F471425
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 637 | 317 | 635 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10000439|Ga0157380_100004393 |
| Length | 163 |
| Sequence | MTPVRWSRRWKAPATPEKGVVKALVQRVSQAAVDVEGERVAQIGPGMLILLGVGVGDGPEEADRLAEKVGKLRIFDDAEGRMNEPLGEREVLCVSQFTLYGDARRGNRPSYVAAARPEVAEPLYDRFCERLEAKKGVFGACMGVALINDGPVTLMLEAPPAEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 2 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 110 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 181 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 200 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 213 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 214 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 288 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 314 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0.16 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0.16 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 10.2 |
| Rhizosphere | 87.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008173 | 3300001979 | Bacteria | 4194 |
| 2 | JGI24750J21931_1036009 | 3300002070 | Bacteria | 740 |
| 3 | JGI24034J26672_10000085 | 3300002239 | Bacteria | 18326 |
| 4 | JGI24742J22300_10006055 | 3300002244 | Bacteria | 1994 |
| 5 | JGI24751J29686_10025259 | 3300002459 | Bacteria | 1233 |
| 6 | JGI25407J50210_10008370 | 3300003373 | Bacteria | 2606 |
| 7 | JGI25404J52841_10013345 | 3300003659 | Bacteria | 1781 |
| 8 | Ga0070658_10035203 | 3300005327 | Bacteria | 4033 |
| 9 | Ga0070676_10522537 | 3300005328 | Bacteria | 846 |
| 10 | Ga0070683_100022732 | 3300005329 | Bacteria | 5608 |
| 11 | Ga0070683_100287103 | 3300005329 | Bacteria | 1565 |
| 12 | Ga0070670_100005551 | 3300005331 | Bacteria | 10640 |
| 13 | Ga0070670_100209403 | 3300005331 | Bacteria | 1695 |
| 14 | Ga0070670_100263676 | 3300005331 | Bacteria | 1502 |
| 15 | Ga0070677_10000004 | 3300005333 | Bacteria | 81101 |
| 16 | Ga0068869_100141084 | 3300005334 | Bacteria | 1860 |
| 17 | Ga0070680_100028938 | 3300005336 | Bacteria | 4447 |
| 18 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 19 | Ga0070682_100024017 | 3300005337 | Bacteria | 3624 |
| 20 | Ga0070682_100216332 | 3300005337 | Bacteria | 1361 |
| 21 | Ga0068868_100000082 | 3300005338 | Bacteria | 57070 |
| 22 | Ga0068868_100022416 | 3300005338 | Bacteria | 4765 |
| 23 | Ga0068868_101219778 | 3300005338 | Bacteria | 696 |
| 24 | Ga0070660_100346369 | 3300005339 | Bacteria | 1223 |
| 25 | Ga0070691_10029194 | 3300005341 | Bacteria | 2579 |
| 26 | Ga0070691_10209840 | 3300005341 | Bacteria | 1027 |
| 27 | Ga0070687_100194309 | 3300005343 | Bacteria | 1225 |
| 28 | Ga0070661_100000145 | 3300005344 | Bacteria | 58346 |
| 29 | Ga0070692_10018299 | 3300005345 | Bacteria | 3367 |
| 30 | Ga0070692_10184527 | 3300005345 | Bacteria | 1211 |
| 31 | Ga0070668_100017212 | 3300005347 | Bacteria | 5410 |
| 32 | Ga0070668_100137978 | 3300005347 | Bacteria | 1963 |
| 33 | Ga0070668_100381788 | 3300005347 | Bacteria | 1199 |
| 34 | Ga0070668_102034382 | 3300005347 | Bacteria | 530 |
| 35 | Ga0070675_100000545 | 3300005354 | Bacteria | 25840 |
| 36 | Ga0070675_100002723 | 3300005354 | Bacteria | 13282 |
| 37 | Ga0070674_100000008 | 3300005356 | Bacteria | 143844 |
| 38 | Ga0070674_100506692 | 3300005356 | Bacteria | 1006 |
| 39 | Ga0070674_100759915 | 3300005356 | Bacteria | 834 |
| 40 | Ga0070673_100009470 | 3300005364 | Bacteria | 6538 |
| 41 | Ga0070688_100005250 | 3300005365 | Bacteria | 6808 |
| 42 | Ga0070659_100001975 | 3300005366 | Bacteria | 14651 |
| 43 | Ga0070659_100182533 | 3300005366 | Bacteria | 1722 |
| 44 | Ga0070667_100005152 | 3300005367 | Bacteria | 10933 |
| 45 | Ga0070703_10040040 | 3300005406 | Bacteria | 1455 |
| 46 | Ga0070714_100412800 | 3300005435 | Bacteria | 1278 |
| 47 | Ga0070714_101339078 | 3300005435 | Bacteria | 699 |
| 48 | Ga0070713_100000568 | 3300005436 | Bacteria | 23380 |
| 49 | Ga0070713_100114241 | 3300005436 | Bacteria | 2359 |
| 50 | Ga0070713_100491384 | 3300005436 | Bacteria | 1157 |
| 51 | Ga0070701_10155648 | 3300005438 | Bacteria | 1320 |
| 52 | Ga0070711_100001852 | 3300005439 | Bacteria | 11802 |
| 53 | Ga0070705_100280140 | 3300005440 | Bacteria | 1185 |
| 54 | Ga0070708_100012387 | 3300005445 | Bacteria | 6959 |
| 55 | Ga0070678_100011699 | 3300005456 | Bacteria | 5426 |
| 56 | Ga0070678_100013404 | 3300005456 | Bacteria | 5139 |
| 57 | Ga0070662_100000004 | 3300005457 | Bacteria | 195534 |
| 58 | Ga0070681_10034225 | 3300005458 | Bacteria | 5102 |
| 59 | Ga0068867_100000281 | 3300005459 | Bacteria | 33623 |
| 60 | Ga0068867_100064271 | 3300005459 | Bacteria | 2728 |
| 61 | Ga0068867_100781521 | 3300005459 | Bacteria | 850 |
| 62 | Ga0070685_10000013 | 3300005466 | Bacteria | 120875 |
| 63 | Ga0070706_100046850 | 3300005467 | Bacteria | 3991 |
| 64 | Ga0070698_100689781 | 3300005471 | Bacteria | 963 |
| 65 | Ga0070684_100100647 | 3300005535 | Bacteria | 2581 |
| 66 | Ga0068853_100025611 | 3300005539 | Bacteria | 4952 |
| 67 | Ga0068853_100031357 | 3300005539 | Bacteria | 4496 |
| 68 | Ga0070672_100000083 | 3300005543 | Bacteria | 44812 |
| 69 | Ga0070672_100005652 | 3300005543 | Bacteria | 8321 |
| 70 | Ga0070686_100132540 | 3300005544 | Bacteria | 1725 |
| 71 | Ga0070693_100091178 | 3300005547 | Bacteria | 1837 |
| 72 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 73 | Ga0070665_100030347 | 3300005548 | Bacteria | 5441 |
| 74 | Ga0070665_100039291 | 3300005548 | Bacteria | 4758 |
| 75 | Ga0070704_100127008 | 3300005549 | Bacteria | 1969 |
| 76 | Ga0068855_100168363 | 3300005563 | Bacteria | 2482 |
| 77 | Ga0068855_100583623 | 3300005563 | Bacteria | 1207 |
| 78 | Ga0070664_100005074 | 3300005564 | Bacteria | 10556 |
| 79 | Ga0070664_100051733 | 3300005564 | Bacteria | 3478 |
| 80 | Ga0070664_100369954 | 3300005564 | Bacteria | 1306 |
| 81 | Ga0068857_100223878 | 3300005577 | Bacteria | 1719 |
| 82 | Ga0068857_100273152 | 3300005577 | Bacteria | 1554 |
| 83 | Ga0068854_100000113 | 3300005578 | Bacteria | 55436 |
| 84 | Ga0068854_100011765 | 3300005578 | Bacteria | 5712 |
| 85 | Ga0068854_100125435 | 3300005578 | Bacteria | 1954 |
| 86 | Ga0068856_100009507 | 3300005614 | Bacteria | 9442 |
| 87 | Ga0068856_100134588 | 3300005614 | Bacteria | 2477 |
| 88 | Ga0068856_100736992 | 3300005614 | Bacteria | 1005 |
| 89 | Ga0070702_100046441 | 3300005615 | Bacteria | 2461 |
| 90 | Ga0070702_100103762 | 3300005615 | Bacteria | 1749 |
| 91 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 92 | Ga0068852_100157330 | 3300005616 | Bacteria | 2118 |
| 93 | Ga0068852_100202247 | 3300005616 | Bacteria | 1880 |
| 94 | Ga0068852_101405333 | 3300005616 | Bacteria | 720 |
| 95 | Ga0068864_100000045 | 3300005618 | Bacteria | 154739 |
| 96 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 97 | Ga0068866_10000237 | 3300005718 | Bacteria | 25933 |
| 98 | Ga0068866_10018951 | 3300005718 | Bacteria | 3122 |
| 99 | Ga0068866_10042099 | 3300005718 | Bacteria | 2271 |
| 100 | Ga0068866_10099259 | 3300005718 | Bacteria | 1603 |
| 101 | Ga0068866_10463691 | 3300005718 | Bacteria | 831 |
| 102 | Ga0068851_10000873 | 3300005834 | Bacteria | 12997 |
| 103 | Ga0068851_10015611 | 3300005834 | Bacteria | 3620 |
| 104 | Ga0068851_10266747 | 3300005834 | Bacteria | 975 |
| 105 | Ga0068863_100000021 | 3300005841 | Bacteria | 198088 |
| 106 | Ga0068863_100377430 | 3300005841 | Bacteria | 1384 |
| 107 | Ga0068863_100948972 | 3300005841 | Bacteria | 862 |
| 108 | Ga0068858_100000091 | 3300005842 | Bacteria | 93802 |
| 109 | Ga0068858_100000216 | 3300005842 | Bacteria | 62188 |
| 110 | Ga0068858_100317404 | 3300005842 | Bacteria | 1489 |
| 111 | Ga0068858_100842029 | 3300005842 | Bacteria | 896 |
| 112 | Ga0068860_100009131 | 3300005843 | Bacteria | 9862 |
| 113 | Ga0068860_100057876 | 3300005843 | Bacteria | 3685 |
| 114 | Ga0068860_100060916 | 3300005843 | Bacteria | 3586 |
| 115 | Ga0068862_100000492 | 3300005844 | Bacteria | 42127 |
| 116 | Ga0081455_10018277 | 3300005937 | Bacteria | 6685 |
| 117 | Ga0081538_10000141 | 3300005981 | Bacteria | 74085 |
| 118 | Ga0081538_10085540 | 3300005981 | Bacteria | 1656 |
| 119 | Ga0081538_10116129 | 3300005981 | Bacteria | 1299 |
| 120 | Ga0081540_1000366 | 3300005983 | Bacteria | 45428 |
| 121 | Ga0081540_1001258 | 3300005983 | Bacteria | 22098 |
| 122 | Ga0081540_1026029 | 3300005983 | Bacteria | 3350 |
| 123 | Ga0081539_10321743 | 3300005985 | Bacteria | 658 |
| 124 | Ga0070716_100213309 | 3300006173 | Bacteria | 1292 |
| 125 | Ga0070716_101419464 | 3300006173 | Bacteria | 565 |
| 126 | Ga0097621_101082771 | 3300006237 | Bacteria | 752 |
| 127 | Ga0097621_101256222 | 3300006237 | Bacteria | 698 |
| 128 | Ga0068871_100017538 | 3300006358 | Bacteria | 5421 |
| 129 | Ga0075428_100003912 | 3300006844 | Bacteria | 16370 |
| 130 | Ga0075428_100520833 | 3300006844 | Bacteria | 1272 |
| 131 | Ga0075433_10204107 | 3300006852 | Bacteria | 1757 |
| 132 | Ga0075433_11404451 | 3300006852 | Bacteria | 604 |
| 133 | Ga0075434_100006906 | 3300006871 | Bacteria | 10460 |
| 134 | Ga0075434_100017126 | 3300006871 | Bacteria | 6974 |
| 135 | Ga0068865_100000094 | 3300006881 | Bacteria | 46651 |
| 136 | Ga0068865_100015512 | 3300006881 | Bacteria | 4861 |
| 137 | Ga0068865_100391443 | 3300006881 | Bacteria | 1136 |
| 138 | Ga0075436_100020779 | 3300006914 | Bacteria | 4504 |
| 139 | Ga0075436_100159178 | 3300006914 | Bacteria | 1591 |
| 140 | Ga0075436_100409490 | 3300006914 | Bacteria | 983 |
| 141 | Ga0075435_100000729 | 3300007076 | Bacteria | 20397 |
| 142 | Ga0075435_100048865 | 3300007076 | Bacteria | 3400 |
| 143 | Ga0099794_10015383 | 3300007265 | Bacteria | 3376 |
| 144 | Ga0099794_10022724 | 3300007265 | Bacteria | 2861 |
| 145 | Ga0105240_10494353 | 3300009093 | Bacteria | 1361 |
| 146 | Ga0111539_10039672 | 3300009094 | Bacteria | 5673 |
| 147 | Ga0105245_10000016 | 3300009098 | Bacteria | 204372 |
| 148 | Ga0105245_10000026 | 3300009098 | Bacteria | 163660 |
| 149 | Ga0105245_10009926 | 3300009098 | Bacteria | 8293 |
| 150 | Ga0105245_10035202 | 3300009098 | Bacteria | 4444 |
| 151 | Ga0105245_10525578 | 3300009098 | Bacteria | 1202 |
| 152 | Ga0105245_11226870 | 3300009098 | Bacteria | 798 |
| 153 | Ga0105247_10000347 | 3300009101 | Bacteria | 40377 |
| 154 | Ga0105247_10033210 | 3300009101 | Bacteria | 3138 |
| 155 | Ga0105247_10233679 | 3300009101 | Bacteria | 1249 |
| 156 | Ga0105247_10369404 | 3300009101 | Bacteria | 1014 |
| 157 | Ga0114129_10478001 | 3300009147 | Unclassified | 1631 |
| 158 | Ga0105243_10057794 | 3300009148 | Bacteria | 3090 |
| 159 | Ga0105243_10069049 | 3300009148 | Bacteria | 2850 |
| 160 | Ga0105243_12262337 | 3300009148 | Bacteria | 581 |
| 161 | Ga0105241_10016196 | 3300009174 | Bacteria | 5462 |
| 162 | Ga0105242_10001472 | 3300009176 | Bacteria | 18524 |
| 163 | Ga0105242_10502078 | 3300009176 | Bacteria | 1154 |
| 164 | Ga0105242_11345364 | 3300009176 | Bacteria | 740 |
| 165 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 166 | Ga0105248_10296648 | 3300009177 | Bacteria | 1820 |
| 167 | Ga0105248_11982916 | 3300009177 | Bacteria | 661 |
| 168 | Ga0105237_10070970 | 3300009545 | Bacteria | 3478 |
| 169 | Ga0105237_10292634 | 3300009545 | Bacteria | 1631 |
| 170 | Ga0105237_12670138 | 3300009545 | Bacteria | 510 |
| 171 | Ga0105238_10015329 | 3300009551 | Bacteria | 7764 |
| 172 | Ga0105238_10370170 | 3300009551 | Bacteria | 1423 |
| 173 | Ga0105249_10000616 | 3300009553 | Bacteria | 32470 |
| 174 | Ga0105249_10006098 | 3300009553 | Bacteria | 10451 |
| 175 | Ga0105249_10197715 | 3300009553 | Bacteria | 1966 |
| 176 | Ga0105249_11654423 | 3300009553 | Bacteria | 713 |
| 177 | Ga0105239_10050697 | 3300010375 | Bacteria | 4552 |
| 178 | Ga0105239_10084036 | 3300010375 | Bacteria | 3506 |
| 179 | Ga0157345_1012372 | 3300012498 | Bacteria | 770 |
| 180 | Ga0157371_10002155 | 3300013102 | Bacteria | 19193 |
| 181 | Ga0157370_10034103 | 3300013104 | Bacteria | 4959 |
| 182 | Ga0157370_10140771 | 3300013104 | Bacteria | 2248 |
| 183 | Ga0157370_10439339 | 3300013104 | Bacteria | 1200 |
| 184 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 185 | Ga0157369_10060569 | 3300013105 | Bacteria | 4082 |
| 186 | Ga0157369_10476907 | 3300013105 | Bacteria | 1291 |
| 187 | Ga0157374_10003475 | 3300013296 | Bacteria | 13240 |
| 188 | Ga0157374_11980598 | 3300013296 | Bacteria | 609 |
| 189 | Ga0157378_10002710 | 3300013297 | Bacteria | 15778 |
| 190 | Ga0157378_10003573 | 3300013297 | Bacteria | 13763 |
| 191 | Ga0157378_10018525 | 3300013297 | Bacteria | 6119 |
| 192 | Ga0157378_12293378 | 3300013297 | Bacteria | 591 |
| 193 | Ga0163162_10247369 | 3300013306 | Bacteria | 1915 |
| 194 | Ga0157372_10160141 | 3300013307 | Bacteria | 2601 |
| 195 | Ga0157372_10520541 | 3300013307 | Bacteria | 1386 |
| 196 | Ga0157375_10339304 | 3300013308 | Bacteria | 1668 |
| 197 | Ga0157375_10994137 | 3300013308 | Bacteria | 979 |
| 198 | Ga0163163_10891230 | 3300014325 | Bacteria | 953 |
| 199 | Ga0163163_11614937 | 3300014325 | Bacteria | 709 |
| 200 | Ga0163163_12270349 | 3300014325 | Bacteria | 601 |
| 201 | Ga0157380_10000281 | 3300014326 | Bacteria | 30636 |
| 202 | Ga0157380_10000439 | 3300014326 | Bacteria | 25370 |
| 203 | Ga0157380_10157334 | 3300014326 | Bacteria | 1971 |
| 204 | Ga0182008_10171224 | 3300014497 | Bacteria | 1096 |
| 205 | Ga0157379_10020146 | 3300014968 | Bacteria | 5894 |
| 206 | Ga0157379_10070389 | 3300014968 | Bacteria | 3129 |
| 207 | Ga0157379_10103334 | 3300014968 | Bacteria | 2557 |
| 208 | Ga0157379_10174198 | 3300014968 | Bacteria | 1942 |
| 209 | Ga0157379_10969744 | 3300014968 | Bacteria | 809 |
| 210 | Ga0157379_11400973 | 3300014968 | Bacteria | 678 |
| 211 | Ga0157376_10036908 | 3300014969 | Bacteria | 3962 |
| 212 | Ga0157376_10090119 | 3300014969 | Bacteria | 2653 |
| 213 | Ga0163161_10000035 | 3300017792 | Bacteria | 155979 |
| 214 | Ga0163161_10239511 | 3300017792 | Bacteria | 1411 |
| 215 | Ga0206353_10300031 | 3300020082 | Bacteria | 1168 |
| 216 | Ga0213872_10000098 | 3300021361 | Bacteria | 80168 |
| 217 | Ga0213874_10031019 | 3300021377 | Unclassified | 1544 |
| 218 | Ga0207656_10003710 | 3300025321 | Bacteria | 5286 |
| 219 | Ga0207656_10008922 | 3300025321 | Bacteria | 3714 |
| 220 | Ga0207653_10076640 | 3300025885 | Bacteria | 1151 |
| 221 | Ga0207682_10000031 | 3300025893 | Bacteria | 57806 |
| 222 | Ga0207692_10094888 | 3300025898 | Bacteria | 1625 |
| 223 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 224 | Ga0207642_10000719 | 3300025899 | Bacteria | 10249 |
| 225 | Ga0207642_10045766 | 3300025899 | Bacteria | 1945 |
| 226 | Ga0207642_10186346 | 3300025899 | Bacteria | 1135 |
| 227 | Ga0207642_10255710 | 3300025899 | Bacteria | 996 |
| 228 | Ga0207710_10000586 | 3300025900 | Bacteria | 21496 |
| 229 | Ga0207710_10060221 | 3300025900 | Bacteria | 1720 |
| 230 | Ga0207685_10000082 | 3300025905 | Bacteria | 18011 |
| 231 | Ga0207645_10070724 | 3300025907 | Bacteria | 2232 |
| 232 | Ga0207705_10791699 | 3300025909 | Bacteria | 736 |
| 233 | Ga0207684_10039098 | 3300025910 | Bacteria | 4025 |
| 234 | Ga0207707_10247318 | 3300025912 | Bacteria | 1549 |
| 235 | Ga0207695_10144779 | 3300025913 | Bacteria | 2321 |
| 236 | Ga0207671_10351007 | 3300025914 | Bacteria | 1170 |
| 237 | Ga0207693_10577556 | 3300025915 | Bacteria | 876 |
| 238 | Ga0207663_10006360 | 3300025916 | Bacteria | 6040 |
| 239 | Ga0207663_10098510 | 3300025916 | Bacteria | 1958 |
| 240 | Ga0207663_10942503 | 3300025916 | Bacteria | 691 |
| 241 | Ga0207663_11040650 | 3300025916 | Bacteria | 657 |
| 242 | Ga0207660_10122158 | 3300025917 | Bacteria | 1973 |
| 243 | Ga0207660_10210123 | 3300025917 | Bacteria | 1523 |
| 244 | Ga0207662_10195918 | 3300025918 | Bacteria | 1306 |
| 245 | Ga0207662_10815786 | 3300025918 | Bacteria | 658 |
| 246 | Ga0207657_10042053 | 3300025919 | Bacteria | 4035 |
| 247 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 248 | Ga0207652_10074731 | 3300025921 | Bacteria | 2951 |
| 249 | Ga0207646_10556930 | 3300025922 | Unclassified | 1031 |
| 250 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 251 | Ga0207694_10082230 | 3300025924 | Bacteria | 2531 |
| 252 | Ga0207650_10010427 | 3300025925 | Bacteria | 6369 |
| 253 | Ga0207650_10145116 | 3300025925 | Bacteria | 1869 |
| 254 | Ga0207650_10540173 | 3300025925 | Bacteria | 977 |
| 255 | Ga0207659_10213968 | 3300025926 | Bacteria | 1546 |
| 256 | Ga0207687_10000017 | 3300025927 | Bacteria | 237310 |
| 257 | Ga0207687_10000018 | 3300025927 | Bacteria | 236159 |
| 258 | Ga0207687_10024992 | 3300025927 | Bacteria | 3995 |
| 259 | Ga0207700_10000384 | 3300025928 | Bacteria | 25706 |
| 260 | Ga0207700_10089561 | 3300025928 | Bacteria | 2426 |
| 261 | Ga0207700_10900642 | 3300025928 | Bacteria | 792 |
| 262 | Ga0207664_10416642 | 3300025929 | Unclassified | 1196 |
| 263 | Ga0207664_10905986 | 3300025929 | Bacteria | 792 |
| 264 | Ga0207644_10426795 | 3300025931 | Bacteria | 1087 |
| 265 | Ga0207690_10002059 | 3300025932 | Bacteria | 12325 |
| 266 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 267 | Ga0207706_10317639 | 3300025933 | Bacteria | 1356 |
| 268 | Ga0207706_10442269 | 3300025933 | Bacteria | 1125 |
| 269 | Ga0207686_10000888 | 3300025934 | Bacteria | 18054 |
| 270 | Ga0207686_10017304 | 3300025934 | Bacteria | 4061 |
| 271 | Ga0207686_10183716 | 3300025934 | Bacteria | 1485 |
| 272 | Ga0207686_10560482 | 3300025934 | Bacteria | 894 |
| 273 | Ga0207709_10003576 | 3300025935 | Bacteria | 9188 |
| 274 | Ga0207669_10000004 | 3300025937 | Bacteria | 196828 |
| 275 | Ga0207669_10000018 | 3300025937 | Bacteria | 114254 |
| 276 | Ga0207669_10693476 | 3300025937 | Bacteria | 836 |
| 277 | Ga0207704_10000088 | 3300025938 | Bacteria | 53926 |
| 278 | Ga0207704_10155056 | 3300025938 | Bacteria | 1622 |
| 279 | Ga0207704_10352234 | 3300025938 | Bacteria | 1147 |
| 280 | Ga0207704_10382762 | 3300025938 | Bacteria | 1105 |
| 281 | Ga0207704_10688562 | 3300025938 | Bacteria | 845 |
| 282 | Ga0207704_10699866 | 3300025938 | Bacteria | 839 |
| 283 | Ga0207665_10621997 | 3300025939 | Bacteria | 844 |
| 284 | Ga0207691_10007934 | 3300025940 | Bacteria | 10214 |
| 285 | Ga0207691_10008177 | 3300025940 | Bacteria | 10044 |
| 286 | Ga0207691_10190751 | 3300025940 | Bacteria | 1787 |
| 287 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 288 | Ga0207689_10043334 | 3300025942 | Bacteria | 3720 |
| 289 | Ga0207661_10029998 | 3300025944 | Bacteria | 4183 |
| 290 | Ga0207661_10073958 | 3300025944 | Bacteria | 2792 |
| 291 | Ga0207661_10109173 | 3300025944 | Bacteria | 2337 |
| 292 | Ga0207661_10387827 | 3300025944 | Bacteria | 1265 |
| 293 | Ga0207679_10014078 | 3300025945 | Bacteria | 5248 |
| 294 | Ga0207679_10014260 | 3300025945 | Bacteria | 5221 |
| 295 | Ga0207679_10051165 | 3300025945 | Bacteria | 3023 |
| 296 | Ga0207679_10264528 | 3300025945 | Bacteria | 1468 |
| 297 | Ga0207679_10846208 | 3300025945 | Bacteria | 835 |
| 298 | Ga0207667_10301303 | 3300025949 | Bacteria | 1638 |
| 299 | Ga0207667_10446954 | 3300025949 | Bacteria | 1314 |
| 300 | Ga0207667_11193547 | 3300025949 | Bacteria | 741 |
| 301 | Ga0207651_10104264 | 3300025960 | Bacteria | 2112 |
| 302 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 303 | Ga0207712_10003277 | 3300025961 | Bacteria | 10276 |
| 304 | Ga0207712_10181569 | 3300025961 | Bacteria | 1653 |
| 305 | Ga0207668_10017566 | 3300025972 | Bacteria | 4484 |
| 306 | Ga0207668_10049936 | 3300025972 | Bacteria | 2879 |
| 307 | Ga0207640_10000278 | 3300025981 | Bacteria | 34363 |
| 308 | Ga0207640_10011876 | 3300025981 | Bacteria | 4945 |
| 309 | Ga0207640_10147335 | 3300025981 | Bacteria | 1724 |
| 310 | Ga0207658_10010674 | 3300025986 | Bacteria | 6243 |
| 311 | Ga0207658_10039026 | 3300025986 | Bacteria | 3425 |
| 312 | Ga0207677_10000519 | 3300026023 | Bacteria | 24757 |
| 313 | Ga0207677_10134833 | 3300026023 | Bacteria | 1881 |
| 314 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 315 | Ga0207703_10000152 | 3300026035 | Bacteria | 79658 |
| 316 | Ga0207703_10063806 | 3300026035 | Bacteria | 3021 |
| 317 | Ga0207703_10250503 | 3300026035 | Bacteria | 1596 |
| 318 | Ga0207703_10835328 | 3300026035 | Bacteria | 880 |
| 319 | Ga0207703_11596575 | 3300026035 | Bacteria | 627 |
| 320 | Ga0207639_10001493 | 3300026041 | Bacteria | 15745 |
| 321 | Ga0207639_10037170 | 3300026041 | Bacteria | 3615 |
| 322 | Ga0207639_10114118 | 3300026041 | Bacteria | 2207 |
| 323 | Ga0207678_10287878 | 3300026067 | Bacteria | 1411 |
| 324 | Ga0207708_10134054 | 3300026075 | Bacteria | 1938 |
| 325 | Ga0207708_10236970 | 3300026075 | Bacteria | 1466 |
| 326 | Ga0207708_10310874 | 3300026075 | Bacteria | 1284 |
| 327 | Ga0207702_10014818 | 3300026078 | Bacteria | 6466 |
| 328 | Ga0207702_10093924 | 3300026078 | Bacteria | 2632 |
| 329 | Ga0207641_10000151 | 3300026088 | Bacteria | 99225 |
| 330 | Ga0207641_10153602 | 3300026088 | Bacteria | 2087 |
| 331 | Ga0207641_11190415 | 3300026088 | Bacteria | 761 |
| 332 | Ga0207648_10000872 | 3300026089 | Bacteria | 33984 |
| 333 | Ga0207648_10141419 | 3300026089 | Bacteria | 2121 |
| 334 | Ga0207648_10719680 | 3300026089 | Bacteria | 926 |
| 335 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 336 | Ga0207674_10020885 | 3300026116 | Bacteria | 7066 |
| 337 | Ga0207674_10103847 | 3300026116 | Bacteria | 2821 |
| 338 | Ga0207683_10021226 | 3300026121 | Bacteria | 5557 |
| 339 | Ga0207683_10092674 | 3300026121 | Bacteria | 2692 |
| 340 | Ga0207683_10237463 | 3300026121 | Bacteria | 1662 |
| 341 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 342 | Ga0207698_10223428 | 3300026142 | Bacteria | 1704 |
| 343 | Ga0207698_11111638 | 3300026142 | Bacteria | 803 |
| 344 | Ga0209588_1027045 | 3300027671 | Bacteria | 1824 |
| 345 | Ga0209588_1056343 | 3300027671 | Bacteria | 1271 |
| 346 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 347 | Ga0268266_10022551 | 3300028379 | Bacteria | 5363 |
| 348 | Ga0268266_11175425 | 3300028379 | Bacteria | 742 |
| 349 | Ga0268265_10001435 | 3300028380 | Bacteria | 20111 |
| 350 | Ga0268264_10006050 | 3300028381 | Bacteria | 10226 |
| 351 | Ga0268264_10035372 | 3300028381 | Bacteria | 4112 |
| 352 | Ga0265326_10000515 | 3300028558 | Bacteria | 14849 |
| 353 | Ga0265319_1001877 | 3300028563 | Bacteria | 11951 |
| 354 | Ga0265319_1011985 | 3300028563 | Bacteria | 3524 |
| 355 | Ga0265334_10121632 | 3300028573 | Bacteria | 933 |
| 356 | Ga0265318_10012595 | 3300028577 | Bacteria | 3593 |
| 357 | Ga0265318_10041182 | 3300028577 | Bacteria | 1757 |
| 358 | Ga0265336_10000005 | 3300028666 | Bacteria | 399349 |
| 359 | Ga0265336_10051010 | 3300028666 | Bacteria | 1250 |
| 360 | Ga0265336_10053720 | 3300028666 | Bacteria | 1214 |
| 361 | Ga0265338_10000001 | 3300028800 | Bacteria | 1177449 |
| 362 | Ga0265338_10000185 | 3300028800 | Bacteria | 116333 |
| 363 | Ga0265324_10004931 | 3300029957 | Bacteria | 5869 |
| 364 | Ga0307511_10298276 | 3300030521 | Unclassified | 730 |
| 365 | Ga0265328_10115316 | 3300031239 | Bacteria | 1000 |
| 366 | Ga0265320_10044969 | 3300031240 | Bacteria | 2172 |
| 367 | Ga0265320_10166384 | 3300031240 | Bacteria | 991 |
| 368 | Ga0265325_10248162 | 3300031241 | Bacteria | 807 |
| 369 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 370 | Ga0265339_10186865 | 3300031249 | Bacteria | 1029 |
| 371 | Ga0265331_10024934 | 3300031250 | Bacteria | 3021 |
| 372 | Ga0265327_10045033 | 3300031251 | Bacteria | 2347 |
| 373 | Ga0265316_10378637 | 3300031344 | Bacteria | 1021 |
| 374 | Ga0265313_10073764 | 3300031595 | Bacteria | 1566 |
| 375 | Ga0265314_10120301 | 3300031711 | Bacteria | 1654 |
| 376 | Ga0316576_10257903 | 3300031727 | Bacteria | 1308 |
| 377 | Ga0307410_10682923 | 3300031852 | Bacteria | 864 |
| 378 | Ga0307409_100251145 | 3300031995 | Bacteria | 1617 |
| 379 | Ga0307416_102136299 | 3300032002 | Bacteria | 662 |
| 380 | Ga0307416_102644878 | 3300032002 | Bacteria | 599 |
| 381 | Ga0307415_100017980 | 3300032126 | Bacteria | 4255 |
| 382 | Ga0316580_10016355 | 3300032139 | Bacteria | 2276 |
| 383 | Ga0373933_1074408 | 3300035724 | Bacteria | 530 |
| 384 | Ga0373933_1159050 | 3300035724 | Bacteria | 509 |
| 385 | Ga0373937_0230833 | 3300036401 | Bacteria | 1743 |
| 386 | Ga0373937_0515827 | 3300036401 | Unclassified | 1136 |
| 387 | Ga0316582_0062455 | 3300036647 | Bacteria | 2392 |
| 388 | Ga0316584_0001138 | 3300036712 | Bacteria | 15619 |
| 389 | Ga0316584_0119883 | 3300036712 | Bacteria | 1966 |
| 390 | Ga0373925_0477831 | 3300037068 | Bacteria | 1022 |
| 391 | Ga0395900_0139332 | 3300037418 | Bacteria | 2485 |
| 392 | Ga0395900_0297602 | 3300037418 | Bacteria | 1601 |
| 393 | Ga0395898_0069843 | 3300037466 | Bacteria | 3397 |
| 394 | Ga0395898_0141655 | 3300037466 | Bacteria | 2302 |
| 395 | Ga0395898_0426121 | 3300037466 | Bacteria | 1264 |
| 396 | Ga0395898_1044399 | 3300037466 | Bacteria | 752 |
| 397 | Ga0395898_1220811 | 3300037466 | Bacteria | 683 |
| 398 | Ga0395905_0178396 | 3300037471 | Bacteria | 1994 |
| 399 | Ga0395905_0575048 | 3300037471 | Bacteria | 1028 |
| 400 | Ga0395905_0825175 | 3300037471 | Bacteria | 830 |
| 401 | Ga0316581_0005128 | 3300037588 | Bacteria | 3391 |
| 402 | Ga0395901_0018398 | 3300038443 | Bacteria | 7131 |
| 403 | Ga0395901_0052502 | 3300038443 | Bacteria | 4237 |
| 404 | Ga0395901_0152207 | 3300038443 | Bacteria | 2431 |
| 405 | Ga0395901_0192138 | 3300038443 | Bacteria | 2141 |
| 406 | Ga0395901_0499757 | 3300038443 | Bacteria | 1238 |
| 407 | Ga0400483_076593 | 3300039062 | Bacteria | 3071 |
| 408 | Ga0400483_185685 | 3300039062 | Bacteria | 3871 |
| 409 | Ga0436365_0418890 | 3300039437 | Bacteria | 1005 |
| 410 | Ga0436362_1065511 | 3300039453 | Bacteria | 1514 |
| 411 | Ga0451789_0083276 | 3300041443 | Bacteria | 615 |
| 412 | Ga0451804_1059469 | 3300041463 | Bacteria | 623 |
| 413 | Ga0451849_1280559 | 3300041505 | Bacteria | 962 |
| 414 | Ga0451849_1303005 | 3300041505 | Bacteria | 539 |
| 415 | Ga0451853_1628146 | 3300041512 | Bacteria | 3816 |
| 416 | Ga0451853_2782007 | 3300041512 | Bacteria | 2121 |
| 417 | Ga0466965_0201876 | 3300044683 | Bacteria | 1055 |
| 418 | Ga0466963_0000001 | 3300044694 | Bacteria | 110556 |
| 419 | Ga0466963_0048694 | 3300044694 | Bacteria | 2801 |
| 420 | Ga0466963_0054081 | 3300044694 | Bacteria | 2668 |
| 421 | Ga0466963_0162512 | 3300044694 | Bacteria | 1554 |
| 422 | Ga0466964_0127729 | 3300044706 | Bacteria | 1154 |
| 423 | Ga0466964_0865855 | 3300044706 | Bacteria | 515 |
| 424 | Ga0466971_0008114 | 3300044719 | Bacteria | 4579 |
| 425 | Ga0466971_0417840 | 3300044719 | Bacteria | 655 |
| 426 | Ga0466968_0090666 | 3300044735 | Unclassified | 1354 |
| 427 | Ga0466957_0000867 | 3300044842 | Bacteria | 15537 |
| 428 | Ga0466957_0050053 | 3300044842 | Bacteria | 2542 |
| 429 | Ga0466957_0134356 | 3300044842 | Bacteria | 1588 |
| 430 | Ga0466960_0234143 | 3300044901 | Unclassified | 1015 |
| 431 | Ga0466959_0008308 | 3300045049 | Bacteria | 7331 |
| 432 | Ga0466958_0054711 | 3300045836 | Bacteria | 2420 |
| 433 | Ga0466958_0082698 | 3300045836 | Bacteria | 1978 |
| 434 | Ga0466967_0013954 | 3300045976 | Bacteria | 6234 |
| 435 | Ga0466967_0029047 | 3300045976 | Bacteria | 4623 |
| 436 | Ga0466967_0097064 | 3300045976 | Bacteria | 2689 |
| 437 | Ga0466967_0101260 | 3300045976 | Bacteria | 2633 |
| 438 | Ga0466967_0375794 | 3300045976 | Bacteria | 1379 |
| 439 | Ga0495592_0081337 | 3300046454 | Bacteria | 2342 |
| 440 | Ga0495592_0133692 | 3300046454 | Bacteria | 1732 |
| 441 | Ga0495603_0472128 | 3300046455 | Bacteria | 718 |
| 442 | Ga0495629_0001048 | 3300046459 | Bacteria | 22105 |
| 443 | Ga0495629_0019036 | 3300046459 | Bacteria | 4910 |
| 444 | Ga0495638_0026563 | 3300046460 | Bacteria | 3751 |
| 445 | Ga0495641_0000044 | 3300046461 | Bacteria | 77415 |
| 446 | Ga0495641_0179217 | 3300046461 | Bacteria | 949 |
| 447 | Ga0495651_0276682 | 3300046462 | Bacteria | 1136 |
| 448 | Ga0495653_0242572 | 3300046463 | Bacteria | 1200 |
| 449 | Ga0495582_0483030 | 3300046473 | Bacteria | 716 |
| 450 | Ga0495605_0298986 | 3300046474 | Bacteria | 681 |
| 451 | Ga0495639_0159059 | 3300046475 | Bacteria | 1093 |
| 452 | Ga0495639_0182680 | 3300046475 | Bacteria | 1022 |
| 453 | Ga0495662_0000061 | 3300046476 | Bacteria | 37295 |
| 454 | Ga0495662_0192616 | 3300046476 | Bacteria | 1005 |
| 455 | Ga0495585_0589985 | 3300046492 | Bacteria | 523 |
| 456 | Ga0495594_0000006 | 3300046499 | Bacteria | 167901 |
| 457 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 458 | Ga0495608_0005192 | 3300046511 | Bacteria | 9304 |
| 459 | Ga0495608_0015106 | 3300046511 | Bacteria | 5357 |
| 460 | Ga0495610_0110402 | 3300046512 | Bacteria | 1219 |
| 461 | Ga0495618_0000174 | 3300046514 | Bacteria | 45942 |
| 462 | Ga0495618_0169909 | 3300046514 | Bacteria | 1388 |
| 463 | Ga0495618_0605452 | 3300046514 | Bacteria | 652 |
| 464 | Ga0495620_0000144 | 3300046515 | Bacteria | 58204 |
| 465 | Ga0495628_0002849 | 3300046516 | Bacteria | 15497 |
| 466 | Ga0495628_0012147 | 3300046516 | Bacteria | 7259 |
| 467 | Ga0495628_0035786 | 3300046516 | Bacteria | 3989 |
| 468 | Ga0495628_0123330 | 3300046516 | Bacteria | 1986 |
| 469 | Ga0495628_0837493 | 3300046516 | Bacteria | 642 |
| 470 | Ga0495630_0000014 | 3300046517 | Bacteria | 217229 |
| 471 | Ga0495630_0000408 | 3300046517 | Bacteria | 33471 |
| 472 | Ga0495630_0625594 | 3300046517 | Bacteria | 825 |
| 473 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 474 | Ga0495621_0015316 | 3300046539 | Bacteria | 2443 |
| 475 | Ga0495621_0263554 | 3300046539 | Bacteria | 706 |
| 476 | Ga0495645_0009482 | 3300046543 | Bacteria | 6803 |
| 477 | Ga0495645_0513780 | 3300046543 | Bacteria | 747 |
| 478 | Ga0495645_0735645 | 3300046543 | Unclassified | 596 |
| 479 | Ga0495622_0000201 | 3300046557 | Bacteria | 47462 |
| 480 | Ga0495633_0101344 | 3300046558 | Bacteria | 1336 |
| 481 | Ga0495667_0380627 | 3300046559 | Bacteria | 890 |
| 482 | Ga0495656_0001383 | 3300046615 | Bacteria | 7931 |
| 483 | Ga0495668_0393425 | 3300046616 | Bacteria | 761 |
| 484 | Ga0495634_0000018 | 3300046642 | Bacteria | 121323 |
| 485 | Ga0495634_0000247 | 3300046642 | Bacteria | 50931 |
| 486 | Ga0495634_0005521 | 3300046642 | Bacteria | 9712 |
| 487 | Ga0495635_0000016 | 3300046663 | Bacteria | 214088 |
| 488 | Ga0495635_0046415 | 3300046663 | Bacteria | 2997 |
| 489 | Ga0495588_0000992 | 3300046674 | Bacteria | 12398 |
| 490 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 491 | Ga0495657_0015946 | 3300046675 | Bacteria | 5482 |
| 492 | Ga0495647_0000136 | 3300046681 | Bacteria | 18523 |
| 493 | Ga0495647_0199127 | 3300046681 | Bacteria | 878 |
| 494 | Ga0495658_0000005 | 3300046683 | Bacteria | 149839 |
| 495 | Ga0495658_0009433 | 3300046683 | Bacteria | 4864 |
| 496 | Ga0495669_0000211 | 3300046684 | Bacteria | 35387 |
| 497 | Ga0495669_0073819 | 3300046684 | Bacteria | 1558 |
| 498 | Ga0495613_0000032 | 3300046689 | Bacteria | 139806 |
| 499 | Ga0495613_0083219 | 3300046689 | Bacteria | 2324 |
| 500 | Ga0495624_0088469 | 3300046690 | Bacteria | 1912 |
| 501 | Ga0495670_0053440 | 3300046691 | Bacteria | 2023 |
| 502 | Ga0495600_0001684 | 3300046809 | Bacteria | 12350 |
| 503 | Ga0495600_0007043 | 3300046809 | Bacteria | 6870 |
| 504 | Ga0495600_0230080 | 3300046809 | Unclassified | 1184 |
| 505 | Ga0495604_0000718 | 3300047317 | Bacteria | 28069 |
| 506 | Ga0495604_0095236 | 3300047317 | Bacteria | 2199 |
| 507 | Ga0495674_0717750 | 3300047319 | Unclassified | 783 |
| 508 | Ga0495672_0074427 | 3300047320 | Bacteria | 1913 |
| 509 | Ga0495676_0018293 | 3300047321 | Bacteria | 6178 |
| 510 | Ga0495676_0027723 | 3300047321 | Bacteria | 4853 |
| 511 | Ga0495676_0286997 | 3300047321 | Bacteria | 1113 |
| 512 | Ga0495680_0000773 | 3300047322 | Bacteria | 35829 |
| 513 | Ga0495680_0157340 | 3300047322 | Bacteria | 1652 |
| 514 | Ga0495675_0000017 | 3300047444 | Bacteria | 123394 |
| 515 | Ga0495679_073860 | 3300047446 | Bacteria | 978 |
| 516 | Ga0495593_0055228 | 3300047673 | Bacteria | 2091 |
| 517 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 518 | Ga0495602_0009797 | 3300048088 | Bacteria | 9948 |
| 519 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 520 | Ga0496100_1084357 | 3300048903 | Bacteria | 631 |
| 521 | Ga0496100_1695506 | 3300048903 | Bacteria | 500 |
| 522 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 523 | Ga0496101_0014452 | 3300048904 | Bacteria | 5307 |
| 524 | Ga0496101_0015579 | 3300048904 | Bacteria | 5126 |
| 525 | Ga0496102_0031518 | 3300048905 | Bacteria | 4756 |
| 526 | Ga0496102_0268743 | 3300048905 | Bacteria | 1608 |
| 527 | Ga0496102_0905609 | 3300048905 | Bacteria | 804 |
| 528 | Ga0496102_1208822 | 3300048905 | Unclassified | 675 |
| 529 | Ga0496103_0213967 | 3300048906 | Bacteria | 1239 |
| 530 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 531 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 532 | Ga0496104_0249160 | 3300048907 | Bacteria | 1689 |
| 533 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 534 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 535 | Ga0496106_0000061 | 3300048909 | Bacteria | 86524 |
| 536 | Ga0496106_0000997 | 3300048909 | Bacteria | 20676 |
| 537 | Ga0496106_0010671 | 3300048909 | Bacteria | 6788 |
| 538 | Ga0496106_0134275 | 3300048909 | Bacteria | 1942 |
| 539 | Ga0496106_0676807 | 3300048909 | Bacteria | 823 |
| 540 | Ga0496106_0836425 | 3300048909 | Bacteria | 729 |
| 541 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 542 | Ga0496107_0006601 | 3300048910 | Bacteria | 7986 |
| 543 | Ga0496107_0956415 | 3300048910 | Bacteria | 623 |
| 544 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 545 | Ga0496108_0000187 | 3300048911 | Bacteria | 57568 |
| 546 | Ga0496108_0000288 | 3300048911 | Bacteria | 43361 |
| 547 | Ga0496108_0011964 | 3300048911 | Bacteria | 7059 |
| 548 | Ga0496108_0076000 | 3300048911 | Bacteria | 2838 |
| 549 | Ga0496108_0084005 | 3300048911 | Bacteria | 2701 |
| 550 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 551 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 552 | Ga0496109_0000636 | 3300048912 | Bacteria | 29254 |
| 553 | Ga0496109_0022094 | 3300048912 | Bacteria | 5631 |
| 554 | Ga0496109_0061038 | 3300048912 | Bacteria | 3446 |
| 555 | Ga0496109_0426213 | 3300048912 | Bacteria | 1253 |
| 556 | Ga0496109_1172796 | 3300048912 | Bacteria | 705 |
| 557 | Ga0496109_1570275 | 3300048912 | Bacteria | 592 |
| 558 | Ga0496110_0000371 | 3300048913 | Bacteria | 30051 |
| 559 | Ga0496110_0014030 | 3300048913 | Bacteria | 6641 |
| 560 | Ga0496110_0227735 | 3300048913 | Bacteria | 1695 |
| 561 | Ga0496110_0508727 | 3300048913 | Bacteria | 1096 |
| 562 | Ga0496110_0907754 | 3300048913 | Bacteria | 787 |
| 563 | Ga0496111_0000008 | 3300048914 | Bacteria | 96148 |
| 564 | Ga0496111_0017072 | 3300048914 | Bacteria | 5011 |
| 565 | Ga0496111_0726005 | 3300048914 | Bacteria | 722 |
| 566 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 567 | Ga0496112_0094261 | 3300048915 | Bacteria | 2964 |
| 568 | Ga0496112_0374073 | 3300048915 | Bacteria | 1366 |
| 569 | Ga0496112_0759185 | 3300048915 | Bacteria | 896 |
| 570 | Ga0496112_1044758 | 3300048915 | Bacteria | 736 |
| 571 | Ga0496113_0037947 | 3300048916 | Bacteria | 3539 |
| 572 | Ga0496113_0095191 | 3300048916 | Bacteria | 2301 |
| 573 | Ga0496113_0418587 | 3300048916 | Bacteria | 1076 |
| 574 | Ga0496113_0737338 | 3300048916 | Bacteria | 785 |
| 575 | Ga0496114_0048234 | 3300048917 | Bacteria | 3543 |
| 576 | Ga0496114_0075680 | 3300048917 | Bacteria | 2836 |
| 577 | Ga0496115_0000232 | 3300048918 | Bacteria | 50769 |
| 578 | Ga0496115_0000429 | 3300048918 | Bacteria | 34014 |
| 579 | Ga0496115_0104399 | 3300048918 | Bacteria | 2326 |
| 580 | Ga0496115_0195232 | 3300048918 | Bacteria | 1672 |
| 581 | Ga0496115_0722411 | 3300048918 | Unclassified | 781 |
| 582 | Ga0496125_0085955 | 3300048928 | Bacteria | 2381 |
| 583 | Ga0496126_0003394 | 3300048929 | Bacteria | 20156 |
| 584 | Ga0496126_0011173 | 3300048929 | Bacteria | 9319 |
| 585 | Ga0501034_0000469 | 3300049571 | Bacteria | 66571 |
| 586 | Ga0501034_0926233 | 3300049571 | Bacteria | 758 |
| 587 | Ga0501034_1183776 | 3300049571 | Unclassified | 643 |
| 588 | Ga0501038_0370782 | 3300049574 | Bacteria | 1112 |
| 589 | Ga0501042_0041312 | 3300049578 | Bacteria | 3279 |
| 590 | Ga0501042_0297961 | 3300049578 | Bacteria | 1165 |
| 591 | Ga0501067_0000073 | 3300049583 | Bacteria | 57130 |
| 592 | Ga0501067_0011503 | 3300049583 | Bacteria | 4903 |
| 593 | Ga0501068_0000683 | 3300049584 | Bacteria | 17361 |
| 594 | Ga0501068_1039508 | 3300049584 | Bacteria | 541 |
| 595 | Ga0501069_0000063 | 3300049585 | Bacteria | 59140 |
| 596 | Ga0501069_0004608 | 3300049585 | Bacteria | 7133 |
| 597 | Ga0501070_0194407 | 3300049586 | Bacteria | 1666 |
| 598 | Ga0501071_0128823 | 3300049587 | Bacteria | 1879 |
| 599 | Ga0501071_0434010 | 3300049587 | Bacteria | 1005 |
| 600 | Ga0501075_0004347 | 3300049591 | Bacteria | 9586 |
| 601 | Ga0501044_1004908 | 3300049823 | Bacteria | 706 |
| 602 | nmdc:mga00v17_1003977_c1 | 3300050491 | Bacteria | 525 |
| 603 | nmdc:mga05p37_1571662_c1 | 3300050507 | Unclassified | 650 |
| 604 | nmdc:mga0qj67_256096_c1 | 3300050509 | Bacteria | 1420 |
| 605 | nmdc:mga06r32_169736_c1 | 3300050510 | Bacteria | 2165 |
| 606 | nmdc:mga08y16_52506_c1 | 3300050511 | Bacteria | 4265 |
| 607 | nmdc:mga0n895_89014_c1 | 3300050512 | Bacteria | 3088 |
| 608 | nmdc:mga0rr50_11358_c1 | 3300050513 | Bacteria | 5698 |
| 609 | nmdc:mga0rr50_45142_c1 | 3300050513 | Bacteria | 3236 |
| 610 | nmdc:mga08x19_111915_c1 | 3300050514 | Bacteria | 1822 |
| 611 | nmdc:mga08x19_433321_c1 | 3300050514 | Bacteria | 924 |
| 612 | Ga0495601_0010373 | 3300053077 | Bacteria | 5543 |
| 613 | Ga0495601_0053946 | 3300053077 | Bacteria | 2542 |
| 614 | Ga0495601_0195665 | 3300053077 | Unclassified | 1321 |
| 615 | Ga0495601_0377896 | 3300053077 | Unclassified | 920 |
| 616 | Ga0495612_0020813 | 3300053078 | Bacteria | 2630 |
| 617 | Ga0495612_0034982 | 3300053078 | Bacteria | 2035 |
| 618 | Ga0495612_0070968 | 3300053078 | Bacteria | 1452 |
| 619 | Ga0495655_0002340 | 3300053083 | Bacteria | 2996 |
| 620 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 621 | Ga0495595_0000103 | 3300053084 | Bacteria | 38598 |
| 622 | Ga0495595_0011187 | 3300053084 | Bacteria | 3748 |
| 623 | Ga0495619_0000025 | 3300053085 | Bacteria | 167905 |
| 624 | Ga0495619_0000053 | 3300053085 | Bacteria | 98761 |
| 625 | Ga0495619_0000081 | 3300053085 | Bacteria | 72034 |
| 626 | Ga0495619_0001003 | 3300053085 | Bacteria | 18481 |
| 627 | Ga0495619_0003474 | 3300053085 | Bacteria | 10169 |
| 628 | Ga0495619_0005151 | 3300053085 | Bacteria | 8297 |
| 629 | Ga0495619_0040287 | 3300053085 | Bacteria | 3054 |
| 630 | Ga0500641_0001810 | 3300053096 | Bacteria | 7579 |
| 631 | Ga0500554_065422 | 3300053102 | Bacteria | 1174 |
| 632 | Ga0500614_000117 | 3300053123 | Bacteria | 19001 |
| 633 | Ga0501084_0107659 | 3300054114 | Bacteria | 2342 |
| 634 | Ga0466962_0043913 | 3300061719 | Bacteria | 2138 |
| 635 | Ga0530510_0036015 | 3300061734 | Bacteria | 3567 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005439 | Ga0070711_100001852 | Ga0070711_1000018522 | 112 |
| 2 | 3300025916 | Ga0207663_10006360 | Ga0207663_100063605 | 112 |
| 3 | 3300053085 | Ga0495619_0000081 | Ga0495619_0000081_3501_3839 | 112 |
| 4 | 3300005338 | Ga0068868_101219778 | Ga0068868_1012197781 | 126 |
| 5 | 3300005347 | Ga0070668_100137978 | Ga0070668_1001379783 | 126 |
| 6 | 3300005354 | Ga0070675_100000545 | Ga0070675_1000005453 | 126 |
| 7 | 3300005436 | Ga0070713_100114241 | Ga0070713_1001142412 | 126 |
| 8 | 3300005440 | Ga0070705_100280140 | Ga0070705_1002801402 | 126 |
| 9 | 3300005458 | Ga0070681_10034225 | Ga0070681_100342255 | 126 |
| 10 | 3300005459 | Ga0068867_100064271 | Ga0068867_1000642712 | 126 |
| 11 | 3300005563 | Ga0068855_100583623 | Ga0068855_1005836232 | 126 |
| 12 | 3300005578 | Ga0068854_100000113 | Ga0068854_10000011315 | 126 |
| 13 | 3300005615 | Ga0070702_100103762 | Ga0070702_1001037622 | 126 |
| 14 | 3300005718 | Ga0068866_10463691 | Ga0068866_104636912 | 126 |
| 15 | 3300006852 | Ga0075433_11404451 | Ga0075433_114044511 | 126 |
| 16 | 3300009098 | Ga0105245_10009926 | Ga0105245_100099267 | 126 |
| 17 | 3300009148 | Ga0105243_10057794 | Ga0105243_100577942 | 126 |
| 18 | 3300025918 | Ga0207662_10815786 | Ga0207662_108157861 | 126 |
| 19 | 3300025927 | Ga0207687_10024992 | Ga0207687_100249924 | 126 |
| 20 | 3300025928 | Ga0207700_10089561 | Ga0207700_100895613 | 126 |
| 21 | 3300025933 | Ga0207706_10442269 | Ga0207706_104422693 | 126 |
| 22 | 3300025935 | Ga0207709_10003576 | Ga0207709_100035766 | 126 |
| 23 | 3300025949 | Ga0207667_11193547 | Ga0207667_111935472 | 126 |
| 24 | 3300025972 | Ga0207668_10049936 | Ga0207668_100499363 | 126 |
| 25 | 3300025981 | Ga0207640_10000278 | Ga0207640_1000027821 | 126 |
| 26 | 3300026023 | Ga0207677_10134833 | Ga0207677_101348332 | 126 |
| 27 | 3300026089 | Ga0207648_10141419 | Ga0207648_101414193 | 126 |
| 28 | 3300044842 | Ga0466957_0000867 | Ga0466957_0000867_11682_12122 | 126 |
| 29 | 3300044842 | Ga0466957_0050053 | Ga0466957_0050053_1795_2238 | 126 |
| 30 | 3300046689 | Ga0495613_0000032 | Ga0495613_0000032_57207_57653 | 126 |
| 31 | 3300047317 | Ga0495604_0000718 | Ga0495604_0000718_21969_22412 | 126 |
| 32 | 3300048907 | Ga0496104_0249160 | Ga0496104_0249160_1047_1490 | 126 |
| 33 | 3300049574 | Ga0501038_0370782 | Ga0501038_0370782_12_419 | 126 |
| 34 | 3300053083 | Ga0495655_0002340 | Ga0495655_0002340_1307_1750 | 126 |
| 35 | 3300046512 | Ga0495610_0110402 | Ga0495610_0110402_474_914 | 127 |
| 36 | 3300048913 | Ga0496110_0000371 | Ga0496110_0000371_10219_10659 | 127 |
| 37 | 3300048914 | Ga0496111_0000008 | Ga0496111_0000008_16698_17138 | 127 |
| 38 | 3300013102 | Ga0157371_10002155 | Ga0157371_1000215522 | 128 |
| 39 | 3300041505 | Ga0451849_1280559 | Ga0451849_1280559_34_465 | 128 |
| 40 | 3300005435 | Ga0070714_101339078 | Ga0070714_1013390782 | 129 |
| 41 | 3300005834 | Ga0068851_10000873 | Ga0068851_1000087315 | 129 |
| 42 | 3300025321 | Ga0207656_10003710 | Ga0207656_100037103 | 129 |
| 43 | 3300045836 | Ga0466958_0082698 | Ga0466958_0082698_1487_1930 | 129 |
| 44 | 3300005329 | Ga0070683_100287103 | Ga0070683_1002871032 | 130 |
| 45 | 3300005337 | Ga0070682_100216332 | Ga0070682_1002163321 | 130 |
| 46 | 3300014497 | Ga0182008_10171224 | Ga0182008_101712241 | 130 |
| 47 | 3300046616 | Ga0495668_0393425 | Ga0495668_0393425_304_720 | 130 |
| 48 | 3300007265 | Ga0099794_10015383 | Ga0099794_100153833 | 131 |
| 49 | 3300007265 | Ga0099794_10022724 | Ga0099794_100227241 | 131 |
| 50 | 3300014325 | Ga0163163_10891230 | Ga0163163_108912302 | 131 |
| 51 | 3300044683 | Ga0466965_0201876 | Ga0466965_0201876_480_878 | 131 |
| 52 | 3300044694 | Ga0466963_0048694 | Ga0466963_0048694_382_780 | 131 |
| 53 | 3300044719 | Ga0466971_0008114 | Ga0466971_0008114_558_956 | 131 |
| 54 | 3300045049 | Ga0466959_0008308 | Ga0466959_0008308_1295_1693 | 131 |
| 55 | 3300045836 | Ga0466958_0054711 | Ga0466958_0054711_805_1203 | 131 |
| 56 | 3300046475 | Ga0495639_0159059 | Ga0495639_0159059_20_439 | 131 |
| 57 | 3300047321 | Ga0495676_0027723 | Ga0495676_0027723_4155_4643 | 131 |
| 58 | 3300061719 | Ga0466962_0043913 | Ga0466962_0043913_1209_1607 | 131 |
| 59 | 3300005445 | Ga0070708_100012387 | Ga0070708_1000123874 | 132 |
| 60 | 3300031240 | Ga0265320_10044969 | Ga0265320_100449692 | 132 |
| 61 | 3300046674 | Ga0495588_0000992 | Ga0495588_0000992_3449_3874 | 133 |
| 62 | 3300053096 | Ga0500641_0001810 | Ga0500641_0001810_3067_3483 | 133 |
| 63 | 3300005356 | Ga0070674_100000008 | Ga0070674_10000000812 | 134 |
| 64 | 3300005364 | Ga0070673_100009470 | Ga0070673_1000094704 | 134 |
| 65 | 3300005718 | Ga0068866_10000237 | Ga0068866_1000023720 | 134 |
| 66 | 3300005843 | Ga0068860_100009131 | Ga0068860_1000091315 | 134 |
| 67 | 3300005981 | Ga0081538_10116129 | Ga0081538_101161292 | 134 |
| 68 | 3300006914 | Ga0075436_100409490 | Ga0075436_1004094902 | 134 |
| 69 | 3300013307 | Ga0157372_10520541 | Ga0157372_105205412 | 134 |
| 70 | 3300025899 | Ga0207642_10000719 | Ga0207642_100007193 | 134 |
| 71 | 3300025937 | Ga0207669_10000004 | Ga0207669_10000004196 | 134 |
| 72 | 3300025960 | Ga0207651_10104264 | Ga0207651_101042642 | 134 |
| 73 | 3300028381 | Ga0268264_10006050 | Ga0268264_100060505 | 134 |
| 74 | 3300049578 | Ga0501042_0041312 | Ga0501042_0041312_2201_2605 | 134 |
| 75 | iso_pu_bacteria | 2847085930 | 2847089783 | 134 |
| 76 | iso_pu_bacteria | 3000405567 | 3000407837 | 134 |
| 77 | 3300014325 | Ga0163163_11614937 | Ga0163163_116149372 | 135 |
| 78 | 3300046475 | Ga0495639_0182680 | Ga0495639_0182680_16_423 | 135 |
| 79 | 3300046516 | Ga0495628_0837493 | Ga0495628_0837493_188_595 | 135 |
| 80 | 3300049584 | Ga0501068_1039508 | Ga0501068_1039508_115_522 | 135 |
| 81 | 3300025909 | Ga0207705_10791699 | Ga0207705_107916992 | 137 |
| 82 | 3300026035 | Ga0207703_11596575 | Ga0207703_115965751 | 137 |
| 83 | 3300049571 | Ga0501034_1183776 | Ga0501034_1183776_118_555 | 137 |
| 84 | 3300049823 | Ga0501044_1004908 | Ga0501044_1004908_234_671 | 137 |
| 85 | 3300001979 | JGI24740J21852_10008173 | JGI24740J21852_100081735 | 138 |
| 86 | 3300002070 | JGI24750J21931_1036009 | JGI24750J21931_10360091 | 138 |
| 87 | 3300002239 | JGI24034J26672_10000085 | JGI24034J26672_1000008516 | 138 |
| 88 | 3300002244 | JGI24742J22300_10006055 | JGI24742J22300_100060552 | 138 |
| 89 | 3300002459 | JGI24751J29686_10025259 | JGI24751J29686_100252592 | 138 |
| 90 | 3300003373 | JGI25407J50210_10008370 | JGI25407J50210_100083703 | 138 |
| 91 | 3300003659 | JGI25404J52841_10013345 | JGI25404J52841_100133451 | 138 |
| 92 | 3300005327 | Ga0070658_10035203 | Ga0070658_100352033 | 138 |
| 93 | 3300005328 | Ga0070676_10522537 | Ga0070676_105225372 | 138 |
| 94 | 3300005329 | Ga0070683_100022732 | Ga0070683_1000227323 | 138 |
| 95 | 3300005331 | Ga0070670_100005551 | Ga0070670_1000055516 | 138 |
| 96 | 3300005331 | Ga0070670_100209403 | Ga0070670_1002094032 | 138 |
| 97 | 3300005331 | Ga0070670_100263676 | Ga0070670_1002636761 | 138 |
| 98 | 3300005333 | Ga0070677_10000004 | Ga0070677_1000000451 | 138 |
| 99 | 3300005334 | Ga0068869_100141084 | Ga0068869_1001410843 | 138 |
| 100 | 3300005336 | Ga0070680_100028938 | Ga0070680_1000289385 | 138 |
| 101 | 3300005337 | Ga0070682_100000013 | Ga0070682_10000001372 | 138 |
| 102 | 3300005337 | Ga0070682_100024017 | Ga0070682_1000240175 | 138 |
| 103 | 3300005338 | Ga0068868_100000082 | Ga0068868_10000008218 | 138 |
| 104 | 3300005338 | Ga0068868_100022416 | Ga0068868_1000224162 | 138 |
| 105 | 3300005339 | Ga0070660_100346369 | Ga0070660_1003463692 | 138 |
| 106 | 3300005341 | Ga0070691_10029194 | Ga0070691_100291941 | 138 |
| 107 | 3300005341 | Ga0070691_10209840 | Ga0070691_102098401 | 138 |
| 108 | 3300005343 | Ga0070687_100194309 | Ga0070687_1001943092 | 138 |
| 109 | 3300005344 | Ga0070661_100000145 | Ga0070661_1000001457 | 138 |
| 110 | 3300005345 | Ga0070692_10018299 | Ga0070692_100182993 | 138 |
| 111 | 3300005345 | Ga0070692_10184527 | Ga0070692_101845272 | 138 |
| 112 | 3300005347 | Ga0070668_100017212 | Ga0070668_1000172126 | 138 |
| 113 | 3300005347 | Ga0070668_100381788 | Ga0070668_1003817883 | 138 |
| 114 | 3300005347 | Ga0070668_102034382 | Ga0070668_1020343821 | 138 |
| 115 | 3300005354 | Ga0070675_100002723 | Ga0070675_1000027238 | 138 |
| 116 | 3300005356 | Ga0070674_100506692 | Ga0070674_1005066922 | 138 |
| 117 | 3300005356 | Ga0070674_100759915 | Ga0070674_1007599151 | 138 |
| 118 | 3300005365 | Ga0070688_100005250 | Ga0070688_1000052503 | 138 |
| 119 | 3300005366 | Ga0070659_100001975 | Ga0070659_10000197513 | 138 |
| 120 | 3300005366 | Ga0070659_100182533 | Ga0070659_1001825332 | 138 |
| 121 | 3300005367 | Ga0070667_100005152 | Ga0070667_10000515210 | 138 |
| 122 | 3300005406 | Ga0070703_10040040 | Ga0070703_100400402 | 138 |
| 123 | 3300005435 | Ga0070714_100412800 | Ga0070714_1004128002 | 138 |
| 124 | 3300005436 | Ga0070713_100000568 | Ga0070713_1000005686 | 138 |
| 125 | 3300005436 | Ga0070713_100491384 | Ga0070713_1004913842 | 138 |
| 126 | 3300005438 | Ga0070701_10155648 | Ga0070701_101556482 | 138 |
| 127 | 3300005456 | Ga0070678_100011699 | Ga0070678_1000116992 | 138 |
| 128 | 3300005456 | Ga0070678_100013404 | Ga0070678_1000134045 | 138 |
| 129 | 3300005457 | Ga0070662_100000004 | Ga0070662_10000000466 | 138 |
| 130 | 3300005459 | Ga0068867_100000281 | Ga0068867_1000002813 | 138 |
| 131 | 3300005459 | Ga0068867_100781521 | Ga0068867_1007815212 | 138 |
| 132 | 3300005466 | Ga0070685_10000013 | Ga0070685_1000001344 | 138 |
| 133 | 3300005467 | Ga0070706_100046850 | Ga0070706_1000468502 | 138 |
| 134 | 3300005471 | Ga0070698_100689781 | Ga0070698_1006897812 | 138 |
| 135 | 3300005535 | Ga0070684_100100647 | Ga0070684_1001006472 | 138 |
| 136 | 3300005539 | Ga0068853_100025611 | Ga0068853_1000256115 | 138 |
| 137 | 3300005539 | Ga0068853_100031357 | Ga0068853_1000313572 | 138 |
| 138 | 3300005543 | Ga0070672_100000083 | Ga0070672_10000008344 | 138 |
| 139 | 3300005543 | Ga0070672_100005652 | Ga0070672_1000056527 | 138 |
| 140 | 3300005544 | Ga0070686_100132540 | Ga0070686_1001325402 | 138 |
| 141 | 3300005547 | Ga0070693_100091178 | Ga0070693_1000911783 | 138 |
| 142 | 3300005548 | Ga0070665_100000106 | Ga0070665_100000106109 | 138 |
| 143 | 3300005548 | Ga0070665_100030347 | Ga0070665_1000303473 | 138 |
| 144 | 3300005548 | Ga0070665_100039291 | Ga0070665_1000392915 | 138 |
| 145 | 3300005549 | Ga0070704_100127008 | Ga0070704_1001270082 | 138 |
| 146 | 3300005563 | Ga0068855_100168363 | Ga0068855_1001683633 | 138 |
| 147 | 3300005564 | Ga0070664_100005074 | Ga0070664_1000050745 | 138 |
| 148 | 3300005564 | Ga0070664_100051733 | Ga0070664_1000517337 | 138 |
| 149 | 3300005564 | Ga0070664_100369954 | Ga0070664_1003699542 | 138 |
| 150 | 3300005577 | Ga0068857_100223878 | Ga0068857_1002238781 | 138 |
| 151 | 3300005577 | Ga0068857_100273152 | Ga0068857_1002731523 | 138 |
| 152 | 3300005578 | Ga0068854_100011765 | Ga0068854_1000117654 | 138 |
| 153 | 3300005578 | Ga0068854_100125435 | Ga0068854_1001254353 | 138 |
| 154 | 3300005614 | Ga0068856_100009507 | Ga0068856_1000095079 | 138 |
| 155 | 3300005614 | Ga0068856_100134588 | Ga0068856_1001345882 | 138 |
| 156 | 3300005614 | Ga0068856_100736992 | Ga0068856_1007369922 | 138 |
| 157 | 3300005615 | Ga0070702_100046441 | Ga0070702_1000464411 | 138 |
| 158 | 3300005616 | Ga0068852_100000002 | Ga0068852_100000002102 | 138 |
| 159 | 3300005616 | Ga0068852_100157330 | Ga0068852_1001573303 | 138 |
| 160 | 3300005616 | Ga0068852_100202247 | Ga0068852_1002022474 | 138 |
| 161 | 3300005616 | Ga0068852_101405333 | Ga0068852_1014053332 | 138 |
| 162 | 3300005618 | Ga0068864_100000045 | Ga0068864_100000045148 | 138 |
| 163 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001338 | 138 |
| 164 | 3300005718 | Ga0068866_10018951 | Ga0068866_100189512 | 138 |
| 165 | 3300005718 | Ga0068866_10042099 | Ga0068866_100420993 | 138 |
| 166 | 3300005718 | Ga0068866_10099259 | Ga0068866_100992591 | 138 |
| 167 | 3300005834 | Ga0068851_10015611 | Ga0068851_100156112 | 138 |
| 168 | 3300005834 | Ga0068851_10266747 | Ga0068851_102667472 | 138 |
| 169 | 3300005841 | Ga0068863_100000021 | Ga0068863_100000021193 | 138 |
| 170 | 3300005841 | Ga0068863_100377430 | Ga0068863_1003774302 | 138 |
| 171 | 3300005841 | Ga0068863_100948972 | Ga0068863_1009489722 | 138 |
| 172 | 3300005842 | Ga0068858_100000091 | Ga0068858_10000009141 | 138 |
| 173 | 3300005842 | Ga0068858_100000216 | Ga0068858_10000021625 | 138 |
| 174 | 3300005842 | Ga0068858_100317404 | Ga0068858_1003174043 | 138 |
| 175 | 3300005842 | Ga0068858_100842029 | Ga0068858_1008420292 | 138 |
| 176 | 3300005843 | Ga0068860_100057876 | Ga0068860_1000578764 | 138 |
| 177 | 3300005843 | Ga0068860_100060916 | Ga0068860_1000609162 | 138 |
| 178 | 3300005844 | Ga0068862_100000492 | Ga0068862_10000049227 | 138 |
| 179 | 3300005937 | Ga0081455_10018277 | Ga0081455_100182776 | 138 |
| 180 | 3300005981 | Ga0081538_10000141 | Ga0081538_1000014132 | 138 |
| 181 | 3300005981 | Ga0081538_10085540 | Ga0081538_100855402 | 138 |
| 182 | 3300005983 | Ga0081540_1000366 | Ga0081540_100036646 | 138 |
| 183 | 3300005983 | Ga0081540_1001258 | Ga0081540_100125816 | 138 |
| 184 | 3300005983 | Ga0081540_1026029 | Ga0081540_10260292 | 138 |
| 185 | 3300005985 | Ga0081539_10321743 | Ga0081539_103217431 | 138 |
| 186 | 3300006173 | Ga0070716_100213309 | Ga0070716_1002133092 | 138 |
| 187 | 3300006173 | Ga0070716_101419464 | Ga0070716_1014194641 | 138 |
| 188 | 3300006237 | Ga0097621_101082771 | Ga0097621_1010827712 | 138 |
| 189 | 3300006237 | Ga0097621_101256222 | Ga0097621_1012562221 | 138 |
| 190 | 3300006358 | Ga0068871_100017538 | Ga0068871_1000175382 | 138 |
| 191 | 3300006844 | Ga0075428_100003912 | Ga0075428_1000039125 | 138 |
| 192 | 3300006844 | Ga0075428_100520833 | Ga0075428_1005208332 | 138 |
| 193 | 3300006852 | Ga0075433_10204107 | Ga0075433_102041073 | 138 |
| 194 | 3300006871 | Ga0075434_100006906 | Ga0075434_10000690610 | 138 |
| 195 | 3300006871 | Ga0075434_100017126 | Ga0075434_1000171262 | 138 |
| 196 | 3300006881 | Ga0068865_100000094 | Ga0068865_10000009416 | 138 |
| 197 | 3300006881 | Ga0068865_100015512 | Ga0068865_1000155123 | 138 |
| 198 | 3300006881 | Ga0068865_100391443 | Ga0068865_1003914432 | 138 |
| 199 | 3300006914 | Ga0075436_100020779 | Ga0075436_1000207793 | 138 |
| 200 | 3300006914 | Ga0075436_100159178 | Ga0075436_1001591783 | 138 |
| 201 | 3300007076 | Ga0075435_100000729 | Ga0075435_1000007296 | 138 |
| 202 | 3300007076 | Ga0075435_100048865 | Ga0075435_1000488654 | 138 |
| 203 | 3300009093 | Ga0105240_10494353 | Ga0105240_104943532 | 138 |
| 204 | 3300009094 | Ga0111539_10039672 | Ga0111539_100396724 | 138 |
| 205 | 3300009098 | Ga0105245_10000016 | Ga0105245_1000001617 | 138 |
| 206 | 3300009098 | Ga0105245_10000026 | Ga0105245_10000026132 | 138 |
| 207 | 3300009098 | Ga0105245_10035202 | Ga0105245_100352025 | 138 |
| 208 | 3300009098 | Ga0105245_10525578 | Ga0105245_105255782 | 138 |
| 209 | 3300009098 | Ga0105245_11226870 | Ga0105245_112268702 | 138 |
| 210 | 3300009101 | Ga0105247_10000347 | Ga0105247_1000034721 | 138 |
| 211 | 3300009101 | Ga0105247_10033210 | Ga0105247_100332102 | 138 |
| 212 | 3300009101 | Ga0105247_10233679 | Ga0105247_102336792 | 138 |
| 213 | 3300009101 | Ga0105247_10369404 | Ga0105247_103694042 | 138 |
| 214 | 3300009147 | Ga0114129_10478001 | Ga0114129_104780013 | 138 |
| 215 | 3300009148 | Ga0105243_10069049 | Ga0105243_100690492 | 138 |
| 216 | 3300009148 | Ga0105243_12262337 | Ga0105243_122623371 | 138 |
| 217 | 3300009174 | Ga0105241_10016196 | Ga0105241_100161965 | 138 |
| 218 | 3300009176 | Ga0105242_10001472 | Ga0105242_100014724 | 138 |
| 219 | 3300009176 | Ga0105242_10502078 | Ga0105242_105020782 | 138 |
| 220 | 3300009176 | Ga0105242_11345364 | Ga0105242_113453641 | 138 |
| 221 | 3300009177 | Ga0105248_10000020 | Ga0105248_10000020250 | 138 |
| 222 | 3300009177 | Ga0105248_10296648 | Ga0105248_102966482 | 138 |
| 223 | 3300009177 | Ga0105248_11982916 | Ga0105248_119829162 | 138 |
| 224 | 3300009545 | Ga0105237_10070970 | Ga0105237_100709704 | 138 |
| 225 | 3300009545 | Ga0105237_10292634 | Ga0105237_102926341 | 138 |
| 226 | 3300009545 | Ga0105237_12670138 | Ga0105237_126701381 | 138 |
| 227 | 3300009551 | Ga0105238_10015329 | Ga0105238_100153295 | 138 |
| 228 | 3300009551 | Ga0105238_10370170 | Ga0105238_103701702 | 138 |
| 229 | 3300009553 | Ga0105249_10000616 | Ga0105249_100006169 | 138 |
| 230 | 3300009553 | Ga0105249_10006098 | Ga0105249_100060989 | 138 |
| 231 | 3300009553 | Ga0105249_10197715 | Ga0105249_101977152 | 138 |
| 232 | 3300009553 | Ga0105249_11654423 | Ga0105249_116544231 | 138 |
| 233 | 3300010375 | Ga0105239_10050697 | Ga0105239_100506972 | 138 |
| 234 | 3300010375 | Ga0105239_10084036 | Ga0105239_100840364 | 138 |
| 235 | 3300012498 | Ga0157345_1012372 | Ga0157345_10123722 | 138 |
| 236 | 3300013104 | Ga0157370_10034103 | Ga0157370_100341034 | 138 |
| 237 | 3300013104 | Ga0157370_10140771 | Ga0157370_101407713 | 138 |
| 238 | 3300013104 | Ga0157370_10439339 | Ga0157370_104393392 | 138 |
| 239 | 3300013105 | Ga0157369_10000014 | Ga0157369_1000001445 | 138 |
| 240 | 3300013105 | Ga0157369_10060569 | Ga0157369_100605694 | 138 |
| 241 | 3300013105 | Ga0157369_10476907 | Ga0157369_104769073 | 138 |
| 242 | 3300013296 | Ga0157374_10003475 | Ga0157374_100034758 | 138 |
| 243 | 3300013296 | Ga0157374_11980598 | Ga0157374_119805982 | 138 |
| 244 | 3300013297 | Ga0157378_10002710 | Ga0157378_1000271012 | 138 |
| 245 | 3300013297 | Ga0157378_10003573 | Ga0157378_100035738 | 138 |
| 246 | 3300013297 | Ga0157378_10018525 | Ga0157378_100185254 | 138 |
| 247 | 3300013297 | Ga0157378_12293378 | Ga0157378_122933782 | 138 |
| 248 | 3300013306 | Ga0163162_10247369 | Ga0163162_102473692 | 138 |
| 249 | 3300013307 | Ga0157372_10160141 | Ga0157372_101601413 | 138 |
| 250 | 3300013308 | Ga0157375_10339304 | Ga0157375_103393042 | 138 |
| 251 | 3300013308 | Ga0157375_10994137 | Ga0157375_109941371 | 138 |
| 252 | 3300014325 | Ga0163163_12270349 | Ga0163163_122703491 | 138 |
| 253 | 3300014326 | Ga0157380_10000281 | Ga0157380_100002816 | 138 |
| 254 | 3300014326 | Ga0157380_10000439 | Ga0157380_100004393 | 138 |
| 255 | 3300014326 | Ga0157380_10157334 | Ga0157380_101573343 | 138 |
| 256 | 3300014968 | Ga0157379_10020146 | Ga0157379_100201462 | 138 |
| 257 | 3300014968 | Ga0157379_10070389 | Ga0157379_100703892 | 138 |
| 258 | 3300014968 | Ga0157379_10103334 | Ga0157379_101033344 | 138 |
| 259 | 3300014968 | Ga0157379_10174198 | Ga0157379_101741982 | 138 |
| 260 | 3300014968 | Ga0157379_10969744 | Ga0157379_109697442 | 138 |
| 261 | 3300014968 | Ga0157379_11400973 | Ga0157379_114009732 | 138 |
| 262 | 3300014969 | Ga0157376_10036908 | Ga0157376_100369083 | 138 |
| 263 | 3300014969 | Ga0157376_10090119 | Ga0157376_100901192 | 138 |
| 264 | 3300017792 | Ga0163161_10000035 | Ga0163161_10000035114 | 138 |
| 265 | 3300017792 | Ga0163161_10239511 | Ga0163161_102395112 | 138 |
| 266 | 3300020082 | Ga0206353_10300031 | Ga0206353_103000311 | 138 |
| 267 | 3300021361 | Ga0213872_10000098 | Ga0213872_1000009833 | 138 |
| 268 | 3300021377 | Ga0213874_10031019 | Ga0213874_100310192 | 138 |
| 269 | 3300025321 | Ga0207656_10008922 | Ga0207656_100089222 | 138 |
| 270 | 3300025885 | Ga0207653_10076640 | Ga0207653_100766401 | 138 |
| 271 | 3300025893 | Ga0207682_10000031 | Ga0207682_1000003116 | 138 |
| 272 | 3300025898 | Ga0207692_10094888 | Ga0207692_100948883 | 138 |
| 273 | 3300025899 | Ga0207642_10000002 | Ga0207642_1000000258 | 138 |
| 274 | 3300025899 | Ga0207642_10045766 | Ga0207642_100457663 | 138 |
| 275 | 3300025899 | Ga0207642_10186346 | Ga0207642_101863462 | 138 |
| 276 | 3300025899 | Ga0207642_10255710 | Ga0207642_102557102 | 138 |
| 277 | 3300025900 | Ga0207710_10000586 | Ga0207710_100005864 | 138 |
| 278 | 3300025900 | Ga0207710_10060221 | Ga0207710_100602212 | 138 |
| 279 | 3300025905 | Ga0207685_10000082 | Ga0207685_1000008210 | 138 |
| 280 | 3300025907 | Ga0207645_10070724 | Ga0207645_100707243 | 138 |
| 281 | 3300025910 | Ga0207684_10039098 | Ga0207684_100390982 | 138 |
| 282 | 3300025912 | Ga0207707_10247318 | Ga0207707_102473183 | 138 |
| 283 | 3300025913 | Ga0207695_10144779 | Ga0207695_101447793 | 138 |
| 284 | 3300025914 | Ga0207671_10351007 | Ga0207671_103510073 | 138 |
| 285 | 3300025915 | Ga0207693_10577556 | Ga0207693_105775561 | 138 |
| 286 | 3300025916 | Ga0207663_10098510 | Ga0207663_100985102 | 138 |
| 287 | 3300025916 | Ga0207663_10942503 | Ga0207663_109425031 | 138 |
| 288 | 3300025916 | Ga0207663_11040650 | Ga0207663_110406501 | 138 |
| 289 | 3300025917 | Ga0207660_10122158 | Ga0207660_101221583 | 138 |
| 290 | 3300025917 | Ga0207660_10210123 | Ga0207660_102101231 | 138 |
| 291 | 3300025918 | Ga0207662_10195918 | Ga0207662_101959182 | 138 |
| 292 | 3300025919 | Ga0207657_10042053 | Ga0207657_100420534 | 138 |
| 293 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003370 | 138 |
| 294 | 3300025921 | Ga0207652_10074731 | Ga0207652_100747315 | 138 |
| 295 | 3300025922 | Ga0207646_10556930 | Ga0207646_105569302 | 138 |
| 296 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004491 | 138 |
| 297 | 3300025924 | Ga0207694_10082230 | Ga0207694_100822302 | 138 |
| 298 | 3300025925 | Ga0207650_10010427 | Ga0207650_100104274 | 138 |
| 299 | 3300025925 | Ga0207650_10145116 | Ga0207650_101451163 | 138 |
| 300 | 3300025925 | Ga0207650_10540173 | Ga0207650_105401732 | 138 |
| 301 | 3300025926 | Ga0207659_10213968 | Ga0207659_102139682 | 138 |
| 302 | 3300025927 | Ga0207687_10000017 | Ga0207687_1000001750 | 138 |
| 303 | 3300025927 | Ga0207687_10000018 | Ga0207687_10000018207 | 138 |
| 304 | 3300025928 | Ga0207700_10000384 | Ga0207700_1000038410 | 138 |
| 305 | 3300025928 | Ga0207700_10900642 | Ga0207700_109006422 | 138 |
| 306 | 3300025929 | Ga0207664_10416642 | Ga0207664_104166421 | 138 |
| 307 | 3300025929 | Ga0207664_10905986 | Ga0207664_109059862 | 138 |
| 308 | 3300025931 | Ga0207644_10426795 | Ga0207644_104267952 | 138 |
| 309 | 3300025932 | Ga0207690_10002059 | Ga0207690_100020594 | 138 |
| 310 | 3300025933 | Ga0207706_10000012 | Ga0207706_10000012152 | 138 |
| 311 | 3300025933 | Ga0207706_10317639 | Ga0207706_103176392 | 138 |
| 312 | 3300025934 | Ga0207686_10000888 | Ga0207686_1000088817 | 138 |
| 313 | 3300025934 | Ga0207686_10017304 | Ga0207686_100173042 | 138 |
| 314 | 3300025934 | Ga0207686_10183716 | Ga0207686_101837162 | 138 |
| 315 | 3300025934 | Ga0207686_10560482 | Ga0207686_105604822 | 138 |
| 316 | 3300025937 | Ga0207669_10000018 | Ga0207669_1000001889 | 138 |
| 317 | 3300025937 | Ga0207669_10693476 | Ga0207669_106934761 | 138 |
| 318 | 3300025938 | Ga0207704_10000088 | Ga0207704_1000008835 | 138 |
| 319 | 3300025938 | Ga0207704_10155056 | Ga0207704_101550561 | 138 |
| 320 | 3300025938 | Ga0207704_10352234 | Ga0207704_103522342 | 138 |
| 321 | 3300025938 | Ga0207704_10382762 | Ga0207704_103827622 | 138 |
| 322 | 3300025938 | Ga0207704_10688562 | Ga0207704_106885622 | 138 |
| 323 | 3300025938 | Ga0207704_10699866 | Ga0207704_106998662 | 138 |
| 324 | 3300025939 | Ga0207665_10621997 | Ga0207665_106219971 | 138 |
| 325 | 3300025940 | Ga0207691_10007934 | Ga0207691_100079346 | 138 |
| 326 | 3300025940 | Ga0207691_10008177 | Ga0207691_100081775 | 138 |
| 327 | 3300025940 | Ga0207691_10190751 | Ga0207691_101907513 | 138 |
| 328 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006128 | 138 |
| 329 | 3300025942 | Ga0207689_10043334 | Ga0207689_100433345 | 138 |
| 330 | 3300025944 | Ga0207661_10029998 | Ga0207661_100299983 | 138 |
| 331 | 3300025944 | Ga0207661_10073958 | Ga0207661_100739582 | 138 |
| 332 | 3300025944 | Ga0207661_10109173 | Ga0207661_101091733 | 138 |
| 333 | 3300025944 | Ga0207661_10387827 | Ga0207661_103878272 | 138 |
| 334 | 3300025945 | Ga0207679_10014078 | Ga0207679_100140783 | 138 |
| 335 | 3300025945 | Ga0207679_10014260 | Ga0207679_100142608 | 138 |
| 336 | 3300025945 | Ga0207679_10051165 | Ga0207679_100511653 | 138 |
| 337 | 3300025945 | Ga0207679_10264528 | Ga0207679_102645282 | 138 |
| 338 | 3300025945 | Ga0207679_10846208 | Ga0207679_108462082 | 138 |
| 339 | 3300025949 | Ga0207667_10301303 | Ga0207667_103013032 | 138 |
| 340 | 3300025949 | Ga0207667_10446954 | Ga0207667_104469543 | 138 |
| 341 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007311 | 138 |
| 342 | 3300025961 | Ga0207712_10003277 | Ga0207712_100032775 | 138 |
| 343 | 3300025961 | Ga0207712_10181569 | Ga0207712_101815692 | 138 |
| 344 | 3300025972 | Ga0207668_10017566 | Ga0207668_100175663 | 138 |
| 345 | 3300025981 | Ga0207640_10011876 | Ga0207640_100118764 | 138 |
| 346 | 3300025981 | Ga0207640_10147335 | Ga0207640_101473353 | 138 |
| 347 | 3300025986 | Ga0207658_10010674 | Ga0207658_100106744 | 138 |
| 348 | 3300025986 | Ga0207658_10039026 | Ga0207658_100390262 | 138 |
| 349 | 3300026023 | Ga0207677_10000519 | Ga0207677_1000051914 | 138 |
| 350 | 3300026035 | Ga0207703_10000023 | Ga0207703_10000023171 | 138 |
| 351 | 3300026035 | Ga0207703_10000152 | Ga0207703_1000015242 | 138 |
| 352 | 3300026035 | Ga0207703_10063806 | Ga0207703_100638063 | 138 |
| 353 | 3300026035 | Ga0207703_10250503 | Ga0207703_102505032 | 138 |
| 354 | 3300026035 | Ga0207703_10835328 | Ga0207703_108353281 | 138 |
| 355 | 3300026041 | Ga0207639_10001493 | Ga0207639_100014938 | 138 |
| 356 | 3300026041 | Ga0207639_10037170 | Ga0207639_100371704 | 138 |
| 357 | 3300026041 | Ga0207639_10114118 | Ga0207639_101141183 | 138 |
| 358 | 3300026067 | Ga0207678_10287878 | Ga0207678_102878782 | 138 |
| 359 | 3300026075 | Ga0207708_10134054 | Ga0207708_101340541 | 138 |
| 360 | 3300026075 | Ga0207708_10236970 | Ga0207708_102369702 | 138 |
| 361 | 3300026075 | Ga0207708_10310874 | Ga0207708_103108743 | 138 |
| 362 | 3300026078 | Ga0207702_10014818 | Ga0207702_100148181 | 138 |
| 363 | 3300026078 | Ga0207702_10093924 | Ga0207702_100939243 | 138 |
| 364 | 3300026088 | Ga0207641_10000151 | Ga0207641_1000015189 | 138 |
| 365 | 3300026088 | Ga0207641_10153602 | Ga0207641_101536023 | 138 |
| 366 | 3300026088 | Ga0207641_11190415 | Ga0207641_111904152 | 138 |
| 367 | 3300026089 | Ga0207648_10000872 | Ga0207648_1000087235 | 138 |
| 368 | 3300026089 | Ga0207648_10719680 | Ga0207648_107196802 | 138 |
| 369 | 3300026095 | Ga0207676_10000016 | Ga0207676_1000001616 | 138 |
| 370 | 3300026116 | Ga0207674_10020885 | Ga0207674_100208853 | 138 |
| 371 | 3300026116 | Ga0207674_10103847 | Ga0207674_101038473 | 138 |
| 372 | 3300026121 | Ga0207683_10021226 | Ga0207683_100212265 | 138 |
| 373 | 3300026121 | Ga0207683_10092674 | Ga0207683_100926742 | 138 |
| 374 | 3300026121 | Ga0207683_10237463 | Ga0207683_102374633 | 138 |
| 375 | 3300026142 | Ga0207698_10000004 | Ga0207698_10000004183 | 138 |
| 376 | 3300026142 | Ga0207698_10223428 | Ga0207698_102234282 | 138 |
| 377 | 3300026142 | Ga0207698_11111638 | Ga0207698_111116382 | 138 |
| 378 | 3300027671 | Ga0209588_1027045 | Ga0209588_10270452 | 138 |
| 379 | 3300027671 | Ga0209588_1056343 | Ga0209588_10563431 | 138 |
| 380 | 3300028379 | Ga0268266_10000047 | Ga0268266_10000047261 | 138 |
| 381 | 3300028379 | Ga0268266_10022551 | Ga0268266_100225515 | 138 |
| 382 | 3300028379 | Ga0268266_11175425 | Ga0268266_111754251 | 138 |
| 383 | 3300028380 | Ga0268265_10001435 | Ga0268265_1000143520 | 138 |
| 384 | 3300028381 | Ga0268264_10035372 | Ga0268264_100353722 | 138 |
| 385 | 3300028558 | Ga0265326_10000515 | Ga0265326_100005157 | 138 |
| 386 | 3300028563 | Ga0265319_1001877 | Ga0265319_10018776 | 138 |
| 387 | 3300028563 | Ga0265319_1011985 | Ga0265319_10119854 | 138 |
| 388 | 3300028573 | Ga0265334_10121632 | Ga0265334_101216321 | 138 |
| 389 | 3300028577 | Ga0265318_10012595 | Ga0265318_100125954 | 138 |
| 390 | 3300028577 | Ga0265318_10041182 | Ga0265318_100411823 | 138 |
| 391 | 3300028666 | Ga0265336_10000005 | Ga0265336_100000056 | 138 |
| 392 | 3300028666 | Ga0265336_10051010 | Ga0265336_100510102 | 138 |
| 393 | 3300028666 | Ga0265336_10053720 | Ga0265336_100537202 | 138 |
| 394 | 3300028800 | Ga0265338_10000001 | Ga0265338_10000001820 | 138 |
| 395 | 3300028800 | Ga0265338_10000185 | Ga0265338_1000018581 | 138 |
| 396 | 3300029957 | Ga0265324_10004931 | Ga0265324_100049315 | 138 |
| 397 | 3300030521 | Ga0307511_10298276 | Ga0307511_102982762 | 138 |
| 398 | 3300031239 | Ga0265328_10115316 | Ga0265328_101153162 | 138 |
| 399 | 3300031240 | Ga0265320_10166384 | Ga0265320_101663841 | 138 |
| 400 | 3300031241 | Ga0265325_10248162 | Ga0265325_102481621 | 138 |
| 401 | 3300031247 | Ga0265340_10000001 | Ga0265340_10000001818 | 138 |
| 402 | 3300031249 | Ga0265339_10186865 | Ga0265339_101868651 | 138 |
| 403 | 3300031250 | Ga0265331_10024934 | Ga0265331_100249343 | 138 |
| 404 | 3300031251 | Ga0265327_10045033 | Ga0265327_100450334 | 138 |
| 405 | 3300031344 | Ga0265316_10378637 | Ga0265316_103786372 | 138 |
| 406 | 3300031595 | Ga0265313_10073764 | Ga0265313_100737642 | 138 |
| 407 | 3300031711 | Ga0265314_10120301 | Ga0265314_101203012 | 138 |
| 408 | 3300031727 | Ga0316576_10257903 | Ga0316576_102579032 | 138 |
| 409 | 3300031852 | Ga0307410_10682923 | Ga0307410_106829232 | 138 |
| 410 | 3300031995 | Ga0307409_100251145 | Ga0307409_1002511452 | 138 |
| 411 | 3300032002 | Ga0307416_102136299 | Ga0307416_1021362992 | 138 |
| 412 | 3300032002 | Ga0307416_102644878 | Ga0307416_1026448782 | 138 |
| 413 | 3300032126 | Ga0307415_100017980 | Ga0307415_1000179805 | 138 |
| 414 | 3300032139 | Ga0316580_10016355 | Ga0316580_100163552 | 138 |
| 415 | 3300035724 | Ga0373933_1074408 | Ga0373933_1074408_84_500 | 138 |
| 416 | 3300035724 | Ga0373933_1159050 | Ga0373933_1159050_48_464 | 138 |
| 417 | 3300036401 | Ga0373937_0230833 | Ga0373937_0230833_737_1153 | 138 |
| 418 | 3300036401 | Ga0373937_0515827 | Ga0373937_0515827_337_783 | 138 |
| 419 | 3300036647 | Ga0316582_0062455 | Ga0316582_0062455_1721_2170 | 138 |
| 420 | 3300036712 | Ga0316584_0001138 | Ga0316584_0001138_6299_6757 | 138 |
| 421 | 3300036712 | Ga0316584_0119883 | Ga0316584_0119883_145_582 | 138 |
| 422 | 3300037068 | Ga0373925_0477831 | Ga0373925_0477831_292_735 | 138 |
| 423 | 3300037418 | Ga0395900_0139332 | Ga0395900_0139332_1248_1664 | 138 |
| 424 | 3300037418 | Ga0395900_0297602 | Ga0395900_0297602_881_1297 | 138 |
| 425 | 3300037466 | Ga0395898_0069843 | Ga0395898_0069843_46_462 | 138 |
| 426 | 3300037466 | Ga0395898_0141655 | Ga0395898_0141655_892_1308 | 138 |
| 427 | 3300037466 | Ga0395898_0426121 | Ga0395898_0426121_450_866 | 138 |
| 428 | 3300037466 | Ga0395898_1044399 | Ga0395898_1044399_195_611 | 138 |
| 429 | 3300037466 | Ga0395898_1220811 | Ga0395898_1220811_65_481 | 138 |
| 430 | 3300037471 | Ga0395905_0178396 | Ga0395905_0178396_1052_1468 | 138 |
| 431 | 3300037471 | Ga0395905_0575048 | Ga0395905_0575048_414_830 | 138 |
| 432 | 3300037471 | Ga0395905_0825175 | Ga0395905_0825175_222_638 | 138 |
| 433 | 3300037588 | Ga0316581_0005128 | Ga0316581_0005128_2606_3064 | 138 |
| 434 | 3300038443 | Ga0395901_0018398 | Ga0395901_0018398_982_1398 | 138 |
| 435 | 3300038443 | Ga0395901_0052502 | Ga0395901_0052502_1712_2128 | 138 |
| 436 | 3300038443 | Ga0395901_0152207 | Ga0395901_0152207_1438_1854 | 138 |
| 437 | 3300038443 | Ga0395901_0192138 | Ga0395901_0192138_326_742 | 138 |
| 438 | 3300038443 | Ga0395901_0499757 | Ga0395901_0499757_593_1009 | 138 |
| 439 | 3300039062 | Ga0400483_076593 | Ga0400483_076593_1588_2025 | 138 |
| 440 | 3300039062 | Ga0400483_185685 | Ga0400483_185685_2950_3387 | 138 |
| 441 | 3300039437 | Ga0436365_0418890 | Ga0436365_0418890_336_779 | 138 |
| 442 | 3300039453 | Ga0436362_1065511 | Ga0436362_1065511_715_1152 | 138 |
| 443 | 3300041443 | Ga0451789_0083276 | Ga0451789_0083276_55_471 | 138 |
| 444 | 3300041463 | Ga0451804_1059469 | Ga0451804_1059469_87_518 | 138 |
| 445 | 3300041505 | Ga0451849_1303005 | Ga0451849_1303005_98_520 | 138 |
| 446 | 3300041512 | Ga0451853_1628146 | Ga0451853_1628146_817_1233 | 138 |
| 447 | 3300041512 | Ga0451853_2782007 | Ga0451853_2782007_1150_1566 | 138 |
| 448 | 3300044694 | Ga0466963_0000001 | Ga0466963_0000001_49467_49883 | 138 |
| 449 | 3300044694 | Ga0466963_0054081 | Ga0466963_0054081_2219_2635 | 138 |
| 450 | 3300044694 | Ga0466963_0162512 | Ga0466963_0162512_817_1260 | 138 |
| 451 | 3300044706 | Ga0466964_0127729 | Ga0466964_0127729_134_580 | 138 |
| 452 | 3300044706 | Ga0466964_0865855 | Ga0466964_0865855_30_497 | 138 |
| 453 | 3300044719 | Ga0466971_0417840 | Ga0466971_0417840_131_601 | 138 |
| 454 | 3300044735 | Ga0466968_0090666 | Ga0466968_0090666_354_794 | 138 |
| 455 | 3300044842 | Ga0466957_0134356 | Ga0466957_0134356_443_886 | 138 |
| 456 | 3300044901 | Ga0466960_0234143 | Ga0466960_0234143_429_869 | 138 |
| 457 | 3300045976 | Ga0466967_0013954 | Ga0466967_0013954_5155_5574 | 138 |
| 458 | 3300045976 | Ga0466967_0029047 | Ga0466967_0029047_379_822 | 138 |
| 459 | 3300045976 | Ga0466967_0097064 | Ga0466967_0097064_1986_2429 | 138 |
| 460 | 3300045976 | Ga0466967_0101260 | Ga0466967_0101260_787_1206 | 138 |
| 461 | 3300045976 | Ga0466967_0375794 | Ga0466967_0375794_86_505 | 138 |
| 462 | 3300046454 | Ga0495592_0081337 | Ga0495592_0081337_1848_2267 | 138 |
| 463 | 3300046454 | Ga0495592_0133692 | Ga0495592_0133692_823_1239 | 138 |
| 464 | 3300046455 | Ga0495603_0472128 | Ga0495603_0472128_80_541 | 138 |
| 465 | 3300046459 | Ga0495629_0001048 | Ga0495629_0001048_11575_12009 | 138 |
| 466 | 3300046459 | Ga0495629_0019036 | Ga0495629_0019036_891_1310 | 138 |
| 467 | 3300046460 | Ga0495638_0026563 | Ga0495638_0026563_2490_2906 | 138 |
| 468 | 3300046461 | Ga0495641_0000044 | Ga0495641_0000044_59677_60093 | 138 |
| 469 | 3300046461 | Ga0495641_0179217 | Ga0495641_0179217_239_658 | 138 |
| 470 | 3300046462 | Ga0495651_0276682 | Ga0495651_0276682_23_439 | 138 |
| 471 | 3300046463 | Ga0495653_0242572 | Ga0495653_0242572_531_947 | 138 |
| 472 | 3300046473 | Ga0495582_0483030 | Ga0495582_0483030_201_662 | 138 |
| 473 | 3300046474 | Ga0495605_0298986 | Ga0495605_0298986_212_649 | 138 |
| 474 | 3300046476 | Ga0495662_0000061 | Ga0495662_0000061_15320_15763 | 138 |
| 475 | 3300046476 | Ga0495662_0192616 | Ga0495662_0192616_68_487 | 138 |
| 476 | 3300046492 | Ga0495585_0589985 | Ga0495585_0589985_82_498 | 138 |
| 477 | 3300046499 | Ga0495594_0000006 | Ga0495594_0000006_154792_155208 | 138 |
| 478 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_261049_261489 | 138 |
| 479 | 3300046511 | Ga0495608_0005192 | Ga0495608_0005192_7714_8130 | 138 |
| 480 | 3300046511 | Ga0495608_0015106 | Ga0495608_0015106_797_1213 | 138 |
| 481 | 3300046514 | Ga0495618_0000174 | Ga0495618_0000174_17582_17998 | 138 |
| 482 | 3300046514 | Ga0495618_0169909 | Ga0495618_0169909_552_989 | 138 |
| 483 | 3300046514 | Ga0495618_0605452 | Ga0495618_0605452_181_600 | 138 |
| 484 | 3300046515 | Ga0495620_0000144 | Ga0495620_0000144_15357_15773 | 138 |
| 485 | 3300046516 | Ga0495628_0002849 | Ga0495628_0002849_4745_5161 | 138 |
| 486 | 3300046516 | Ga0495628_0012147 | Ga0495628_0012147_1728_2144 | 138 |
| 487 | 3300046516 | Ga0495628_0035786 | Ga0495628_0035786_2583_2999 | 138 |
| 488 | 3300046516 | Ga0495628_0123330 | Ga0495628_0123330_1375_1818 | 138 |
| 489 | 3300046517 | Ga0495630_0000014 | Ga0495630_0000014_13980_14396 | 138 |
| 490 | 3300046517 | Ga0495630_0000408 | Ga0495630_0000408_510_953 | 138 |
| 491 | 3300046517 | Ga0495630_0625594 | Ga0495630_0625594_151_606 | 138 |
| 492 | 3300046529 | Ga0495652_0000010 | Ga0495652_0000010_123320_123736 | 138 |
| 493 | 3300046539 | Ga0495621_0015316 | Ga0495621_0015316_1272_1688 | 138 |
| 494 | 3300046539 | Ga0495621_0263554 | Ga0495621_0263554_32_448 | 138 |
| 495 | 3300046543 | Ga0495645_0009482 | Ga0495645_0009482_2864_3280 | 138 |
| 496 | 3300046543 | Ga0495645_0513780 | Ga0495645_0513780_166_588 | 138 |
| 497 | 3300046543 | Ga0495645_0735645 | Ga0495645_0735645_18_464 | 138 |
| 498 | 3300046557 | Ga0495622_0000201 | Ga0495622_0000201_26843_27259 | 138 |
| 499 | 3300046558 | Ga0495633_0101344 | Ga0495633_0101344_628_1044 | 138 |
| 500 | 3300046559 | Ga0495667_0380627 | Ga0495667_0380627_184_600 | 138 |
| 501 | 3300046615 | Ga0495656_0001383 | Ga0495656_0001383_5679_6095 | 138 |
| 502 | 3300046642 | Ga0495634_0000018 | Ga0495634_0000018_88325_88741 | 138 |
| 503 | 3300046642 | Ga0495634_0000247 | Ga0495634_0000247_32666_33082 | 138 |
| 504 | 3300046642 | Ga0495634_0005521 | Ga0495634_0005521_2078_2497 | 138 |
| 505 | 3300046663 | Ga0495635_0000016 | Ga0495635_0000016_153003_153431 | 138 |
| 506 | 3300046663 | Ga0495635_0046415 | Ga0495635_0046415_1658_2083 | 138 |
| 507 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_393195_393635 | 138 |
| 508 | 3300046675 | Ga0495657_0015946 | Ga0495657_0015946_1658_2074 | 138 |
| 509 | 3300046681 | Ga0495647_0000136 | Ga0495647_0000136_14699_15121 | 138 |
| 510 | 3300046681 | Ga0495647_0199127 | Ga0495647_0199127_227_688 | 138 |
| 511 | 3300046683 | Ga0495658_0000005 | Ga0495658_0000005_53992_54408 | 138 |
| 512 | 3300046683 | Ga0495658_0009433 | Ga0495658_0009433_3715_4173 | 138 |
| 513 | 3300046684 | Ga0495669_0000211 | Ga0495669_0000211_21165_21581 | 138 |
| 514 | 3300046684 | Ga0495669_0073819 | Ga0495669_0073819_52_471 | 138 |
| 515 | 3300046689 | Ga0495613_0083219 | Ga0495613_0083219_1329_1745 | 138 |
| 516 | 3300046690 | Ga0495624_0088469 | Ga0495624_0088469_50_499 | 138 |
| 517 | 3300046691 | Ga0495670_0053440 | Ga0495670_0053440_35_451 | 138 |
| 518 | 3300046809 | Ga0495600_0001684 | Ga0495600_0001684_2397_2813 | 138 |
| 519 | 3300046809 | Ga0495600_0007043 | Ga0495600_0007043_4435_4857 | 138 |
| 520 | 3300046809 | Ga0495600_0230080 | Ga0495600_0230080_532_978 | 138 |
| 521 | 3300047317 | Ga0495604_0095236 | Ga0495604_0095236_572_1015 | 138 |
| 522 | 3300047319 | Ga0495674_0717750 | Ga0495674_0717750_158_604 | 138 |
| 523 | 3300047320 | Ga0495672_0074427 | Ga0495672_0074427_870_1316 | 138 |
| 524 | 3300047321 | Ga0495676_0018293 | Ga0495676_0018293_5750_6166 | 138 |
| 525 | 3300047321 | Ga0495676_0286997 | Ga0495676_0286997_399_833 | 138 |
| 526 | 3300047322 | Ga0495680_0000773 | Ga0495680_0000773_10553_10969 | 138 |
| 527 | 3300047322 | Ga0495680_0157340 | Ga0495680_0157340_140_565 | 138 |
| 528 | 3300047444 | Ga0495675_0000017 | Ga0495675_0000017_52013_52453 | 138 |
| 529 | 3300047446 | Ga0495679_073860 | Ga0495679_073860_434_850 | 138 |
| 530 | 3300047673 | Ga0495593_0055228 | Ga0495593_0055228_673_1089 | 138 |
| 531 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_41855_42298 | 138 |
| 532 | 3300048088 | Ga0495602_0009797 | Ga0495602_0009797_6582_6998 | 138 |
| 533 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_303951_304367 | 138 |
| 534 | 3300048903 | Ga0496100_1084357 | Ga0496100_1084357_95_511 | 138 |
| 535 | 3300048903 | Ga0496100_1695506 | Ga0496100_1695506_44_460 | 138 |
| 536 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_303951_304367 | 138 |
| 537 | 3300048904 | Ga0496101_0014452 | Ga0496101_0014452_4151_4612 | 138 |
| 538 | 3300048904 | Ga0496101_0015579 | Ga0496101_0015579_690_1133 | 138 |
| 539 | 3300048905 | Ga0496102_0031518 | Ga0496102_0031518_3914_4357 | 138 |
| 540 | 3300048905 | Ga0496102_0268743 | Ga0496102_0268743_58_519 | 138 |
| 541 | 3300048905 | Ga0496102_0905609 | Ga0496102_0905609_41_460 | 138 |
| 542 | 3300048905 | Ga0496102_1208822 | Ga0496102_1208822_16_435 | 138 |
| 543 | 3300048906 | Ga0496103_0213967 | Ga0496103_0213967_191_634 | 138 |
| 544 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_182737_183153 | 138 |
| 545 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_109761_110177 | 138 |
| 546 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_365622_366038 | 138 |
| 547 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_304903_305319 | 138 |
| 548 | 3300048909 | Ga0496106_0000061 | Ga0496106_0000061_46875_47291 | 138 |
| 549 | 3300048909 | Ga0496106_0000997 | Ga0496106_0000997_12902_13318 | 138 |
| 550 | 3300048909 | Ga0496106_0010671 | Ga0496106_0010671_3198_3659 | 138 |
| 551 | 3300048909 | Ga0496106_0134275 | Ga0496106_0134275_16_459 | 138 |
| 552 | 3300048909 | Ga0496106_0676807 | Ga0496106_0676807_143_559 | 138 |
| 553 | 3300048909 | Ga0496106_0836425 | Ga0496106_0836425_190_627 | 138 |
| 554 | 3300048910 | Ga0496107_0000013 | Ga0496107_0000013_130995_131411 | 138 |
| 555 | 3300048910 | Ga0496107_0006601 | Ga0496107_0006601_4725_5141 | 138 |
| 556 | 3300048910 | Ga0496107_0956415 | Ga0496107_0956415_189_605 | 138 |
| 557 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_593662_594078 | 138 |
| 558 | 3300048911 | Ga0496108_0000187 | Ga0496108_0000187_50657_51073 | 138 |
| 559 | 3300048911 | Ga0496108_0000288 | Ga0496108_0000288_29843_30286 | 138 |
| 560 | 3300048911 | Ga0496108_0011964 | Ga0496108_0011964_5450_5866 | 138 |
| 561 | 3300048911 | Ga0496108_0076000 | Ga0496108_0076000_2275_2721 | 138 |
| 562 | 3300048911 | Ga0496108_0084005 | Ga0496108_0084005_2161_2622 | 138 |
| 563 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_268208_268624 | 138 |
| 564 | 3300048912 | Ga0496109_0000012 | Ga0496109_0000012_142462_142905 | 138 |
| 565 | 3300048912 | Ga0496109_0000636 | Ga0496109_0000636_20645_21061 | 138 |
| 566 | 3300048912 | Ga0496109_0022094 | Ga0496109_0022094_3914_4375 | 138 |
| 567 | 3300048912 | Ga0496109_0061038 | Ga0496109_0061038_1643_2059 | 138 |
| 568 | 3300048912 | Ga0496109_0426213 | Ga0496109_0426213_51_521 | 138 |
| 569 | 3300048912 | Ga0496109_1172796 | Ga0496109_1172796_207_626 | 138 |
| 570 | 3300048912 | Ga0496109_1570275 | Ga0496109_1570275_46_489 | 138 |
| 571 | 3300048913 | Ga0496110_0014030 | Ga0496110_0014030_5878_6318 | 138 |
| 572 | 3300048913 | Ga0496110_0227735 | Ga0496110_0227735_794_1210 | 138 |
| 573 | 3300048913 | Ga0496110_0508727 | Ga0496110_0508727_167_628 | 138 |
| 574 | 3300048913 | Ga0496110_0907754 | Ga0496110_0907754_252_671 | 138 |
| 575 | 3300048914 | Ga0496111_0017072 | Ga0496111_0017072_1417_1833 | 138 |
| 576 | 3300048914 | Ga0496111_0726005 | Ga0496111_0726005_25_495 | 138 |
| 577 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_16604_17023 | 138 |
| 578 | 3300048915 | Ga0496112_0094261 | Ga0496112_0094261_1238_1708 | 138 |
| 579 | 3300048915 | Ga0496112_0374073 | Ga0496112_0374073_748_1164 | 138 |
| 580 | 3300048915 | Ga0496112_0759185 | Ga0496112_0759185_89_550 | 138 |
| 581 | 3300048915 | Ga0496112_1044758 | Ga0496112_1044758_18_434 | 138 |
| 582 | 3300048916 | Ga0496113_0037947 | Ga0496113_0037947_2353_2769 | 138 |
| 583 | 3300048916 | Ga0496113_0095191 | Ga0496113_0095191_981_1400 | 138 |
| 584 | 3300048916 | Ga0496113_0418587 | Ga0496113_0418587_286_702 | 138 |
| 585 | 3300048916 | Ga0496113_0737338 | Ga0496113_0737338_97_540 | 138 |
| 586 | 3300048917 | Ga0496114_0048234 | Ga0496114_0048234_43_459 | 138 |
| 587 | 3300048917 | Ga0496114_0075680 | Ga0496114_0075680_1932_2393 | 138 |
| 588 | 3300048918 | Ga0496115_0000232 | Ga0496115_0000232_14476_14892 | 138 |
| 589 | 3300048918 | Ga0496115_0000429 | Ga0496115_0000429_2405_2821 | 138 |
| 590 | 3300048918 | Ga0496115_0104399 | Ga0496115_0104399_869_1309 | 138 |
| 591 | 3300048918 | Ga0496115_0195232 | Ga0496115_0195232_102_545 | 138 |
| 592 | 3300048918 | Ga0496115_0722411 | Ga0496115_0722411_263_703 | 138 |
| 593 | 3300048928 | Ga0496125_0085955 | Ga0496125_0085955_1091_1507 | 138 |
| 594 | 3300048929 | Ga0496126_0003394 | Ga0496126_0003394_12902_13408 | 138 |
| 595 | 3300048929 | Ga0496126_0011173 | Ga0496126_0011173_3294_3734 | 138 |
| 596 | 3300049571 | Ga0501034_0000469 | Ga0501034_0000469_42671_43114 | 138 |
| 597 | 3300049571 | Ga0501034_0926233 | Ga0501034_0926233_277_693 | 138 |
| 598 | 3300049578 | Ga0501042_0297961 | Ga0501042_0297961_78_494 | 138 |
| 599 | 3300049583 | Ga0501067_0000073 | Ga0501067_0000073_35906_36367 | 138 |
| 600 | 3300049583 | Ga0501067_0011503 | Ga0501067_0011503_1192_1653 | 138 |
| 601 | 3300049584 | Ga0501068_0000683 | Ga0501068_0000683_8592_9053 | 138 |
| 602 | 3300049585 | Ga0501069_0000063 | Ga0501069_0000063_7825_8286 | 138 |
| 603 | 3300049585 | Ga0501069_0004608 | Ga0501069_0004608_6150_6596 | 138 |
| 604 | 3300049586 | Ga0501070_0194407 | Ga0501070_0194407_1214_1630 | 138 |
| 605 | 3300049587 | Ga0501071_0128823 | Ga0501071_0128823_962_1423 | 138 |
| 606 | 3300049587 | Ga0501071_0434010 | Ga0501071_0434010_14_430 | 138 |
| 607 | 3300049591 | Ga0501075_0004347 | Ga0501075_0004347_9140_9556 | 138 |
| 608 | 3300050491 | nmdc:mga00v17_1003977_c1 | nmdc:mga00v17_1003977_c1_82_498 | 138 |
| 609 | 3300050507 | nmdc:mga05p37_1571662_c1 | nmdc:mga05p37_1571662_c1_128_577 | 138 |
| 610 | 3300050509 | nmdc:mga0qj67_256096_c1 | nmdc:mga0qj67_256096_c1_123_566 | 138 |
| 611 | 3300050510 | nmdc:mga06r32_169736_c1 | nmdc:mga06r32_169736_c1_938_1354 | 138 |
| 612 | 3300050511 | nmdc:mga08y16_52506_c1 | nmdc:mga08y16_52506_c1_638_1087 | 138 |
| 613 | 3300050512 | nmdc:mga0n895_89014_c1 | nmdc:mga0n895_89014_c1_930_1376 | 138 |
| 614 | 3300050513 | nmdc:mga0rr50_11358_c1 | nmdc:mga0rr50_11358_c1_3125_3571 | 138 |
| 615 | 3300050513 | nmdc:mga0rr50_45142_c1 | nmdc:mga0rr50_45142_c1_1334_1795 | 138 |
| 616 | 3300050514 | nmdc:mga08x19_111915_c1 | nmdc:mga08x19_111915_c1_58_504 | 138 |
| 617 | 3300050514 | nmdc:mga08x19_433321_c1 | nmdc:mga08x19_433321_c1_320_781 | 138 |
| 618 | 3300053077 | Ga0495601_0010373 | Ga0495601_0010373_3399_3842 | 138 |
| 619 | 3300053077 | Ga0495601_0053946 | Ga0495601_0053946_247_666 | 138 |
| 620 | 3300053077 | Ga0495601_0195665 | Ga0495601_0195665_349_771 | 138 |
| 621 | 3300053077 | Ga0495601_0377896 | Ga0495601_0377896_109_525 | 138 |
| 622 | 3300053078 | Ga0495612_0020813 | Ga0495612_0020813_1963_2382 | 138 |
| 623 | 3300053078 | Ga0495612_0034982 | Ga0495612_0034982_1186_1629 | 138 |
| 624 | 3300053078 | Ga0495612_0070968 | Ga0495612_0070968_31_447 | 138 |
| 625 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_52007_52447 | 138 |
| 626 | 3300053084 | Ga0495595_0000103 | Ga0495595_0000103_21252_21668 | 138 |
| 627 | 3300053084 | Ga0495595_0011187 | Ga0495595_0011187_466_909 | 138 |
| 628 | 3300053085 | Ga0495619_0000025 | Ga0495619_0000025_30104_30520 | 138 |
| 629 | 3300053085 | Ga0495619_0000053 | Ga0495619_0000053_5665_6105 | 138 |
| 630 | 3300053085 | Ga0495619_0001003 | Ga0495619_0001003_13943_14368 | 138 |
| 631 | 3300053085 | Ga0495619_0003474 | Ga0495619_0003474_628_1071 | 138 |
| 632 | 3300053085 | Ga0495619_0005151 | Ga0495619_0005151_2605_3021 | 138 |
| 633 | 3300053085 | Ga0495619_0040287 | Ga0495619_0040287_2450_2893 | 138 |
| 634 | 3300053102 | Ga0500554_065422 | Ga0500554_065422_93_512 | 138 |
| 635 | 3300053123 | Ga0500614_000117 | Ga0500614_000117_5943_6359 | 138 |
| 636 | 3300054114 | Ga0501084_0107659 | Ga0501084_0107659_481_897 | 138 |
| 637 | 3300061734 | Ga0530510_0036015 | Ga0530510_0036015_1906_2367 | 138 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jke-assembly1.cif.gz_A | d-tyr trnatyr deacylase from escherichia coli | 0.9692 | 1 | 138 |
| 1jke-assembly1.cif.gz_A | d-tyr trnatyr deacylase from escherichia coli | 0.9623 | 1 | 138 |
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.9599 | 1 | 138 |
| 3ko7-assembly2.cif.gz_D | dtd from plasmodium falciparum in complex with d-lysine | 0.9569 | 1 | 137 |
| 3lmv-assembly2.cif.gz_C | d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes | 0.9564 | 1 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14274_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9803 | 1 | 137 | 3.50.80.10 |
| af_O14274_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9664 | 1 | 137 | 3.50.80.10 |
| af_F1QGC8_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9618 | 1 | 138 | 3.50.80.10 |
| 1j7gA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9599 | 1 | 138 | 3.50.80.10 |
| af_Q07648_1_150_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9559 | 1 | 137 | 3.50.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4RS55-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9931 | 1 | 137 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-Q1ATQ8-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) | 0.9877 | 1 | 138 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A1F8TNJ3-F1-model_v4 | D-tyrosyl-tRNA(Tyr) deacylase | 0.9874 | 10 | 134 |
GO:0005737
GO:0051500 |
| AF-A0A6L5F498-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.987 | 1 | 138 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A1Z8QXJ5-F1-model_v4 | deleted | 0.9866 | 1 | 136 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar