F471401

General Info

Members Datasets Scaffolds Average Seq Length
637 507 325 234

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1008306|Ga0006562J51391_10083062
Length 251
Sequence MLLIAGLGNPGPKYAHNRHNIGFMAADEIFRRHRFSNWQKKFQAEIADGVIDGEKVLLVKPQTFMNLSGQSIGEAMRFYKLTPADLVVIYDELDLIPGKLRIKTGGGSGGHNGIKSIDAHMQAFPGGQNYRRMRLGIGHPGAKELVHNYVLGDFAKADNEWLDTLLGAIADNVGLLAAKGEDNSFMNRIALAMGDGNQRPSGFKADPAQLEKAPPKAQSHIRQARQNQKKPNIPASGPMAEMLRKLLGKKD

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
11 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
12 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
13 2534681786 Brucella suis 92/29 Isolate Unclassified
14 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
15 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
16 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
17 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
18 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
19 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
20 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
21 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
22 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
23 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
24 2643221607 Rhizobium sp. Root73 Isolate Unclassified
25 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
26 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
27 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
28 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
29 2643221688 Rhizobium sp. Root482 Isolate Unclassified
30 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
31 2643221718 Rhizobium sp. Root268 Isolate Unclassified
32 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
33 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
34 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
35 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
36 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
37 2751185800 Brucella pituitosa AA2 Isolate Unclassified
38 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
39 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
40 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
41 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
42 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
43 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
44 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
45 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
46 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
47 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
48 2791355263 Rhizobium chutanense C5 Isolate Nodule
49 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
50 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
51 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
52 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
53 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
54 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
55 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
56 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
57 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
58 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
59 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
60 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
61 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
62 2854911287 Brucella lupini LUP21 Isolate Unclassified
63 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
64 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
65 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
66 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
67 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
68 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
69 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
70 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
71 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
72 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
73 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
74 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
75 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
76 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
77 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
78 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
79 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
80 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
81 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
82 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
83 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
84 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
85 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
86 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
87 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
88 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
89 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
90 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
91 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
92 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
93 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
94 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
95 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
96 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
97 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
98 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
99 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
100 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
101 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
102 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
103 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
104 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
105 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
106 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
107 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
108 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
109 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
110 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
111 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
112 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
113 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
114 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
115 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
116 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
117 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
118 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
119 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
120 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
121 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
122 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
123 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
124 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
125 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
126 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
127 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
128 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
129 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
130 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
131 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
132 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
133 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
134 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
135 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
136 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
137 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
138 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
139 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
140 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
141 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
142 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
143 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
144 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
145 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
146 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
147 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
148 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
149 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
150 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
151 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
152 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
153 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
154 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
155 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
156 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
157 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
158 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
159 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
160 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
161 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
162 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
163 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
164 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
165 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
166 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
167 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
168 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
169 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
170 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
171 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
172 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
173 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
174 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
175 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
176 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
177 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
178 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
179 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
180 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
181 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
182 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
183 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
184 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
185 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
186 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
187 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
188 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
189 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
190 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
191 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
192 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
193 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
194 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
195 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
196 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
197 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
198 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
199 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
200 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
201 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
202 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
203 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
204 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
205 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
206 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
207 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
208 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
209 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
210 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
211 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
212 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
213 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
214 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
215 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
216 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
217 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
218 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
219 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
220 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
221 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
222 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
223 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
224 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
225 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
226 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
227 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
228 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
229 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
230 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
231 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
232 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
233 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
234 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
235 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
236 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
237 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
238 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
239 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
240 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
241 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
242 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
243 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
244 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
245 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
246 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
247 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
248 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
249 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
250 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
251 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
252 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
253 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
254 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
255 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
256 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
257 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
258 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
259 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
260 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
261 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
262 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
263 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
264 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
265 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
266 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
267 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
268 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
269 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
270 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
271 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
272 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
273 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
274 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
275 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
276 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
277 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
278 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
279 3004167301 Mesorhizobium loti 582 Isolate Unclassified
280 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
281 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
282 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
283 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
284 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
285 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
286 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
287 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
288 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
289 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
290 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
291 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
292 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
293 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
294 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
295 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
296 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
297 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
298 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
299 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
300 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
301 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
302 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
303 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
304 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
305 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
306 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
307 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
308 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
309 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
310 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
311 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
312 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
313 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
314 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
315 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
316 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
317 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
318 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
319 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
320 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
321 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
322 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
323 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
324 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
325 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
326 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
327 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
328 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
329 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
330 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
331 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
332 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
333 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
334 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
335 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
336 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
337 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
338 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
339 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
340 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
341 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
342 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
343 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
344 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
345 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
346 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
347 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
349 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
350 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
351 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
353 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
354 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
356 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
357 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
377 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
380 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
381 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
382 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
383 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
384 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
385 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
386 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
387 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
388 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
389 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
390 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
391 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
392 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
393 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
394 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
395 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
396 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
397 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
398 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
399 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
400 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
401 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
402 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
403 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
404 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
405 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
406 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
407 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
408 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
409 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
410 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
411 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
412 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
413 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
414 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
415 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
416 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
417 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
418 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
419 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
420 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
421 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
422 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
423 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
424 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
425 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
426 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
427 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
428 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
429 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
430 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
431 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
432 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
433 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
434 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
435 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
436 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
437 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
438 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
439 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
440 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
441 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
442 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
443 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
444 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
445 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
446 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
447 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
448 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
449 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
450 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
451 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
452 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
464 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
465 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
466 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
467 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
468 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
469 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
472 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
473 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
474 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
475 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
476 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
477 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
478 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
479 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
480 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
481 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
482 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
483 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
484 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
485 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
486 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
487 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
488 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
489 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
490 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
491 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
492 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
493 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
494 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
495 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
496 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
497 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
498 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
499 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
500 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
501 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
502 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
503 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
504 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
505 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
506 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
507 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.86
Metatranscriptomes 0.16
Isolates 48.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 36.89
Rhizoplane 2.04
Rhizosphere 35.95
Stem 0
Stem Tuber 0
Unclassified 13.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000905 3300001979 Bacteria 13143
2 JGI24739J22299_10009537 3300001989 Bacteria 3614
3 JGI25155J39150_1000014 3300002704 Bacteria 196159
4 JGI25156J39149_1000037 3300002705 Bacteria 109690
5 JGI25162J39368_1000379 3300002737 Bacteria 37841
6 JGI25162J39368_1001708 3300002737 Bacteria 10683
7 JGI25154J39366_1000229 3300002738 Bacteria 37528
8 JGI25157J39369_1000040 3300002741 Bacteria 126165
9 JGI25157J39369_1001353 3300002741 Bacteria 9668
10 JGI25406J46586_10018009 3300003203 Bacteria 2908
11 JGI25165J46597_1000006 3300003214 Bacteria 529784
12 JGI25165J46597_1000395 3300003214 Bacteria 46157
13 JGI25165J46597_1000469 3300003214 Bacteria 39844
14 JGI25153J46596_10023622 3300003215 Bacteria 2236
15 rootL2_10065624 3300003322 Bacteria 8395
16 JGI25160J50197_1006059 3300003354 Bacteria 4942
17 JGI25161J50226_1000068 3300003374 Bacteria 90522
18 Ga0006562J51391_1008306 3300003578 Bacteria 2300
19 Ga0055542_1000483 3300003762 Bacteria 37155
20 Ga0055529_1002224 3300003763 Bacteria 3975
21 Ga0055526_1002000 3300003771 Bacteria 14042
22 Ga0055536_1006223 3300003781 Bacteria 5632
23 Ga0055528_1001364 3300003790 Bacteria 15020
24 Ga0055531_10001015 3300003794 Bacteria 22239
25 Ga0055543_1000189 3300004625 Bacteria 50188
26 Ga0065165_1004223 3300005262 Bacteria 9136
27 Ga0065165_1008292 3300005262 Bacteria 4901
28 Ga0070660_100237582 3300005339 Bacteria 1483
29 Ga0070659_100250094 3300005366 Bacteria 1469
30 Ga0070663_100049284 3300005455 Bacteria 2990
31 Ga0070663_100076203 3300005455 Bacteria 2452
32 Ga0068853_100156133 3300005539 Bacteria 2056
33 Ga0068853_100240375 3300005539 Bacteria 1659
34 Ga0070665_100074460 3300005548 Bacteria 3402
35 Ga0070665_100280373 3300005548 Bacteria 1668
36 Ga0070665_100331435 3300005548 Bacteria 1527
37 Ga0068855_100274319 3300005563 Bacteria 1874
38 Ga0068855_100508968 3300005563 Bacteria 1307
39 Ga0068856_100053525 3300005614 Bacteria 3980
40 Ga0068856_100328231 3300005614 Bacteria 1548
41 Ga0068852_100485212 3300005616 Bacteria 1229
42 Ga0068860_100564058 3300005843 Bacteria 1142
43 Ga0075365_10086838 3300006038 Bacteria 2126
44 Ga0075365_10127473 3300006038 Bacteria 1759
45 Ga0075368_10094793 3300006042 Bacteria 1222
46 Ga0075368_10187080 3300006042 Bacteria 874
47 Ga0075363_100034053 3300006048 Bacteria 2657
48 Ga0075363_100126555 3300006048 Bacteria 1431
49 Ga0075363_100128426 3300006048 Bacteria 1421
50 Ga0075364_10141861 3300006051 Bacteria 1616
51 Ga0075362_10057229 3300006177 Bacteria 1757
52 Ga0075367_10158860 3300006178 Bacteria 1405
53 Ga0075367_10184636 3300006178 Bacteria 1300
54 Ga0075369_10062789 3300006186 Bacteria 1623
55 Ga0075366_10048177 3300006195 Bacteria 2526
56 Ga0075370_10035040 3300006353 Bacteria 2816
57 Ga0105240_10080882 3300009093 Bacteria 3994
58 Ga0105240_10254206 3300009093 Bacteria 2030
59 Ga0105241_10226264 3300009174 Bacteria 1575
60 Ga0105248_10373498 3300009177 Bacteria 1605
61 Ga0105237_10019531 3300009545 Bacteria 6999
62 Ga0105238_10046229 3300009551 Bacteria 4394
63 Ga0105249_10882235 3300009553 Bacteria 961
64 Ga0105239_10046241 3300010375 Bacteria 4769
65 Ga0105239_10270239 3300010375 Bacteria 1912
66 Ga0157373_10073462 3300013100 Bacteria 2413
67 Ga0157370_10041153 3300013104 Bacteria 4461
68 Ga0157369_10093737 3300013105 Bacteria 3205
69 Ga0157369_10531988 3300013105 Bacteria 1215
70 Ga0157372_10216095 3300013307 Bacteria 2222
71 Ga0157372_10462219 3300013307 Bacteria 1479
72 Ga0157380_10936371 3300014326 Bacteria 895
73 Ga0182008_10083775 3300014497 Bacteria 1570
74 Ga0157376_10348823 3300014969 Bacteria 1416
75 Ga0209435_100027 3300025206 Bacteria 196217
76 Ga0209563_104966 3300025230 Bacteria 2471
77 Ga0209437_100051 3300025233 Bacteria 392523
78 Ga0209437_100098 3300025233 Bacteria 229766
79 Ga0209646_1000086 3300025246 Bacteria 196217
80 Ga0209026_1000082 3300025250 Bacteria 196315
81 Ga0209026_1000089 3300025250 Bacteria 175907
82 Ga0209148_1000124 3300025254 Bacteria 185123
83 Ga0209148_1012825 3300025254 Bacteria 1522
84 Ga0209759_1000063 3300025256 Bacteria 196315
85 Ga0209759_1000967 3300025256 Bacteria 20167
86 Ga0209759_1018372 3300025256 Bacteria 1690
87 Ga0209233_1000010 3300025261 Bacteria 1194329
88 Ga0209233_1000095 3300025261 Bacteria 303783
89 Ga0209233_1000190 3300025261 Bacteria 130713
90 Ga0209233_1020228 3300025261 Bacteria 1750
91 Ga0209455_1000062 3300025272 Bacteria 335169
92 Ga0209025_1000171 3300025294 Bacteria 160478
93 Ga0209025_1064515 3300025294 Bacteria 1344
94 Ga0209758_1002148 3300025297 Bacteria 20744
95 Ga0207656_10219717 3300025321 Bacteria 923
96 Ga0207705_10066970 3300025909 Bacteria 2598
97 Ga0207695_10180054 3300025913 Bacteria 2035
98 Ga0207695_10197854 3300025913 Bacteria 1925
99 Ga0207671_10005211 3300025914 Bacteria 12085
100 Ga0207671_10190043 3300025914 Bacteria 1601
101 Ga0207657_10022181 3300025919 Bacteria 5955
102 Ga0207649_10158228 3300025920 Bacteria 1567
103 Ga0207694_10018088 3300025924 Bacteria 5328
104 Ga0207706_10241935 3300025933 Bacteria 1577
105 Ga0207691_10372555 3300025940 Bacteria 1220
106 Ga0207711_10651831 3300025941 Bacteria 982
107 Ga0207679_10536992 3300025945 Bacteria 1048
108 Ga0207667_10378907 3300025949 Bacteria 1441
109 Ga0207639_10036283 3300026041 Bacteria 3652
110 Ga0207639_10219113 3300026041 Bacteria 1643
111 Ga0207678_10073386 3300026067 Bacteria 2932
112 Ga0207678_10123373 3300026067 Bacteria 2211
113 Ga0207702_10266502 3300026078 Bacteria 1614
114 Ga0207674_10382490 3300026116 Bacteria 1361
115 Ga0207683_10047918 3300026121 Bacteria 3742
116 Ga0207698_10446704 3300026142 Bacteria 1247
117 Ga0209371_1006202 3300027312 Bacteria 4499
118 Ga0209813_10103472 3300027866 Bacteria 972
119 Ga0268266_10136062 3300028379 Bacteria 2201
120 Ga0268264_10237633 3300028381 Bacteria 1686
121 Ga0268264_10314136 3300028381 Bacteria 1479
122 Ga0307515_10106195 3300028794 Bacteria 3333
123 Ga0307515_10248866 3300028794 Bacteria 1534
124 Ga0268256_1018823 3300030500 Bacteria 1907
125 Ga0265332_10000812 3300031238 Bacteria 18981
126 Ga0265325_10102433 3300031241 Bacteria 1400
127 Ga0265329_10010061 3300031242 Bacteria 3493
128 Ga0265340_10002134 3300031247 Bacteria 11343
129 Ga0265339_10000669 3300031249 Bacteria 26471
130 Ga0316575_10013371 3300031665 Bacteria 3066
131 Ga0265314_10060216 3300031711 Bacteria 2592
132 Ga0265342_10000281 3300031712 Bacteria 57398
133 Ga0307405_10232660 3300031731 Bacteria 1359
134 Ga0316577_10182744 3300031733 Bacteria 1185
135 Ga0307412_10211172 3300031911 Bacteria 1481
136 Ga0307414_10728356 3300032004 Bacteria 900
137 Ga0316574_0665552 3300035398 Bacteria 640
138 Ga0316582_0077517 3300036647 Bacteria 2163
139 Ga0316584_0143495 3300036712 Bacteria 1780
140 Ga0395900_0060345 3300037418 Bacteria 3903
141 Ga0395900_0180139 3300037418 Bacteria 2148
142 Ga0395898_0148089 3300037466 Bacteria 2247
143 Ga0395898_0200625 3300037466 Bacteria 1905
144 Ga0395905_0000571 3300037471 Bacteria 49947
145 Ga0395905_0121483 3300037471 Bacteria 2455
146 Ga0395905_0354971 3300037471 Bacteria 1358
147 Ga0395901_0050510 3300038443 Bacteria 4320
148 Ga0395901_0084599 3300038443 Bacteria 3315
149 Ga0395901_0122639 3300038443 Bacteria 2731
150 Ga0395901_0457824 3300038443 Bacteria 1304
151 Ga0439436_0020916 3300041404 Bacteria 1947
152 Ga0439438_021938 3300041405 Bacteria 1776
153 Ga0439466_0060014 3300041411 Bacteria 1227
154 Ga0439465_0011896 3300041413 Bacteria 2726
155 Ga0439465_0029198 3300041413 Bacteria 1751
156 Ga0439465_0045500 3300041413 Bacteria 1427
157 Ga0451839_1523640 3300041496 Bacteria 1136
158 Ga0439449_0068501 3300042007 Bacteria 1308
159 Ga0450918_000589 3300042531 Bacteria 7769
160 Ga0466972_0014897 3300044658 Bacteria 3890
161 Ga0466965_0202471 3300044683 Bacteria 1053
162 Ga0466968_0108850 3300044735 Bacteria 1244
163 Ga0466960_0048051 3300044901 Bacteria 2049
164 Ga0495617_064670 3300046452 Bacteria 1206
165 Ga0495638_0002105 3300046460 Bacteria 16833
166 Ga0495638_0340073 3300046460 Bacteria 796
167 Ga0495605_0002723 3300046474 Bacteria 10784
168 Ga0495584_0060298 3300046491 Bacteria 1908
169 Ga0495585_0002932 3300046492 Bacteria 11806
170 Ga0495607_0072870 3300046501 Bacteria 1911
171 Ga0495583_0023705 3300046506 Bacteria 3099
172 Ga0495606_0001738 3300046507 Bacteria 27981
173 Ga0495610_0092740 3300046512 Bacteria 1366
174 Ga0495616_0016658 3300046513 Bacteria 4063
175 Ga0495631_0001191 3300046518 Bacteria 16052
176 Ga0495632_0071437 3300046519 Bacteria 1667
177 Ga0495643_0044317 3300046522 Bacteria 2418
178 Ga0495643_0151563 3300046522 Bacteria 1148
179 Ga0495609_0031187 3300046538 Bacteria 2424
180 Ga0495668_0004532 3300046616 Bacteria 9808
181 Ga0495611_0003117 3300046648 Bacteria 7356
182 Ga0495625_0001431 3300046660 Bacteria 29079
183 Ga0495625_0075395 3300046660 Bacteria 2360
184 Ga0495625_0322430 3300046660 Bacteria 983
185 Ga0495625_0381806 3300046660 Bacteria 884
186 Ga0495659_0191693 3300046664 Bacteria 836
187 Ga0495670_0045882 3300046691 Bacteria 2182
188 Ga0495670_0083223 3300046691 Bacteria 1632
189 Ga0495676_0235247 3300047321 Bacteria 1257
190 Ga0495687_045363 3300047443 Bacteria 1904
191 Ga0495686_0001869 3300047472 Bacteria 21081
192 Ga0495686_0026006 3300047472 Bacteria 3831
193 Ga0495686_0098967 3300047472 Bacteria 1761
194 Ga0495626_0037683 3300048091 Bacteria 2296
195 Ga0496102_0210151 3300048905 Bacteria 1835
196 Ga0496103_0028131 3300048906 Bacteria 3410
197 Ga0496106_0183069 3300048909 Bacteria 1664
198 Ga0496108_0438728 3300048911 Bacteria 1141
199 Ga0496111_0076747 3300048914 Bacteria 2436
200 Ga0496112_0000934 3300048915 Bacteria 21168
201 Ga0496112_0540667 3300048915 Bacteria 1099
202 Ga0496114_0303842 3300048917 Bacteria 1409
203 Ga0496117_0008082 3300048920 Bacteria 10078
204 Ga0496118_0160538 3300048921 Bacteria 1391
205 Ga0496119_0026280 3300048922 Bacteria 4040
206 Ga0496120_0005103 3300048923 Bacteria 10619
207 Ga0496120_0034090 3300048923 Bacteria 3054
208 Ga0496121_0273364 3300048924 Bacteria 1160
209 Ga0496122_0000157 3300048925 Bacteria 159733
210 Ga0496122_0000464 3300048925 Bacteria 84473
211 Ga0496122_0094199 3300048925 Bacteria 2028
212 Ga0496123_0000048 3300048926 Bacteria 244152
213 Ga0496123_0000147 3300048926 Bacteria 143834
214 Ga0496123_0027908 3300048926 Bacteria 4191
215 Ga0496123_0056987 3300048926 Bacteria 2548
216 Ga0496124_0024702 3300048927 Bacteria 5458
217 Ga0496124_0045206 3300048927 Bacteria 3776
218 Ga0496124_0289853 3300048927 Bacteria 1189
219 Ga0496125_0002199 3300048928 Bacteria 26028
220 Ga0496126_0000601 3300048929 Bacteria 67983
221 Ga0496126_0071957 3300048929 Bacteria 3077
222 Ga0495678_013474 3300049459 Bacteria 3838
223 Ga0501031_0093723 3300049568 Bacteria 1960
224 Ga0501031_0163016 3300049568 Bacteria 1457
225 Ga0501032_0000024 3300049569 Bacteria 143876
226 Ga0501032_0092296 3300049569 Bacteria 2009
227 Ga0501032_0131298 3300049569 Bacteria 1652
228 Ga0501033_0000391 3300049570 Bacteria 42136
229 Ga0501033_0000706 3300049570 Bacteria 30703
230 Ga0501033_0039290 3300049570 Bacteria 3534
231 Ga0501033_0044635 3300049570 Bacteria 3299
232 Ga0501033_0198795 3300049570 Bacteria 1432
233 Ga0501033_0259804 3300049570 Bacteria 1229
234 Ga0501033_0266691 3300049570 Bacteria 1211
235 Ga0501034_0000140 3300049571 Bacteria 134996
236 Ga0501034_0243879 3300049571 Bacteria 1742
237 Ga0501034_0394499 3300049571 Bacteria 1307
238 Ga0501036_0000443 3300049572 Bacteria 29542
239 Ga0501036_0111272 3300049572 Bacteria 2314
240 Ga0501037_0000024 3300049573 Bacteria 146046
241 Ga0501037_0000818 3300049573 Bacteria 23265
242 Ga0501037_0261727 3300049573 Bacteria 1208
243 Ga0501038_0000064 3300049574 Bacteria 87975
244 Ga0501038_0172247 3300049574 Bacteria 1751
245 Ga0501039_0000017 3300049575 Bacteria 189412
246 Ga0501043_0000050 3300049579 Bacteria 107465
247 Ga0501043_0000124 3300049579 Bacteria 70977
248 Ga0501043_0015255 3300049579 Bacteria 6018
249 Ga0501043_0038992 3300049579 Bacteria 3734
250 Ga0501046_0106305 3300049580 Bacteria 2148
251 Ga0501047_0023841 3300049581 Bacteria 5876
252 Ga0501047_0084213 3300049581 Bacteria 3056
253 Ga0501047_0192172 3300049581 Bacteria 1904
254 Ga0501047_0240005 3300049581 Bacteria 1663
255 Ga0501047_0562563 3300049581 Bacteria 964
256 Ga0501069_0000004 3300049585 Bacteria 192353
257 Ga0501069_0006462 3300049585 Bacteria 6130
258 Ga0501069_0047173 3300049585 Bacteria 2391
259 Ga0501069_0509828 3300049585 Bacteria 718
260 Ga0501070_0000694 3300049586 Bacteria 30882
261 Ga0501070_0003303 3300049586 Bacteria 14003
262 Ga0501070_0009617 3300049586 Bacteria 8168
263 Ga0501070_0017227 3300049586 Bacteria 6066
264 Ga0501070_0152100 3300049586 Bacteria 1909
265 Ga0501070_0460682 3300049586 Bacteria 1024
266 Ga0501070_0512911 3300049586 Bacteria 962
267 Ga0501071_0031139 3300049587 Bacteria 3779
268 Ga0501074_0000006 3300049590 Bacteria 112293
269 Ga0501074_0203351 3300049590 Bacteria 1411
270 Ga0501080_0002140 3300049742 Bacteria 17165
271 Ga0501080_0060928 3300049742 Bacteria 3513
272 Ga0501080_0081311 3300049742 Bacteria 3010
273 Ga0501080_0161650 3300049742 Bacteria 2068
274 Ga0501080_0198917 3300049742 Bacteria 1840
275 Ga0501083_0029607 3300049744 Bacteria 3763
276 Ga0501083_0260485 3300049744 Bacteria 1128
277 Ga0501035_0000011 3300049822 Bacteria 305794
278 Ga0501035_0000021 3300049822 Bacteria 209085
279 Ga0501035_0004020 3300049822 Bacteria 14026
280 Ga0501035_0008048 3300049822 Bacteria 9825
281 Ga0501035_0010776 3300049822 Bacteria 8465
282 Ga0501035_0012639 3300049822 Bacteria 7800
283 Ga0501035_0043924 3300049822 Bacteria 4026
284 Ga0501035_0107362 3300049822 Bacteria 2447
285 Ga0501044_0000333 3300049823 Bacteria 59546
286 Ga0501044_0007374 3300049823 Bacteria 12095
287 Ga0501044_0028642 3300049823 Bacteria 5878
288 Ga0501044_0031157 3300049823 Bacteria 5615
289 Ga0501044_0057928 3300049823 Bacteria 3974
290 Ga0501044_0058093 3300049823 Bacteria 3968
291 Ga0501044_0146513 3300049823 Bacteria 2346
292 Ga0501044_0150901 3300049823 Bacteria 2306
293 Ga0501044_0337676 3300049823 Bacteria 1428
294 Ga0501044_0455601 3300049823 Bacteria 1185
295 Ga0501044_0659480 3300049823 Bacteria 935
296 Ga0501044_0900578 3300049823 Bacteria 759
297 Ga0501045_0136342 3300049824 Bacteria 1825
298 nmdc:mga03n38_60933_c1 3300050490 Bacteria 1717
299 nmdc:mga03n38_80755_c1 3300050490 Bacteria 1528
300 nmdc:mga00v17_139190_c1 3300050491 Bacteria 1555
301 nmdc:mga00v17_21857_c1 3300050491 Bacteria 3683
302 nmdc:mga0yw44_141990_c1 3300050492 Bacteria 1561
303 nmdc:mga0yw44_518289_c1 3300050492 Bacteria 809
304 nmdc:mga0yw44_59754_c1 3300050492 Bacteria 2333
305 nmdc:mga0k408_44510_c1 3300050493 Bacteria 2560
306 nmdc:mga06z11_132299_c1 3300050494 Bacteria 1402
307 nmdc:mga06z11_185748_c1 3300050494 Bacteria 1201
308 nmdc:mga06z11_392210_c1 3300050494 Bacteria 835
309 nmdc:mga06z11_61810_c1 3300050494 Bacteria 1955
310 nmdc:mga07m45_45176_c1 3300050496 Bacteria 2473
311 Ga0500610_0021918 3300053079 Bacteria 3143
312 Ga0500610_0060594 3300053079 Bacteria 1975
313 Ga0500569_003913 3300053109 Bacteria 3088
314 Ga0500594_0007875 3300053118 Bacteria 2417
315 Ga0500608_006715 3300053122 Bacteria 4709
316 Ga0500618_000143 3300053125 Bacteria 59383
317 Ga0500618_029205 3300053125 Bacteria 1301
318 Ga0500568_0002244 3300053139 Bacteria 11561
319 Ga0500620_000224 3300053155 Bacteria 11256
320 Ga0500627_0042568 3300053158 Bacteria 1955
321 Ga0500627_0129270 3300053158 Bacteria 1141
322 Ga0500627_0133550 3300053158 Bacteria 1121
323 Ga0500636_0000003 3300053177 Bacteria 240189
324 Ga0501082_0061970 3300060353 Bacteria 3219
325 Ga0501082_0170542 3300060353 Bacteria 1892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2968138860 2968139394 190
2 iso_pu_bacteria 2965062239 2965065159 192
3 iso_pu_bacteria 2937861824 2937863254 193
4 iso_pu_bacteria 8004361976 8004362572 193
5 iso_pu_bacteria 2965032056 2965037371 195
6 3300025933 Ga0207706_10241935 Ga0207706_102419352 196
7 3300006186 Ga0075369_10062789 Ga0075369_100627892 197
8 3300006042 Ga0075368_10094793 Ga0075368_100947932 198
9 3300006048 Ga0075363_100126555 Ga0075363_1001265552 198
10 3300006051 Ga0075364_10141861 Ga0075364_101418612 198
11 3300006178 Ga0075367_10158860 Ga0075367_101588602 198
12 3300006195 Ga0075366_10048177 Ga0075366_100481772 198
13 3300006353 Ga0075370_10035040 Ga0075370_100350402 198
14 3300027866 Ga0209813_10103472 Ga0209813_101034721 198
15 3300037418 Ga0395900_0180139 Ga0395900_0180139_717_1328 198
16 3300050490 nmdc:mga03n38_60933_c1 nmdc:mga03n38_60933_c1_555_1160 198
17 3300050491 nmdc:mga00v17_21857_c1 nmdc:mga00v17_21857_c1_1471_2076 198
18 3300050493 nmdc:mga0k408_44510_c1 nmdc:mga0k408_44510_c1_599_1204 198
19 3300050496 nmdc:mga07m45_45176_c1 nmdc:mga07m45_45176_c1_1549_2154 198
20 3300025919 Ga0207657_10022181 Ga0207657_100221816 199
21 3300031238 Ga0265332_10000812 Ga0265332_100008125 199
22 3300031241 Ga0265325_10102433 Ga0265325_101024332 199
23 3300031242 Ga0265329_10010061 Ga0265329_100100612 199
24 3300031247 Ga0265340_10002134 Ga0265340_100021348 199
25 3300031249 Ga0265339_10000669 Ga0265339_1000066929 199
26 3300031711 Ga0265314_10060216 Ga0265314_100602163 199
27 3300031712 Ga0265342_10000281 Ga0265342_1000028111 199
28 3300050492 nmdc:mga0yw44_518289_c1 nmdc:mga0yw44_518289_c1_115_786 199
29 3300035398 Ga0316574_0665552 Ga0316574_0665552_17_622 200
30 3300049570 Ga0501033_0044635 Ga0501033_0044635_1240_1860 200
31 3300049572 Ga0501036_0111272 Ga0501036_0111272_238_858 200
32 3300049586 Ga0501070_0512911 Ga0501070_0512911_297_917 200
33 3300049823 Ga0501044_0031157 Ga0501044_0031157_1011_1631 200
34 3300005339 Ga0070660_100237582 Ga0070660_1002375822 201
35 3300005455 Ga0070663_100076203 Ga0070663_1000762032 201
36 3300005563 Ga0068855_100274319 Ga0068855_1002743192 201
37 3300006038 Ga0075365_10086838 Ga0075365_100868382 201
38 3300006048 Ga0075363_100128426 Ga0075363_1001284262 201
39 3300009174 Ga0105241_10226264 Ga0105241_102262642 201
40 3300025321 Ga0207656_10219717 Ga0207656_102197171 201
41 3300025909 Ga0207705_10066970 Ga0207705_100669703 201
42 3300025914 Ga0207671_10190043 Ga0207671_101900432 201
43 3300025920 Ga0207649_10158228 Ga0207649_101582282 201
44 3300025945 Ga0207679_10536992 Ga0207679_105369921 201
45 3300025949 Ga0207667_10378907 Ga0207667_103789072 201
46 3300026041 Ga0207639_10219113 Ga0207639_102191132 201
47 3300026067 Ga0207678_10073386 Ga0207678_100733862 201
48 3300026078 Ga0207702_10266502 Ga0207702_102665022 201
49 3300026116 Ga0207674_10382490 Ga0207674_103824902 201
50 3300026142 Ga0207698_10446704 Ga0207698_104467042 201
51 3300028381 Ga0268264_10314136 Ga0268264_103141362 201
52 3300046664 Ga0495659_0191693 Ga0495659_0191693_138_800 201
53 3300048917 Ga0496114_0303842 Ga0496114_0303842_231_953 201
54 3300050494 nmdc:mga06z11_132299_c1 nmdc:mga06z11_132299_c1_258_980 201
55 3300038443 Ga0395901_0457824 Ga0395901_0457824_23_676 204
56 3300046491 Ga0495584_0060298 Ga0495584_0060298_1243_1890 204
57 3300046519 Ga0495632_0071437 Ga0495632_0071437_1000_1647 204
58 3300049585 Ga0501069_0509828 Ga0501069_0509828_35_697 204
59 3300046460 Ga0495638_0340073 Ga0495638_0340073_29_700 205
60 3300049579 Ga0501043_0015255 Ga0501043_0015255_1612_2337 205
61 3300049586 Ga0501070_0152100 Ga0501070_0152100_31_756 205
62 3300049742 Ga0501080_0198917 Ga0501080_0198917_916_1641 205
63 3300049822 Ga0501035_0107362 Ga0501035_0107362_67_792 205
64 3300031911 Ga0307412_10211172 Ga0307412_102111722 209
65 3300032004 Ga0307414_10728356 Ga0307414_107283561 209
66 iso_pu_bacteria 2979764755 2979767269 210
67 3300049569 Ga0501032_0092296 Ga0501032_0092296_628_1353 211
68 3300049570 Ga0501033_0259804 Ga0501033_0259804_30_755 211
69 3300049744 Ga0501083_0260485 Ga0501083_0260485_172_897 211
70 3300049823 Ga0501044_0058093 Ga0501044_0058093_2911_3636 211
71 iso_pu_bacteria 2844002411 2844008292 211
72 3300025261 Ga0209233_1020228 Ga0209233_10202282 212
73 3300046460 Ga0495638_0002105 Ga0495638_0002105_15173_15922 212
74 3300049569 Ga0501032_0131298 Ga0501032_0131298_258_986 213
75 3300049570 Ga0501033_0000706 Ga0501033_0000706_27897_28625 213
76 3300049822 Ga0501035_0010776 Ga0501035_0010776_6496_7224 213
77 3300048911 Ga0496108_0438728 Ga0496108_0438728_344_1066 214
78 3300048914 Ga0496111_0076747 Ga0496111_0076747_486_1208 214
79 iso_pu_bacteria 2979772303 2979777494 214
80 3300025294 Ga0209025_1064515 Ga0209025_10645152 216
81 3300041404 Ga0439436_0020916 Ga0439436_0020916_148_861 216
82 3300041411 Ga0439466_0060014 Ga0439466_0060014_131_844 216
83 3300041413 Ga0439465_0011896 Ga0439465_0011896_1765_2478 216
84 3300042007 Ga0439449_0068501 Ga0439449_0068501_163_876 216
85 3300046660 Ga0495625_0075395 Ga0495625_0075395_1167_1907 216
86 3300049574 Ga0501038_0172247 Ga0501038_0172247_1000_1731 216
87 3300049581 Ga0501047_0023841 Ga0501047_0023841_2948_3679 216
88 3300049585 Ga0501069_0006462 Ga0501069_0006462_4417_5148 216
89 3300049586 Ga0501070_0003303 Ga0501070_0003303_7586_8317 216
90 3300049590 Ga0501074_0203351 Ga0501074_0203351_175_906 216
91 3300049742 Ga0501080_0161650 Ga0501080_0161650_1278_2009 216
92 3300049822 Ga0501035_0004020 Ga0501035_0004020_5646_6377 216
93 iso_pu_bacteria 2878788777 2878789972 216
94 3300041405 Ga0439438_021938 Ga0439438_021938_130_870 217
95 3300046522 Ga0495643_0044317 Ga0495643_0044317_1021_1761 217
96 3300047321 Ga0495676_0235247 Ga0495676_0235247_448_1173 217
97 3300053158 Ga0500627_0133550 Ga0500627_0133550_27_740 217
98 iso_pu_bacteria 2903513507 2903514518 217
99 iso_pu_bacteria 2958144490 2958148896 217
100 3300006048 Ga0075363_100034053 Ga0075363_1000340533 218
101 3300009553 Ga0105249_10882235 Ga0105249_108822352 218
102 3300050490 nmdc:mga03n38_80755_c1 nmdc:mga03n38_80755_c1_721_1461 218
103 3300050491 nmdc:mga00v17_139190_c1 nmdc:mga00v17_139190_c1_494_1234 218
104 3300013104 Ga0157370_10041153 Ga0157370_100411532 219
105 3300005262 Ga0065165_1008292 Ga0065165_10082921 220
106 3300042531 Ga0450918_000589 Ga0450918_000589_461_1174 220
107 iso_pu_bacteria 2757320392 2757571631 220
108 iso_pu_bacteria 3004239961 3004246838 220
109 iso_pu_bacteria 2767802442 2770196935 221
110 iso_pu_bacteria 2869162929 2869163995 221
111 iso_pu_bacteria 2937843397 2937844323 221
112 iso_pu_bacteria 8004395343 8004399131 221
113 3300006038 Ga0075365_10127473 Ga0075365_101274732 222
114 3300009545 Ga0105237_10019531 Ga0105237_100195312 222
115 3300009551 Ga0105238_10046229 Ga0105238_100462295 222
116 3300025914 Ga0207671_10005211 Ga0207671_1000521113 222
117 3300025924 Ga0207694_10018088 Ga0207694_100180884 222
118 3300026041 Ga0207639_10036283 Ga0207639_100362833 222
119 3300031733 Ga0316577_10182744 Ga0316577_101827442 222
120 3300036647 Ga0316582_0077517 Ga0316582_0077517_453_1178 222
121 3300037418 Ga0395900_0060345 Ga0395900_0060345_2467_3189 222
122 3300037466 Ga0395898_0148089 Ga0395898_0148089_810_1532 222
123 3300037466 Ga0395898_0200625 Ga0395898_0200625_1172_1894 222
124 3300037471 Ga0395905_0121483 Ga0395905_0121483_566_1288 222
125 3300038443 Ga0395901_0050510 Ga0395901_0050510_2425_3147 222
126 3300038443 Ga0395901_0122639 Ga0395901_0122639_1112_1834 222
127 3300048915 Ga0496112_0540667 Ga0496112_0540667_54_776 222
128 3300049823 Ga0501044_0659480 Ga0501044_0659480_37_759 222
129 3300050492 nmdc:mga0yw44_141990_c1 nmdc:mga0yw44_141990_c1_403_1146 222
130 3300050492 nmdc:mga0yw44_59754_c1 nmdc:mga0yw44_59754_c1_119_859 222
131 3300053158 Ga0500627_0042568 Ga0500627_0042568_780_1523 222
132 iso_pu_bacteria 2511231027 2511390126 222
133 iso_pu_bacteria 2842871566 2842872116 222
134 iso_pu_bacteria 2928521798 2928524047 222
135 iso_pu_bacteria 2954011201 2954012992 222
136 3300009093 Ga0105240_10254206 Ga0105240_102542063 223
137 3300014326 Ga0157380_10936371 Ga0157380_109363711 223
138 3300025913 Ga0207695_10197854 Ga0207695_101978542 223
139 3300031665 Ga0316575_10013371 Ga0316575_100133713 223
140 3300037471 Ga0395905_0354971 Ga0395905_0354971_235_957 223
141 3300038443 Ga0395901_0084599 Ga0395901_0084599_1973_2695 223
142 3300048905 Ga0496102_0210151 Ga0496102_0210151_1069_1791 223
143 3300049581 Ga0501047_0084213 Ga0501047_0084213_1332_2051 223
144 3300049824 Ga0501045_0136342 Ga0501045_0136342_434_1153 223
145 iso_pu_bacteria 2512875024 2512960326 223
146 iso_pu_bacteria 2513237164 2514034568 223
147 iso_pu_bacteria 2599185301 2599936212 223
148 iso_pu_bacteria 2693429783 2694632379 223
149 iso_pu_bacteria 2693429784 2694640379 223
150 iso_pu_bacteria 2791355123 2792751976 223
151 iso_pu_bacteria 2841734538 2841738317 223
152 iso_pu_bacteria 2847686936 2847691396 223
153 iso_pu_bacteria 2856364286 2856368273 223
154 iso_pu_bacteria 2857349434 2857351535 223
155 iso_pu_bacteria 2869285874 2869290108 223
156 iso_pu_bacteria 2871429161 2871432392 223
157 iso_pu_bacteria 2871495908 2871502525 223
158 iso_pu_bacteria 2874146452 2874152356 223
159 iso_pu_bacteria 2874155637 2874159759 223
160 iso_pu_bacteria 2876392853 2876393942 223
161 iso_pu_bacteria 2876413966 2876418275 223
162 iso_pu_bacteria 2878745973 2878750005 223
163 iso_pu_bacteria 2878760144 2878766417 223
164 iso_pu_bacteria 2878767105 2878773613 223
165 iso_pu_bacteria 2881161766 2881167056 223
166 iso_pu_bacteria 2885305155 2885308566 223
167 iso_pu_bacteria 2885326080 2885327529 223
168 iso_pu_bacteria 2885334103 2885334581 223
169 iso_pu_bacteria 2888350351 2888355372 223
170 iso_pu_bacteria 2889010040 2889010352 223
171 iso_pu_bacteria 2889016732 2889017985 223
172 iso_pu_bacteria 2903492973 2903504406 223
173 iso_pu_bacteria 2903540706 2903547566 223
174 iso_pu_bacteria 2904659560 2904660273 223
175 iso_pu_bacteria 2906308376 2906312364 223
176 iso_pu_bacteria 2906321335 2906325073 223
177 iso_pu_bacteria 2906328253 2906330421 223
178 iso_pu_bacteria 2922130491 2922137778 223
179 iso_pu_bacteria 2922158528 2922159299 223
180 iso_pu_bacteria 2922185730 2922186722 223
181 iso_pu_bacteria 2924726620 2924732797 223
182 iso_pu_bacteria 2937813078 2937819494 223
183 iso_pu_bacteria 2937836603 2937842407 223
184 iso_pu_bacteria 2937994558 2938001441 223
185 iso_pu_bacteria 2938014810 2938015757 223
186 iso_pu_bacteria 2958071322 2958076543 223
187 iso_pu_bacteria 2958100919 2958106587 223
188 iso_pu_bacteria 2958115193 2958116456 223
189 iso_pu_bacteria 2958130278 2958134495 223
190 iso_pu_bacteria 2958165035 2958171595 223
191 iso_pu_bacteria 2958172287 2958176319 223
192 iso_pu_bacteria 2958179912 2958180976 223
193 iso_pu_bacteria 2961077736 2961078813 223
194 iso_pu_bacteria 2961114664 2961115597 223
195 iso_pu_bacteria 2961163497 2961170036 223
196 iso_pu_bacteria 2965018300 2965024787 223
197 iso_pu_bacteria 2965119406 2965127302 223
198 iso_pu_bacteria 2968091066 2968095034 223
199 iso_pu_bacteria 2968097103 2968103248 223
200 iso_pu_bacteria 2968110612 2968111330 223
201 iso_pu_bacteria 2968128360 2968130592 223
202 iso_pu_bacteria 2968171901 2968178428 223
203 iso_pu_bacteria 2970554993 2970561273 223
204 iso_pu_bacteria 2977843712 2977848152 223
205 iso_pu_bacteria 2977858184 2977858786 223
206 iso_pu_bacteria 2977864932 2977869050 223
207 iso_pu_bacteria 2977942078 2977944520 223
208 iso_pu_bacteria 2977971508 2977979139 223
209 iso_pu_bacteria 2979710463 2979711197 223
210 iso_pu_bacteria 2979742915 2979744144 223
211 iso_pu_bacteria 2979779861 2979786217 223
212 iso_pu_bacteria 2987636660 2987638719 223
213 iso_pu_bacteria 2987659509 2987666277 223
214 iso_pu_bacteria 2996336353 2996339880 223
215 iso_pu_bacteria 2996341866 2996343722 223
216 iso_pu_bacteria 3004188549 3004195283 223
217 iso_pu_bacteria 3004203850 3004205038 223
218 iso_pu_bacteria 3004334049 3004335449 223
219 iso_pu_bacteria 8004387939 8004392313 223
220 iso_pu_bacteria 8004445564 8004449184 223
221 iso_pu_bacteria 8004633249 8004639079 223
222 iso_pu_bacteria 8004703790 8004708854 223
223 iso_pu_bacteria 8004714634 8004718623 223
224 iso_pu_bacteria 8054460903 8054463100 223
225 3300046512 Ga0495610_0092740 Ga0495610_0092740_291_1019 224
226 3300046660 Ga0495625_0322430 Ga0495625_0322430_190_918 224
227 3300047472 Ga0495686_0098967 Ga0495686_0098967_300_1028 224
228 3300049568 Ga0501031_0093723 Ga0501031_0093723_815_1537 224
229 3300049823 Ga0501044_0455601 Ga0501044_0455601_274_996 224
230 3300053125 Ga0500618_000143 Ga0500618_000143_23841_24569 224
231 iso_pu_bacteria 2508501123 2509115055 224
232 iso_pu_bacteria 2508501127 2509139537 224
233 iso_pu_bacteria 2509276018 2509373810 224
234 iso_pu_bacteria 2510065059 2510314145 224
235 iso_pu_bacteria 2512875016 2512932321 224
236 iso_pu_bacteria 2513237090 2513614262 224
237 iso_pu_bacteria 2513237305 2514419445 224
238 iso_pu_bacteria 2534681786 2535485222 224
239 iso_pu_bacteria 2588253730 2588518388 224
240 iso_pu_bacteria 2597489875 2597812311 224
241 iso_pu_bacteria 2643221595 2643985556 224
242 iso_pu_bacteria 2643221627 2644158304 224
243 iso_pu_bacteria 2687453392 2688597484 224
244 iso_pu_bacteria 2721755686 2723574707 224
245 iso_pu_bacteria 2751185800 2753359873 224
246 iso_pu_bacteria 2756170246 2756671773 224
247 iso_pu_bacteria 2758568016 2758642194 224
248 iso_pu_bacteria 2765235802 2765466546 224
249 iso_pu_bacteria 2775506902 2776270456 224
250 iso_pu_bacteria 2775506904 2776281625 224
251 iso_pu_bacteria 2791355253 2793280140 224
252 iso_pu_bacteria 2791355263 2793339443 224
253 iso_pu_bacteria 2839993093 2839997475 224
254 iso_pu_bacteria 2840764183 2840768949 224
255 iso_pu_bacteria 2847670302 2847675215 224
256 iso_pu_bacteria 2854911287 2854912529 224
257 iso_pu_bacteria 2856314179 2856314976 224
258 iso_pu_bacteria 2856328259 2856329305 224
259 iso_pu_bacteria 2856334872 2856336413 224
260 iso_pu_bacteria 2856342000 2856348410 224
261 iso_pu_bacteria 2856349417 2856352388 224
262 iso_pu_bacteria 2856356410 2856364007 224
263 iso_pu_bacteria 2857367948 2857369300 224
264 iso_pu_bacteria 2869249662 2869249703 224
265 iso_pu_bacteria 2869256925 2869261856 224
266 iso_pu_bacteria 2869264136 2869264992 224
267 iso_pu_bacteria 2869271264 2869275652 224
268 iso_pu_bacteria 2871435913 2871436704 224
269 iso_pu_bacteria 2871459585 2871464082 224
270 iso_pu_bacteria 2871466892 2871469539 224
271 iso_pu_bacteria 2871474448 2871474503 224
272 iso_pu_bacteria 2871488783 2871493014 224
273 iso_pu_bacteria 2874109183 2874110519 224
274 iso_pu_bacteria 2874116593 2874123461 224
275 iso_pu_bacteria 2874123672 2874127007 224
276 iso_pu_bacteria 2874131515 2874138776 224
277 iso_pu_bacteria 2874162495 2874162829 224
278 iso_pu_bacteria 2874168670 2874168917 224
279 iso_pu_bacteria 2876363079 2876367647 224
280 iso_pu_bacteria 2876369609 2876373367 224
281 iso_pu_bacteria 2876386047 2876388207 224
282 iso_pu_bacteria 2876399893 2876404840 224
283 iso_pu_bacteria 2876406927 2876408733 224
284 iso_pu_bacteria 2876420981 2876424266 224
285 iso_pu_bacteria 2878035449 2878042219 224
286 iso_pu_bacteria 2878753008 2878757060 224
287 iso_pu_bacteria 2878774303 2878774825 224
288 iso_pu_bacteria 2878781027 2878782784 224
289 iso_pu_bacteria 2881147464 2881150786 224
290 iso_pu_bacteria 2881155292 2881161325 224
291 iso_pu_bacteria 2881845957 2881847243 224
292 iso_pu_bacteria 2881853255 2881858145 224
293 iso_pu_bacteria 2881861095 2881861489 224
294 iso_pu_bacteria 2882632389 2882640721 224
295 iso_pu_bacteria 2882912400 2882918692 224
296 iso_pu_bacteria 2885312484 2885312657 224
297 iso_pu_bacteria 2885318864 2885321555 224
298 iso_pu_bacteria 2885350715 2885355820 224
299 iso_pu_bacteria 2888337043 2888338551 224
300 iso_pu_bacteria 2888343758 2888346052 224
301 iso_pu_bacteria 2894652903 2894655756 224
302 iso_pu_bacteria 2903448605 2903450425 224
303 iso_pu_bacteria 2903492973 2903500786 224
304 iso_pu_bacteria 2903521522 2903521836 224
305 iso_pu_bacteria 2903528002 2903528213 224
306 iso_pu_bacteria 2904578770 2904582057 224
307 iso_pu_bacteria 2906370794 2906376380 224
308 iso_pu_bacteria 2906378014 2906382383 224
309 iso_pu_bacteria 2906401398 2906405923 224
310 iso_pu_bacteria 2906408224 2906408792 224
311 iso_pu_bacteria 2906414383 2906419620 224
312 iso_pu_bacteria 2915650412 2915653255 224
313 iso_pu_bacteria 2919119836 2919123165 224
314 iso_pu_bacteria 2922151315 2922151477 224
315 iso_pu_bacteria 2922172374 2922173607 224
316 iso_pu_bacteria 2922178524 2922180853 224
317 iso_pu_bacteria 2924710171 2924715399 224
318 iso_pu_bacteria 2924733363 2924737636 224
319 iso_pu_bacteria 2924741084 2924746464 224
320 iso_pu_bacteria 2924748358 2924753332 224
321 iso_pu_bacteria 2924754689 2924762026 224
322 iso_pu_bacteria 2924762789 2924763788 224
323 iso_pu_bacteria 2924784321 2924786363 224
324 iso_pu_bacteria 2937822353 2937829058 224
325 iso_pu_bacteria 2937848649 2937850969 224
326 iso_pu_bacteria 2937980651 2937985051 224
327 iso_pu_bacteria 2958108152 2958115016 224
328 iso_pu_bacteria 2958122699 2958128434 224
329 iso_pu_bacteria 2958158011 2958162145 224
330 iso_pu_bacteria 2961127735 2961129912 224
331 iso_pu_bacteria 2961136820 2961140928 224
332 iso_pu_bacteria 2961170736 2961175612 224
333 iso_pu_bacteria 2961183825 2961187214 224
334 iso_pu_bacteria 2963644680 2963646884 224
335 iso_pu_bacteria 2965025482 2965029724 224
336 iso_pu_bacteria 2965040258 2965040495 224
337 iso_pu_bacteria 2965047637 2965054869 224
338 iso_pu_bacteria 2965089291 2965093348 224
339 iso_pu_bacteria 2965102966 2965104777 224
340 iso_pu_bacteria 2965110997 2965117005 224
341 iso_pu_bacteria 2967996073 2967999332 224
342 iso_pu_bacteria 2968003550 2968007744 224
343 iso_pu_bacteria 2968083720 2968088315 224
344 iso_pu_bacteria 2970489779 2970494903 224
345 iso_pu_bacteria 2970503327 2970508200 224
346 iso_pu_bacteria 2970510686 2970511476 224
347 iso_pu_bacteria 2970524798 2970527575 224
348 iso_pu_bacteria 2970532167 2970538977 224
349 iso_pu_bacteria 2970540015 2970543496 224
350 iso_pu_bacteria 2970547951 2970554198 224
351 iso_pu_bacteria 2970619444 2970624397 224
352 iso_pu_bacteria 2970627176 2970628409 224
353 iso_pu_bacteria 2977821940 2977826219 224
354 iso_pu_bacteria 2977851361 2977853716 224
355 iso_pu_bacteria 2977872689 2977878089 224
356 iso_pu_bacteria 2977898635 2977900320 224
357 iso_pu_bacteria 2977907340 2977910980 224
358 iso_pu_bacteria 2977915119 2977918224 224
359 iso_pu_bacteria 2977922695 2977923651 224
360 iso_pu_bacteria 2977935797 2977936514 224
361 iso_pu_bacteria 2977950692 2977950893 224
362 iso_pu_bacteria 2977986579 2977990444 224
363 iso_pu_bacteria 2979793036 2979796085 224
364 iso_pu_bacteria 2979808191 2979813384 224
365 iso_pu_bacteria 2987645492 2987648993 224
366 iso_pu_bacteria 2987666974 2987672331 224
367 iso_pu_bacteria 2987673487 2987677918 224
368 iso_pu_bacteria 2996310559 2996314411 224
369 iso_pu_bacteria 2996386984 2996390273 224
370 iso_pu_bacteria 3002141150 3002144938 224
371 iso_pu_bacteria 3004195979 3004201605 224
372 iso_pu_bacteria 3004211236 3004215291 224
373 iso_pu_bacteria 3004218560 3004225866 224
374 iso_pu_bacteria 3004232784 3004236661 224
375 iso_pu_bacteria 3004248173 3004249854 224
376 iso_pu_bacteria 3004268573 3004275528 224
377 iso_pu_bacteria 637000159 637075420 224
378 iso_pu_bacteria 649633066 649872033 224
379 iso_pu_bacteria 8004300914 8004301102 224
380 iso_pu_bacteria 8004312739 8004317679 224
381 iso_pu_bacteria 8004374579 8004378635 224
382 iso_pu_bacteria 8004695233 8004697285 224
383 iso_pu_bacteria 8004727605 8004728992 224
384 iso_pu_bacteria 8055617313 8055619780 224
385 3300046691 Ga0495670_0083223 Ga0495670_0083223_513_1226 225
386 3300053122 Ga0500608_006715 Ga0500608_006715_1305_2021 225
387 iso_pu_bacteria 2513237159 2513997723 225
388 iso_pu_bacteria 2582581283 2585167403 225
389 iso_pu_bacteria 2582581306 2585265626 225
390 iso_pu_bacteria 2582581865 2585388831 225
391 iso_pu_bacteria 2582581866 2585395468 225
392 iso_pu_bacteria 2599185156 2599331979 225
393 iso_pu_bacteria 2615840698 2616554412 225
394 iso_pu_bacteria 2643221607 2644050274 225
395 iso_pu_bacteria 2643221636 2644204664 225
396 iso_pu_bacteria 2643221637 2644208826 225
397 iso_pu_bacteria 2643221686 2644483194 225
398 iso_pu_bacteria 2643221688 2644494344 225
399 iso_pu_bacteria 2643221689 2644499752 225
400 iso_pu_bacteria 2643221718 2644652356 225
401 iso_pu_bacteria 2667528174 2671111266 225
402 iso_pu_bacteria 2775507266 2778175593 225
403 iso_pu_bacteria 2818991448 2819609302 225
404 iso_pu_bacteria 2838029111 2838033713 225
405 iso_pu_bacteria 2842475841 2842480460 225
406 iso_pu_bacteria 2842502639 2842505319 225
407 iso_pu_bacteria 2842521101 2842522029 225
408 iso_pu_bacteria 2842922631 2842924315 225
409 iso_pu_bacteria 2891373044 2891373530 225
410 iso_pu_bacteria 2919408235 2919410165 225
411 iso_pu_bacteria 2920760137 2920761347 225
412 iso_pu_bacteria 2989349275 2989350002 225
413 iso_pu_bacteria 2995392953 2995396924 225
414 iso_pu_bacteria 3000135777 3000139853 225
415 iso_pu_bacteria 3003930520 3003934405 225
416 iso_pu_bacteria 8005645114 8005646112 225
417 iso_pu_bacteria 8005682033 8005682726 225
418 iso_pu_bacteria 8018150411 8018152792 225
419 3300003203 JGI25406J46586_10018009 JGI25406J46586_100180093 226
420 3300036712 Ga0316584_0143495 Ga0316584_0143495_238_957 226
421 3300037471 Ga0395905_0000571 Ga0395905_0000571_16089_16799 226
422 3300001989 JGI24739J22299_10009537 JGI24739J22299_100095372 227
423 3300002741 JGI25157J39369_1001353 JGI25157J39369_10013534 227
424 3300003214 JGI25165J46597_1000006 JGI25165J46597_1000006334 227
425 3300005366 Ga0070659_100250094 Ga0070659_1002500942 227
426 3300005455 Ga0070663_100049284 Ga0070663_1000492842 227
427 3300005539 Ga0068853_100156133 Ga0068853_1001561333 227
428 3300005548 Ga0070665_100280373 Ga0070665_1002803732 227
429 3300005563 Ga0068855_100508968 Ga0068855_1005089682 227
430 3300005614 Ga0068856_100328231 Ga0068856_1003282312 227
431 3300005616 Ga0068852_100485212 Ga0068852_1004852121 227
432 3300006177 Ga0075362_10057229 Ga0075362_100572292 227
433 3300009093 Ga0105240_10080882 Ga0105240_100808822 227
434 3300009177 Ga0105248_10373498 Ga0105248_103734981 227
435 3300010375 Ga0105239_10046241 Ga0105239_100462414 227
436 3300010375 Ga0105239_10270239 Ga0105239_102702392 227
437 3300013105 Ga0157369_10093737 Ga0157369_100937373 227
438 3300013307 Ga0157372_10216095 Ga0157372_102160952 227
439 3300013307 Ga0157372_10462219 Ga0157372_104622192 227
440 3300014497 Ga0182008_10083775 Ga0182008_100837753 227
441 3300014969 Ga0157376_10348823 Ga0157376_103488232 227
442 3300025250 Ga0209026_1000089 Ga0209026_100008976 227
443 3300025256 Ga0209759_1000967 Ga0209759_100096711 227
444 3300025261 Ga0209233_1000010 Ga0209233_1000010915 227
445 3300025297 Ga0209758_1002148 Ga0209758_100214820 227
446 3300025913 Ga0207695_10180054 Ga0207695_101800542 227
447 3300025941 Ga0207711_10651831 Ga0207711_106518312 227
448 3300026067 Ga0207678_10123373 Ga0207678_101233732 227
449 3300041496 Ga0451839_1523640 Ga0451839_1523640_348_1067 227
450 3300044658 Ga0466972_0014897 Ga0466972_0014897_223_945 227
451 3300044683 Ga0466965_0202471 Ga0466965_0202471_165_887 227
452 3300044901 Ga0466960_0048051 Ga0466960_0048051_31_753 227
453 3300046452 Ga0495617_064670 Ga0495617_064670_110_826 227
454 3300046474 Ga0495605_0002723 Ga0495605_0002723_2901_3617 227
455 3300046492 Ga0495585_0002932 Ga0495585_0002932_6313_7029 227
456 3300046501 Ga0495607_0072870 Ga0495607_0072870_570_1286 227
457 3300046506 Ga0495583_0023705 Ga0495583_0023705_1651_2367 227
458 3300046513 Ga0495616_0016658 Ga0495616_0016658_1770_2486 227
459 3300046518 Ga0495631_0001191 Ga0495631_0001191_11570_12286 227
460 3300046538 Ga0495609_0031187 Ga0495609_0031187_1292_2008 227
461 3300046616 Ga0495668_0004532 Ga0495668_0004532_2046_2762 227
462 3300046648 Ga0495611_0003117 Ga0495611_0003117_541_1257 227
463 3300046660 Ga0495625_0001431 Ga0495625_0001431_11469_12185 227
464 3300046691 Ga0495670_0045882 Ga0495670_0045882_634_1350 227
465 3300048091 Ga0495626_0037683 Ga0495626_0037683_858_1574 227
466 3300048906 Ga0496103_0028131 Ga0496103_0028131_1789_2511 227
467 3300048909 Ga0496106_0183069 Ga0496106_0183069_323_1045 227
468 3300048915 Ga0496112_0000934 Ga0496112_0000934_6473_7192 227
469 3300048921 Ga0496118_0160538 Ga0496118_0160538_360_1079 227
470 3300049459 Ga0495678_013474 Ga0495678_013474_2688_3404 227
471 3300049569 Ga0501032_0000024 Ga0501032_0000024_74181_74915 227
472 3300049570 Ga0501033_0000391 Ga0501033_0000391_28187_28921 227
473 3300049570 Ga0501033_0039290 Ga0501033_0039290_1494_2225 227
474 3300049571 Ga0501034_0000140 Ga0501034_0000140_24039_24773 227
475 3300049572 Ga0501036_0000443 Ga0501036_0000443_15631_16365 227
476 3300049573 Ga0501037_0000024 Ga0501037_0000024_129690_130424 227
477 3300049573 Ga0501037_0000818 Ga0501037_0000818_21035_21766 227
478 3300049574 Ga0501038_0000064 Ga0501038_0000064_74090_74824 227
479 3300049575 Ga0501039_0000017 Ga0501039_0000017_73996_74730 227
480 3300049579 Ga0501043_0000050 Ga0501043_0000050_74090_74824 227
481 3300049579 Ga0501043_0000124 Ga0501043_0000124_68724_69455 227
482 3300049580 Ga0501046_0106305 Ga0501046_0106305_601_1335 227
483 3300049581 Ga0501047_0192172 Ga0501047_0192172_1031_1765 227
484 3300049581 Ga0501047_0240005 Ga0501047_0240005_654_1385 227
485 3300049585 Ga0501069_0000004 Ga0501069_0000004_186684_187415 227
486 3300049585 Ga0501069_0047173 Ga0501069_0047173_1332_2054 227
487 3300049586 Ga0501070_0000694 Ga0501070_0000694_26503_27234 227
488 3300049586 Ga0501070_0009617 Ga0501070_0009617_7133_7864 227
489 3300049587 Ga0501071_0031139 Ga0501071_0031139_1452_2183 227
490 3300049590 Ga0501074_0000006 Ga0501074_0000006_43690_44421 227
491 3300049742 Ga0501080_0002140 Ga0501080_0002140_5851_6582 227
492 3300049742 Ga0501080_0060928 Ga0501080_0060928_1501_2232 227
493 3300049744 Ga0501083_0029607 Ga0501083_0029607_1501_2232 227
494 3300049822 Ga0501035_0000011 Ga0501035_0000011_255937_256668 227
495 3300049822 Ga0501035_0000021 Ga0501035_0000021_134368_135102 227
496 3300049822 Ga0501035_0008048 Ga0501035_0008048_6158_6889 227
497 3300049822 Ga0501035_0012639 Ga0501035_0012639_6641_7372 227
498 3300049823 Ga0501044_0000333 Ga0501044_0000333_49048_49779 227
499 3300049823 Ga0501044_0007374 Ga0501044_0007374_4252_4983 227
500 3300049823 Ga0501044_0150901 Ga0501044_0150901_439_1173 227
501 3300049823 Ga0501044_0337676 Ga0501044_0337676_330_1061 227
502 3300049823 Ga0501044_0900578 Ga0501044_0900578_12_734 227
503 3300050494 nmdc:mga06z11_185748_c1 nmdc:mga06z11_185748_c1_367_1089 227
504 3300053079 Ga0500610_0060594 Ga0500610_0060594_679_1395 227
505 3300053109 Ga0500569_003913 Ga0500569_003913_608_1324 227
506 3300053118 Ga0500594_0007875 Ga0500594_0007875_636_1352 227
507 3300053139 Ga0500568_0002244 Ga0500568_0002244_3805_4521 227
508 3300053158 Ga0500627_0129270 Ga0500627_0129270_137_877 227
509 3300060353 Ga0501082_0061970 Ga0501082_0061970_1362_2093 227
510 3300060353 Ga0501082_0170542 Ga0501082_0170542_747_1478 227
511 3300003578 Ga0006562J51391_1008306 Ga0006562J51391_10083062 228
512 3300003762 Ga0055542_1000483 Ga0055542_100048327 228
513 3300003763 Ga0055529_1002224 Ga0055529_10022245 228
514 3300005539 Ga0068853_100240375 Ga0068853_1002403752 228
515 3300005843 Ga0068860_100564058 Ga0068860_1005640582 228
516 3300006042 Ga0075368_10187080 Ga0075368_101870802 228
517 3300006178 Ga0075367_10184636 Ga0075367_101846362 228
518 3300025230 Ga0209563_104966 Ga0209563_1049663 228
519 3300025254 Ga0209148_1000124 Ga0209148_1000124168 228
520 3300025272 Ga0209455_1000062 Ga0209455_100006284 228
521 3300025940 Ga0207691_10372555 Ga0207691_103725552 228
522 3300026121 Ga0207683_10047918 Ga0207683_100479183 228
523 3300028381 Ga0268264_10237633 Ga0268264_102376332 228
524 3300028794 Ga0307515_10248866 Ga0307515_102488662 228
525 3300046660 Ga0495625_0381806 Ga0495625_0381806_30_755 228
526 3300047443 Ga0495687_045363 Ga0495687_045363_936_1676 228
527 3300048922 Ga0496119_0026280 Ga0496119_0026280_1868_2593 228
528 3300048923 Ga0496120_0005103 Ga0496120_0005103_7862_8587 228
529 3300048923 Ga0496120_0034090 Ga0496120_0034090_1619_2371 228
530 3300048924 Ga0496121_0273364 Ga0496121_0273364_197_919 228
531 3300048925 Ga0496122_0094199 Ga0496122_0094199_579_1331 228
532 3300048926 Ga0496123_0027908 Ga0496123_0027908_2443_3195 228
533 3300048927 Ga0496124_0289853 Ga0496124_0289853_132_854 228
534 3300048929 Ga0496126_0071957 Ga0496126_0071957_993_1745 228
535 3300049570 Ga0501033_0266691 Ga0501033_0266691_237_962 228
536 3300049571 Ga0501034_0243879 Ga0501034_0243879_171_887 228
537 3300049581 Ga0501047_0562563 Ga0501047_0562563_201_935 228
538 3300049586 Ga0501070_0017227 Ga0501070_0017227_3792_4526 228
539 3300049742 Ga0501080_0081311 Ga0501080_0081311_98_832 228
540 3300049822 Ga0501035_0043924 Ga0501035_0043924_2181_2906 228
541 3300049823 Ga0501044_0057928 Ga0501044_0057928_507_1232 228
542 3300049823 Ga0501044_0146513 Ga0501044_0146513_901_1635 228
543 3300050494 nmdc:mga06z11_392210_c1 nmdc:mga06z11_392210_c1_63_788 228
544 3300050494 nmdc:mga06z11_61810_c1 nmdc:mga06z11_61810_c1_374_1114 228
545 3300053079 Ga0500610_0021918 Ga0500610_0021918_1486_2220 228
546 3300053155 Ga0500620_000224 Ga0500620_000224_585_1310 228
547 3300053177 Ga0500636_0000003 Ga0500636_0000003_119809_120522 228
548 iso_pu_bacteria 2968117919 2968119601 228
549 iso_pu_bacteria 2987652177 2987654246 228
550 iso_pu_bacteria 8004640170 8004641158 228
551 3300002704 JGI25155J39150_1000014 JGI25155J39150_100001432 229
552 3300002705 JGI25156J39149_1000037 JGI25156J39149_100003780 229
553 3300002737 JGI25162J39368_1001708 JGI25162J39368_10017089 229
554 3300002738 JGI25154J39366_1000229 JGI25154J39366_100022914 229
555 3300002741 JGI25157J39369_1000040 JGI25157J39369_100004030 229
556 3300003214 JGI25165J46597_1000395 JGI25165J46597_10003954 229
557 3300003215 JGI25153J46596_10023622 JGI25153J46596_100236222 229
558 3300003322 rootL2_10065624 rootL2_100656249 229
559 3300003354 JGI25160J50197_1006059 JGI25160J50197_10060595 229
560 3300003374 JGI25161J50226_1000068 JGI25161J50226_100006828 229
561 3300003771 Ga0055526_1002000 Ga0055526_10020005 229
562 3300003790 Ga0055528_1001364 Ga0055528_100136410 229
563 3300004625 Ga0055543_1000189 Ga0055543_100018925 229
564 3300005262 Ga0065165_1004223 Ga0065165_10042234 229
565 3300005548 Ga0070665_100074460 Ga0070665_1000744603 229
566 3300005548 Ga0070665_100331435 Ga0070665_1003314352 229
567 3300005614 Ga0068856_100053525 Ga0068856_1000535254 229
568 3300025206 Ga0209435_100027 Ga0209435_10002730 229
569 3300025233 Ga0209437_100051 Ga0209437_100051136 229
570 3300025233 Ga0209437_100098 Ga0209437_1000985 229
571 3300025246 Ga0209646_1000086 Ga0209646_100008630 229
572 3300025250 Ga0209026_1000082 Ga0209026_100008230 229
573 3300025254 Ga0209148_1012825 Ga0209148_10128252 229
574 3300025256 Ga0209759_1000063 Ga0209759_1000063171 229
575 3300025256 Ga0209759_1018372 Ga0209759_10183721 229
576 3300025261 Ga0209233_1000095 Ga0209233_1000095122 229
577 3300025261 Ga0209233_1000190 Ga0209233_10001904 229
578 3300025294 Ga0209025_1000171 Ga0209025_100017194 229
579 3300028379 Ga0268266_10136062 Ga0268266_101360622 229
580 3300028794 Ga0307515_10106195 Ga0307515_101061954 229
581 3300031731 Ga0307405_10232660 Ga0307405_102326602 229
582 3300041413 Ga0439465_0045500 Ga0439465_0045500_572_1276 229
583 3300044735 Ga0466968_0108850 Ga0466968_0108850_219_944 229
584 3300046507 Ga0495606_0001738 Ga0495606_0001738_25934_26653 229
585 3300046522 Ga0495643_0151563 Ga0495643_0151563_138_881 229
586 3300047472 Ga0495686_0001869 Ga0495686_0001869_13779_14498 229
587 3300047472 Ga0495686_0026006 Ga0495686_0026006_2005_2724 229
588 3300048920 Ga0496117_0008082 Ga0496117_0008082_808_1521 229
589 3300048925 Ga0496122_0000157 Ga0496122_0000157_77712_78449 229
590 3300048925 Ga0496122_0000464 Ga0496122_0000464_40081_40794 229
591 3300048926 Ga0496123_0000048 Ga0496123_0000048_165704_166441 229
592 3300048926 Ga0496123_0000147 Ga0496123_0000147_32005_32718 229
593 3300048927 Ga0496124_0024702 Ga0496124_0024702_3882_4595 229
594 3300048927 Ga0496124_0045206 Ga0496124_0045206_1584_2321 229
595 3300048929 Ga0496126_0000601 Ga0496126_0000601_31560_32273 229
596 3300049568 Ga0501031_0163016 Ga0501031_0163016_571_1287 229
597 3300049570 Ga0501033_0198795 Ga0501033_0198795_569_1285 229
598 3300049573 Ga0501037_0261727 Ga0501037_0261727_420_1136 229
599 3300049579 Ga0501043_0038992 Ga0501043_0038992_203_919 229
600 3300049586 Ga0501070_0460682 Ga0501070_0460682_72_815 229
601 3300049823 Ga0501044_0028642 Ga0501044_0028642_2170_2886 229
602 3300053125 Ga0500618_029205 Ga0500618_029205_259_1002 229
603 iso_pu_bacteria 2509276022 2509395122 229
604 iso_pu_bacteria 2856320880 2856323388 229
605 iso_pu_bacteria 2869278585 2869282868 229
606 iso_pu_bacteria 2874139085 2874142528 229
607 iso_pu_bacteria 2878738818 2878739234 229
608 iso_pu_bacteria 2924718760 2924723630 229
609 iso_pu_bacteria 2924776078 2924776699 229
610 iso_pu_bacteria 2937877337 2937880860 229
611 iso_pu_bacteria 2937972304 2937977051 229
612 iso_pu_bacteria 2958034702 2958039651 229
613 iso_pu_bacteria 2958041894 2958052720 229
614 iso_pu_bacteria 2958064165 2958065185 229
615 iso_pu_bacteria 2958084443 2958088584 229
616 iso_pu_bacteria 2958092219 2958093889 229
617 iso_pu_bacteria 2968016561 2968020979 229
618 iso_pu_bacteria 2970469710 2970474276 229
619 iso_pu_bacteria 2970593180 2970597477 229
620 iso_pu_bacteria 2996348954 2996352388 229
621 iso_pu_bacteria 3004167301 3004167913 229
622 iso_pu_bacteria 3004275668 3004279070 229
623 iso_pu_bacteria 3004289098 3004294826 229
624 3300003781 Ga0055536_1006223 Ga0055536_10062232 233
625 3300003794 Ga0055531_10001015 Ga0055531_1000101510 233
626 iso_pu_bacteria 2937868953 2937874463 235
627 3300048928 Ga0496125_0002199 Ga0496125_0002199_15507_16280 241
628 3300001979 JGI24740J21852_10000905 JGI24740J21852_100009053 242
629 3300002737 JGI25162J39368_1000379 JGI25162J39368_100037938 242
630 3300003214 JGI25165J46597_1000469 JGI25165J46597_10004694 242
631 3300013100 Ga0157373_10073462 Ga0157373_100734622 242
632 3300013105 Ga0157369_10531988 Ga0157369_105319882 242
633 3300027312 Ga0209371_1006202 Ga0209371_10062023 242
634 3300030500 Ga0268256_1018823 Ga0268256_10188233 242
635 3300041413 Ga0439465_0029198 Ga0439465_0029198_935_1693 242
636 3300048926 Ga0496123_0056987 Ga0496123_0056987_803_1558 242
637 3300049571 Ga0501034_0394499 Ga0501034_0394499_437_1192 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

3

190

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ofv-assembly1.cif.gz_C crystal structure of peptidyl-trna hydrolase from escherichia coli, i222 crystal form 0.9468 14 183
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9443 14 187
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.9387 14 194
4p7b-assembly2.cif.gz_C crystal structure of s. typhimurium peptidyl-trna hydrolase 0.9363 15 194
8axp-assembly1.cif.gz_B neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. 0.9359 15 194
ID Description Score Start End Superfamily
af_F1M8A9_28_144_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9406 13 120 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9332 13 193 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9322 15 183 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9173 14 194 3.40.50.1470
af_Q86Y79_27_209_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.913 13 187 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A7C1P4V1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9964 14 162 GO:0004045
GO:0005737
GO:0006412
AF-A0A434SHI8-F1-model_v4 Peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9961 14 189 GO:0004045
AF-A0A7C5PJ52-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9957 14 121 GO:0004045
AF-A0A2E6W354-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9899 14 199 GO:0004045
GO:0005737
GO:0006412
AF-A0A2E5L551-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9897 14 198 GO:0004045
GO:0005737
GO:0006412

Feature Viewer

pLDDT pTM Quality
86.37 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map