0207704_1000008835 138
319 3300025938 Ga0207704_10155056 Ga0207704_101550561 138
320 3300025938 Ga0207704_10352234 Ga0207704_103522342 138
321 3300025938 Ga0207704_10382762 Ga0207704_103827622 138
322 3300025938 Ga0207704_10688562 Ga0207704_106885622 138
323 3300025938 Ga0207704_10699866 Ga0207704_106998662 138
324 3300025939 Ga0207665_10621997 Ga0207665_106219971 138
325 3300025940 Ga0207691_10007934 Ga0207691_100079346 138
326 3300025940 Ga0207691_10008177 Ga0207691_100081775 138
327 3300025940 Ga0207691_10190751 Ga0207691_101907513 138
328 3300025941 Ga0207711_10000006 Ga0207711_10000006128 138
329 3300025942 Ga0207689_10043334 Ga0207689_100433345 138
330 3300025944 Ga0207661_10029998 Ga0207661_100299983 138
331 3300025944 Ga0207661_10073958 Ga0207661_100739582 138
332 3300025944 Ga0207661_10109173 Ga0207661_101091733 138
333 3300025944 Ga0207661_10387827 Ga0207661_103878272 138
334 3300025945 Ga0207679_10014078 Ga0207679_100140783 138
335 3300025945 Ga0207679_10014260 Ga0207679_100142608 138
336 3300025945 Ga0207679_10051165 Ga0207679_100511653 138
337 3300025945 Ga0207679_10264528 Ga0207679_102645282 138
338 3300025945 Ga0207679_10846208 Ga0207679_108462082 138
339 3300025949 Ga0207667_10301303 Ga0207667_103013032 138
340 3300025949 Ga0207667_10446954 Ga0207667_104469543 138
341 3300025961 Ga0207712_10000007 Ga0207712_10000007311 138
342 3300025961 Ga0207712_10003277 Ga0207712_100032775 138
343 3300025961 Ga0207712_10181569 Ga0207712_101815692 138
344 3300025972 Ga0207668_10017566 Ga0207668_100175663 138
345 3300025981 Ga0207640_10011876 Ga0207640_100118764 138
346 3300025981 Ga0207640_10147335 Ga0207640_101473353 138
347 3300025986 Ga0207658_10010674 Ga0207658_100106744 138
348 3300025986 Ga0207658_10039026 Ga0207658_100390262 138
349 3300026023 Ga0207677_10000519 Ga0207677_1000051914 138
350 3300026035 Ga0207703_10000023 Ga0207703_10000023171 138
351 3300026035 Ga0207703_10000152 Ga0207703_1000015242 138
352 3300026035 Ga0207703_10063806 Ga0207703_100638063 138
353 3300026035 Ga0207703_10250503 Ga0207703_102505032 138
354 3300026035 Ga0207703_10835328 Ga0207703_108353281 138
355 3300026041 Ga0207639_10001493 Ga0207639_100014938 138
356 3300026041 Ga0207639_10037170 Ga0207639_100371704 138
357 3300026041 Ga0207639_10114118 Ga0207639_101141183 138
358 3300026067 Ga0207678_10287878 Ga0207678_102878782 138
359 3300026075 Ga0207708_10134054 Ga0207708_101340541 138
360 3300026075 Ga0207708_10236970 Ga0207708_102369702 138
361 3300026075 Ga0207708_10310874 Ga0207708_103108743 138
362 3300026078 Ga0207702_10014818 Ga0207702_100148181 138
363 3300026078 Ga0207702_10093924 Ga0207702_100939243 138
364 3300026088 Ga0207641_10000151 Ga0207641_1000015189 138
365 3300026088 Ga0207641_10153602 Ga0207641_101536023 138
366 3300026088 Ga0207641_11190415 Ga0207641_111904152 138
367 3300026089 Ga0207648_10000872 Ga0207648_1000087235 138
368 3300026089 Ga0207648_10719680 Ga0207648_107196802 138
369 3300026095 Ga0207676_10000016 Ga0207676_1000001616 138
370 3300026116 Ga0207674_10020885 Ga0207674_100208853 138
371 3300026116 Ga0207674_10103847 Ga0207674_101038473 138
372 3300026121 Ga0207683_10021226 Ga0207683_100212265 138
373 3300026121 Ga0207683_10092674 Ga0207683_100926742 138
374 3300026121 Ga0207683_10237463 Ga0207683_102374633 138
375 3300026142 Ga0207698_10000004 Ga0207698_10000004183 138
376 3300026142 Ga0207698_10223428 Ga0207698_102234282 138
377 3300026142 Ga0207698_11111638 Ga0207698_111116382 138
378 3300027671 Ga0209588_1027045 Ga0209588_10270452 138
379 3300027671 Ga0209588_1056343 Ga0209588_10563431 138
380 3300028379 Ga0268266_10000047 Ga0268266_10000047261 138
381 3300028379 Ga0268266_10022551 Ga0268266_100225515 138
382 3300028379 Ga0268266_11175425 Ga0268266_111754251 138
383 3300028380 Ga0268265_10001435 Ga0268265_1000143520 138
384 3300028381 Ga0268264_10035372 Ga0268264_100353722 138
385 3300028558 Ga0265326_10000515 Ga0265326_100005157 138
386 3300028563 Ga0265319_1001877 Ga0265319_10018776 138
387 3300028563 Ga0265319_1011985 Ga0265319_10119854 138
388 3300028573 Ga0265334_10121632 Ga0265334_101216321 138
389 3300028577 Ga0265318_10012595 Ga0265318_100125954 138
390 3300028577 Ga0265318_10041182 Ga0265318_100411823 138
391 3300028666 Ga0265336_10000005 Ga0265336_100000056 138
392 3300028666 Ga0265336_10051010 Ga0265336_100510102 138
393 3300028666 Ga0265336_10053720 Ga0265336_100537202 138
394 3300028800 Ga0265338_10000001 Ga0265338_10000001820 138
395 3300028800 Ga0265338_10000185 Ga0265338_1000018581 138
396 3300029957 Ga0265324_10004931 Ga0265324_100049315 138
397 3300030521 Ga0307511_10298276 Ga0307511_102982762 138
398 3300031239 Ga0265328_10115316 Ga0265328_101153162 138
399 3300031240 Ga0265320_10166384 Ga0265320_101663841 138
400 3300031241 Ga0265325_10248162 Ga0265325_102481621 138
401 3300031247 Ga0265340_10000001 Ga0265340_10000001818 138
402 3300031249 Ga0265339_10186865 Ga0265339_101868651 138
403 3300031250 Ga0265331_10024934 Ga0265331_100249343 138
404 3300031251 Ga0265327_10045033 Ga0265327_100450334 138
405 3300031344 Ga0265316_10378637 Ga0265316_103786372 138
406 3300031595 Ga0265313_10073764 Ga0265313_100737642 138
407 3300031711 Ga0265314_10120301 Ga0265314_101203012 138
408 3300031727 Ga0316576_10257903 Ga0316576_102579032 138
409 3300031852 Ga0307410_10682923 Ga0307410_106829232 138
410 3300031995 Ga0307409_100251145 Ga0307409_1002511452 138
411 3300032002 Ga0307416_102136299 Ga0307416_1021362992 138
412 3300032002 Ga0307416_102644878 Ga0307416_1026448782 138
413 3300032126 Ga0307415_100017980 Ga0307415_1000179805 138
414 3300032139 Ga0316580_10016355 Ga0316580_100163552 138
415 3300035724 Ga0373933_1074408 Ga0373933_1074408_84_500 138
416 3300035724 Ga0373933_1159050 Ga0373933_1159050_48_464 138
417 3300036401 Ga0373937_0230833 Ga0373937_0230833_737_1153 138
418 3300036401 Ga0373937_0515827 Ga0373937_0515827_337_783 138
419 3300036647 Ga0316582_0062455 Ga0316582_0062455_1721_2170 138
420 3300036712 Ga0316584_0001138 Ga0316584_0001138_6299_6757 138
421 3300036712 Ga0316584_0119883 Ga0316584_0119883_145_582 138
422 3300037068 Ga0373925_0477831 Ga0373925_0477831_292_735 138
423 3300037418 Ga0395900_0139332 Ga0395900_0139332_1248_1664 138
424 3300037418 Ga0395900_0297602 Ga0395900_0297602_881_1297 138
425 3300037466 Ga0395898_0069843 Ga0395898_0069843_46_462 138
426 3300037466 Ga0395898_0141655 Ga0395898_0141655_892_1308 138
427 3300037466 Ga0395898_0426121 Ga0395898_0426121_450_866 138
428 3300037466 Ga0395898_1044399 Ga0395898_1044399_195_611 138
429 3300037466 Ga0395898_1220811 Ga0395898_1220811_65_481 138
430 3300037471 Ga0395905_0178396 Ga0395905_0178396_1052_1468 138
431 3300037471 Ga0395905_0575048 Ga0395905_0575048_414_830 138
432 3300037471 Ga0395905_0825175 Ga0395905_0825175_222_638 138
433 3300037588 Ga0316581_0005128 Ga0316581_0005128_2606_3064 138
434 3300038443 Ga0395901_0018398 Ga0395901_0018398_982_1398 138
435 3300038443 Ga0395901_0052502 Ga0395901_0052502_1712_2128 138
436 3300038443 Ga0395901_0152207 Ga0395901_0152207_1438_1854 138
437 3300038443 Ga0395901_0192138 Ga0395901_0192138_326_742 138
438 3300038443 Ga0395901_0499757 Ga0395901_0499757_593_1009 138
439 3300039062 Ga0400483_076593 Ga0400483_076593_1588_2025 138
440 3300039062 Ga0400483_185685 Ga0400483_185685_2950_3387 138
441 3300039437 Ga0436365_0418890 Ga0436365_0418890_336_779 138
442 3300039453 Ga0436362_1065511 Ga0436362_1065511_715_1152 138
443 3300041443 Ga0451789_0083276 Ga0451789_0083276_55_471 138
444 3300041463 Ga0451804_1059469 Ga0451804_1059469_87_518 138
445 3300041505 Ga0451849_1303005 Ga0451849_1303005_98_520 138
446 3300041512 Ga0451853_1628146 Ga0451853_1628146_817_1233 138
447 3300041512 Ga0451853_2782007 Ga0451853_2782007_1150_1566 138
448 3300044694 Ga0466963_0000001 Ga0466963_0000001_49467_49883 138
449 3300044694 Ga0466963_0054081 Ga0466963_0054081_2219_2635 138
450 3300044694 Ga0466963_0162512 Ga0466963_0162512_817_1260 138
451 3300044706 Ga0466964_0127729 Ga0466964_0127729_134_580 138
452 3300044706 Ga0466964_0865855 Ga0466964_0865855_30_497 138
453 3300044719 Ga0466971_0417840 Ga0466971_0417840_131_601 138
454 3300044735 Ga0466968_0090666 Ga0466968_0090666_354_794 138
455 3300044842 Ga0466957_0134356 Ga0466957_0134356_443_886 138
456 3300044901 Ga0466960_0234143 Ga0466960_0234143_429_869 138
457 3300045976 Ga0466967_0013954 Ga0466967_0013954_5155_5574 138
458 3300045976 Ga0466967_0029047 Ga0466967_0029047_379_822 138
459 3300045976 Ga0466967_0097064 Ga0466967_0097064_1986_2429 138
460 3300045976 Ga0466967_0101260 Ga0466967_0101260_787_1206 138
461 3300045976 Ga0466967_0375794 Ga0466967_0375794_86_505 138
462 3300046454 Ga0495592_0081337 Ga0495592_0081337_1848_2267 138
463 3300046454 Ga0495592_0133692 Ga0495592_0133692_823_1239 138
464 3300046455 Ga0495603_0472128 Ga0495603_0472128_80_541 138
465 3300046459 Ga0495629_0001048 Ga0495629_0001048_11575_12009 138
466 3300046459 Ga0495629_0019036 Ga0495629_0019036_891_1310 138
467 3300046460 Ga0495638_0026563 Ga0495638_0026563_2490_2906 138
468 3300046461 Ga0495641_0000044 Ga0495641_0000044_59677_60093 138
469 3300046461 Ga0495641_0179217 Ga0495641_0179217_239_658 138
470 3300046462 Ga0495651_0276682 Ga0495651_0276682_23_439 138
471 3300046463 Ga0495653_0242572 Ga0495653_0242572_531_947 138
472 3300046473 Ga0495582_0483030 Ga0495582_0483030_201_662 138
473 3300046474 Ga0495605_0298986 Ga0495605_0298986_212_649 138
474 3300046476 Ga0495662_0000061 Ga0495662_0000061_15320_15763 138
475 3300046476 Ga0495662_0192616 Ga0495662_0192616_68_487 138
476 3300046492 Ga0495585_0589985 Ga0495585_0589985_82_498 138
477 3300046499 Ga0495594_0000006 Ga0495594_0000006_154792_155208 138
478 3300046511 Ga0495608_0000007 Ga0495608_0000007_261049_261489 138
479 3300046511 Ga0495608_0005192 Ga0495608_0005192_7714_8130 138
480 3300046511 Ga0495608_0015106 Ga0495608_0015106_797_1213 138
481 3300046514 Ga0495618_0000174 Ga0495618_0000174_17582_17998 138
482 3300046514 Ga0495618_0169909 Ga0495618_0169909_552_989 138
483 3300046514 Ga0495618_0605452 Ga0495618_0605452_181_600 138
484 3300046515 Ga0495620_0000144 Ga0495620_0000144_15357_15773 138
485 3300046516 Ga0495628_0002849 Ga0495628_0002849_4745_5161 138
486 3300046516 Ga0495628_0012147 Ga0495628_0012147_1728_2144 138
487 3300046516 Ga0495628_0035786 Ga0495628_0035786_2583_2999 138
488 3300046516 Ga0495628_0123330 Ga0495628_0123330_1375_1818 138
489 3300046517 Ga0495630_0000014 Ga0495630_0000014_13980_14396 138
490 3300046517 Ga0495630_0000408 Ga0495630_0000408_510_953 138
491 3300046517 Ga0495630_0625594 Ga0495630_0625594_151_606 138
492 3300046529 Ga0495652_0000010 Ga0495652_0000010_123320_123736 138
493 3300046539 Ga0495621_0015316 Ga0495621_0015316_1272_1688 138
494 3300046539 Ga0495621_0263554 Ga0495621_0263554_32_448 138
495 3300046543 Ga0495645_0009482 Ga0495645_0009482_2864_3280 138
496 3300046543 Ga0495645_0513780 Ga0495645_0513780_166_588 138
497 3300046543 Ga0495645_0735645 Ga0495645_0735645_18_464 138
498 3300046557 Ga0495622_0000201 Ga0495622_0000201_26843_27259 138
499 3300046558 Ga0495633_0101344 Ga0495633_0101344_628_1044 138
500 3300046559 Ga0495667_0380627 Ga0495667_0380627_184_600 138
501 3300046615 Ga0495656_0001383 Ga0495656_0001383_5679_6095 138
502 3300046642 Ga0495634_0000018 Ga0495634_0000018_88325_88741 138
503 3300046642 Ga0495634_0000247 Ga0495634_0000247_32666_33082 138
504 3300046642 Ga0495634_0005521 Ga0495634_0005521_2078_2497 138
505 3300046663 Ga0495635_0000016 Ga0495635_0000016_153003_153431 138
506 3300046663 Ga0495635_0046415 Ga0495635_0046415_1658_2083 138
507 3300046675 Ga0495657_0000001 Ga0495657_0000001_393195_393635 138
508 3300046675 Ga0495657_0015946 Ga0495657_0015946_1658_2074 138
509 3300046681 Ga0495647_0000136 Ga0495647_0000136_14699_15121 138
510 3300046681 Ga0495647_0199127 Ga0495647_0199127_227_688 138
511 3300046683 Ga0495658_0000005 Ga0495658_0000005_53992_54408 138
512 3300046683 Ga0495658_0009433 Ga0495658_0009433_3715_4173 138
513 3300046684 Ga0495669_0000211 Ga0495669_0000211_21165_21581 138
514 3300046684 Ga0495669_0073819 Ga0495669_0073819_52_471 138
515 3300046689 Ga0495613_0083219 Ga0495613_0083219_1329_1745 138
516 3300046690 Ga0495624_0088469 Ga0495624_0088469_50_499 138
517 3300046691 Ga0495670_0053440 Ga0495670_0053440_35_451 138
518 3300046809 Ga0495600_0001684 Ga0495600_0001684_2397_2813 138
519 3300046809 Ga0495600_0007043 Ga0495600_0007043_4435_4857 138
520 3300046809 Ga0495600_0230080 Ga0495600_0230080_532_978 138
521 3300047317 Ga0495604_0095236 Ga0495604_0095236_572_1015 138
522 3300047319 Ga0495674_0717750 Ga0495674_0717750_158_604 138
523 3300047320 Ga0495672_0074427 Ga0495672_0074427_870_1316 138
524 3300047321 Ga0495676_0018293 Ga0495676_0018293_5750_6166 138
525 3300047321 Ga0495676_0286997 Ga0495676_0286997_399_833 138
526 3300047322 Ga0495680_0000773 Ga0495680_0000773_10553_10969 138
527 3300047322 Ga0495680_0157340 Ga0495680_0157340_140_565 138
528 3300047444 Ga0495675_0000017 Ga0495675_0000017_52013_52453 138
529 3300047446 Ga0495679_073860 Ga0495679_073860_434_850 138
530 3300047673 Ga0495593_0055228 Ga0495593_0055228_673_1089 138
531 3300048088 Ga0495602_0000007 Ga0495602_0000007_41855_42298 138
532 3300048088 Ga0495602_0009797 Ga0495602_0009797_6582_6998 138
533 3300048903 Ga0496100_0000002 Ga0496100_0000002_303951_304367 138
534 3300048903 Ga0496100_1084357 Ga0496100_1084357_95_511 138
535 3300048903 Ga0496100_1695506 Ga0496100_1695506_44_460 138
536 3300048904 Ga0496101_0000001 Ga0496101_0000001_303951_304367 138
537 3300048904 Ga0496101_0014452 Ga0496101_0014452_4151_4612 138
538 3300048904 Ga0496101_0015579 Ga0496101_0015579_690_1133 138
539 3300048905 Ga0496102_0031518 Ga0496102_0031518_3914_4357 138
540 3300048905 Ga0496102_0268743 Ga0496102_0268743_58_519 138
541 3300048905 Ga0496102_0905609 Ga0496102_0905609_41_460 138
542 3300048905 Ga0496102_1208822 Ga0496102_1208822_16_435 138
543 3300048906 Ga0496103_0213967 Ga0496103_0213967_191_634 138
544 3300048907 Ga0496104_0000009 Ga0496104_0000009_182737_183153 138
545 3300048907 Ga0496104_0000015 Ga0496104_0000015_109761_110177 138
546 3300048908 Ga0496105_0000004 Ga0496105_0000004_365622_366038 138
547 3300048908 Ga0496105_0000007 Ga0496105_0000007_304903_305319 138
548 3300048909 Ga0496106_0000061 Ga0496106_0000061_46875_47291 138
549 3300048909 Ga0496106_0000997 Ga0496106_0000997_12902_13318 138
550 3300048909 Ga0496106_0010671 Ga0496106_0010671_3198_3659 138
551 3300048909 Ga0496106_0134275 Ga0496106_0134275_16_459 138
552 3300048909 Ga0496106_0676807 Ga0496106_0676807_143_559 138
553 3300048909 Ga0496106_0836425 Ga0496106_0836425_190_627 138
554 3300048910 Ga0496107_0000013 Ga0496107_0000013_130995_131411 138
555 3300048910 Ga0496107_0006601 Ga0496107_0006601_4725_5141 138
556 3300048910 Ga0496107_0956415 Ga0496107_0956415_189_605 138
557 3300048911 Ga0496108_0000001 Ga0496108_0000001_593662_594078 138
558 3300048911 Ga0496108_0000187 Ga0496108_0000187_50657_51073 138
559 3300048911 Ga0496108_0000288 Ga0496108_0000288_29843_30286 138
560 3300048911 Ga0496108_0011964 Ga0496108_0011964_5450_5866 138
561 3300048911 Ga0496108_0076000 Ga0496108_0076000_2275_2721 138
562 3300048911 Ga0496108_0084005 Ga0496108_0084005_2161_2622 138
563 3300048912 Ga0496109_0000003 Ga0496109_0000003_268208_268624 138
564 3300048912 Ga0496109_0000012 Ga0496109_0000012_142462_142905 138
565 3300048912 Ga0496109_0000636 Ga0496109_0000636_20645_21061 138
566 3300048912 Ga0496109_0022094 Ga0496109_0022094_3914_4375 138
567 3300048912 Ga0496109_0061038 Ga0496109_0061038_1643_2059 138
568 3300048912 Ga0496109_0426213 Ga0496109_0426213_51_521 138
569 3300048912 Ga0496109_1172796 Ga0496109_1172796_207_626 138
570 3300048912 Ga0496109_1570275 Ga0496109_1570275_46_489 138
571 3300048913 Ga0496110_0014030 Ga0496110_0014030_5878_6318 138
572 3300048913 Ga0496110_0227735 Ga0496110_0227735_794_1210 138
573 3300048913 Ga0496110_0508727 Ga0496110_0508727_167_628 138
574 3300048913 Ga0496110_0907754 Ga0496110_0907754_252_671 138
575 3300048914 Ga0496111_0017072 Ga0496111_0017072_1417_1833 138
576 3300048914 Ga0496111_0726005 Ga0496111_0726005_25_495 138
577 3300048915 Ga0496112_0000003 Ga0496112_0000003_16604_17023 138
578 3300048915 Ga0496112_0094261 Ga0496112_0094261_1238_1708 138
579 3300048915 Ga0496112_0374073 Ga0496112_0374073_748_1164 138
580 3300048915 Ga0496112_0759185 Ga0496112_0759185_89_550 138
581 3300048915 Ga0496112_1044758 Ga0496112_1044758_18_434 138
582 3300048916 Ga0496113_0037947 Ga0496113_0037947_2353_2769 138
583 3300048916 Ga0496113_0095191 Ga0496113_0095191_981_1400 138
584 3300048916 Ga0496113_0418587 Ga0496113_0418587_286_702 138
585 3300048916 Ga0496113_0737338 Ga0496113_0737338_97_540 138
586 3300048917 Ga0496114_0048234 Ga0496114_0048234_43_459 138
587 3300048917 Ga0496114_0075680 Ga0496114_0075680_1932_2393 138
588 3300048918 Ga0496115_0000232 Ga0496115_0000232_14476_14892 138
589 3300048918 Ga0496115_0000429 Ga0496115_0000429_2405_2821 138
590 3300048918 Ga0496115_0104399 Ga0496115_0104399_869_1309 138
591 3300048918 Ga0496115_0195232 Ga0496115_0195232_102_545 138
592 3300048918 Ga0496115_0722411 Ga0496115_0722411_263_703 138
593 3300048928 Ga0496125_0085955 Ga0496125_0085955_1091_1507 138
594 3300048929 Ga0496126_0003394 Ga0496126_0003394_12902_13408 138
595 3300048929 Ga0496126_0011173 Ga0496126_0011173_3294_3734 138
596 3300049571 Ga0501034_0000469 Ga0501034_0000469_42671_43114 138
597 3300049571 Ga0501034_0926233 Ga0501034_0926233_277_693 138
598 3300049578 Ga0501042_0297961 Ga0501042_0297961_78_494 138
599 3300049583 Ga0501067_0000073 Ga0501067_0000073_35906_36367 138
600 3300049583 Ga0501067_0011503 Ga0501067_0011503_1192_1653 138
601 3300049584 Ga0501068_0000683 Ga0501068_0000683_8592_9053 138
602 3300049585 Ga0501069_0000063 Ga0501069_0000063_7825_8286 138
603 3300049585 Ga0501069_0004608 Ga0501069_0004608_6150_6596 138
604 3300049586 Ga0501070_0194407 Ga0501070_0194407_1214_1630 138
605 3300049587 Ga0501071_0128823 Ga0501071_0128823_962_1423 138
606 3300049587 Ga0501071_0434010 Ga0501071_0434010_14_430 138
607 3300049591 Ga0501075_0004347 Ga0501075_0004347_9140_9556 138
608 3300050491 nmdc:mga00v17_1003977_c1 nmdc:mga00v17_1003977_c1_82_498 138
609 3300050507 nmdc:mga05p37_1571662_c1 nmdc:mga05p37_1571662_c1_128_577 138
610 3300050509 nmdc:mga0qj67_256096_c1 nmdc:mga0qj67_256096_c1_123_566 138
611 3300050510 nmdc:mga06r32_169736_c1 nmdc:mga06r32_169736_c1_938_1354 138
612 3300050511 nmdc:mga08y16_52506_c1 nmdc:mga08y16_52506_c1_638_1087 138
613 3300050512 nmdc:mga0n895_89014_c1 nmdc:mga0n895_89014_c1_930_1376 138
614 3300050513 nmdc:mga0rr50_11358_c1 nmdc:mga0rr50_11358_c1_3125_3571 138
615 3300050513 nmdc:mga0rr50_45142_c1 nmdc:mga0rr50_45142_c1_1334_1795 138
616 3300050514 nmdc:mga08x19_111915_c1 nmdc:mga08x19_111915_c1_58_504 138
617 3300050514 nmdc:mga08x19_433321_c1 nmdc:mga08x19_433321_c1_320_781 138
618 3300053077 Ga0495601_0010373 Ga0495601_0010373_3399_3842 138
619 3300053077 Ga0495601_0053946 Ga0495601_0053946_247_666 138
620 3300053077 Ga0495601_0195665 Ga0495601_0195665_349_771 138
621 3300053077 Ga0495601_0377896 Ga0495601_0377896_109_525 138
622 3300053078 Ga0495612_0020813 Ga0495612_0020813_1963_2382 138
623 3300053078 Ga0495612_0034982 Ga0495612_0034982_1186_1629 138
624 3300053078 Ga0495612_0070968 Ga0495612_0070968_31_447 138
625 3300053084 Ga0495595_0000002 Ga0495595_0000002_52007_52447 138
626 3300053084 Ga0495595_0000103 Ga0495595_0000103_21252_21668 138
627 3300053084 Ga0495595_0011187 Ga0495595_0011187_466_909 138
628 3300053085 Ga0495619_0000025 Ga0495619_0000025_30104_30520 138
629 3300053085 Ga0495619_0000053 Ga0495619_0000053_5665_6105 138
630 3300053085 Ga0495619_0001003 Ga0495619_0001003_13943_14368 138
631 3300053085 Ga0495619_0003474 Ga0495619_0003474_628_1071 138
632 3300053085 Ga0495619_0005151 Ga0495619_0005151_2605_3021 138
633 3300053085 Ga0495619_0040287 Ga0495619_0040287_2450_2893 138
634 3300053102 Ga0500554_065422 Ga0500554_065422_93_512 138
635 3300053123 Ga0500614_000117 Ga0500614_000117_5943_6359 138
636 3300054114 Ga0501084_0107659 Ga0501084_0107659_481_897 138
637 3300061734 Ga0530510_0036015 Ga0530510_0036015_1906_2367 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

22

157

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9692 1 138
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9623 1 138
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9599 1 138
3ko7-assembly2.cif.gz_D dtd from plasmodium falciparum in complex with d-lysine 0.9569 1 137
3lmv-assembly2.cif.gz_C d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9564 1 137
ID Description Score Start End Superfamily
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9803 1 137 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9664 1 137 3.50.80.10
af_F1QGC8_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9618 1 138 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9599 1 138 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9559 1 137 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A6J4RS55-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9931 1 137 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-Q1ATQ8-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) 0.9877 1 138 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1F8TNJ3-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9874 10 134 GO:0005737
GO:0051500
AF-A0A6L5F498-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.987 1 138 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1Z8QXJ5-F1-model_v4 deleted 0.9866 1 136

Feature Viewer

pLDDT pTM Quality
97.27 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map