F471393

General Info

Members Datasets Scaffolds Average Seq Length
636 360 1272 208

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2811994880|2812365671
Length 244
Sequence SRALGSLQRADAGRGGCHRHRPPGGGDELDESDEGAFVNEQVPAIARAESPGLGLNDHIYNRLLRERIIWLGSEVRDENANAICAQMMLLAAEDPDKDIWLYINSPGGSITAGMAIYDTMQYIKPDVATIAMGMAASMGQFLLSSGAKGKRYATPHARVMMHQPSGGIGGTATDVRINAQLILHMKKVLADLIAEQTGKTSEQIHADSDRDRWFTAPEALEYGFIDHVVTSAHSVAGGGGTARG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
57 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
90 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
91 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
105 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
106 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
107 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
129 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
136 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
147 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
150 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
151 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
152 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
153 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
154 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
155 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
156 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
157 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
158 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
159 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
160 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
163 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
164 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
310 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
311 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
312 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
313 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
314 2643221548 Streptomyces sp. Root55 Isolate Unclassified
315 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
316 2643221578 Streptomyces sp. Root63 Isolate Unclassified
317 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
318 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
319 2643221670 Streptomyces sp. Root431 Isolate Unclassified
320 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
321 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
322 2643221679 Angustibacter sp. Root456 Isolate Unclassified
323 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
324 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
325 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
326 2643221711 Terrabacter sp. Root85 Isolate Unclassified
327 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
328 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
329 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
330 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
331 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
332 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
333 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
334 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
335 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
336 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
337 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
338 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
339 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
340 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
341 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
342 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
343 2862574272 Streptomyces sp. AcE210 Isolate Nodule
344 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
345 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
346 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
347 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
348 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
349 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
350 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
351 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
352 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
353 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
354 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
355 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
356 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
357 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
358 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
359 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
360 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.72
Metatranscriptomes 12.26
Isolates 8.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0.16
Rhizoplane 11.95
Rhizosphere 78.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017617 3300001979 Bacteria 2549
2 JGI24735J21928_10057845 3300002067 Bacteria 1115
3 Ga0006778J45830_1054830 3300003162 Bacteria 675
4 JGI25406J46586_10024934 3300003203 Bacteria 2332
5 Ga0006562J51391_1016339 3300003578 Bacteria 2720
6 Ga0006562J51391_1037323 3300003578 Bacteria 2893
7 Ga0058863_10168630 3300004799 Bacteria 742
8 Ga0070658_10204293 3300005327 Bacteria 1668
9 Ga0070658_10651637 3300005327 Bacteria 914
10 Ga0070683_100081608 3300005329 Bacteria 3028
11 Ga0070683_100282242 3300005329 Bacteria 1579
12 Ga0070680_100144028 3300005336 Bacteria 1999
13 Ga0070680_100224560 3300005336 Bacteria 1585
14 Ga0070682_100041162 3300005337 Bacteria 2847
15 Ga0070682_100107696 3300005337 Bacteria 1851
16 Ga0070682_100534371 3300005337 Bacteria 915
17 Ga0070660_100114343 3300005339 Bacteria 2149
18 Ga0070660_100474291 3300005339 Bacteria 1039
19 Ga0070687_100181945 3300005343 Bacteria 1260
20 Ga0070674_100051183 3300005356 Bacteria 2845
21 Ga0070659_100320024 3300005366 Bacteria 1297
22 Ga0070714_100001789 3300005435 Bacteria 15646
23 Ga0070705_100013976 3300005440 Bacteria 4118
24 Ga0070663_100104701 3300005455 Bacteria 2117
25 Ga0070663_100693915 3300005455 Bacteria 865
26 Ga0070678_100051769 3300005456 Bacteria 2978
27 Ga0070678_100129343 3300005456 Bacteria 2004
28 Ga0070678_100341564 3300005456 Bacteria 1285
29 Ga0070678_100608265 3300005456 Bacteria 976
30 Ga0070681_10187459 3300005458 Bacteria 1989
31 Ga0070681_10584564 3300005458 Bacteria 1031
32 Ga0068867_100157664 3300005459 Bacteria 1788
33 Ga0070706_100397046 3300005467 Bacteria 1284
34 Ga0070698_100756395 3300005471 Bacteria 915
35 Ga0070679_100020810 3300005530 Bacteria 6399
36 Ga0070679_100189952 3300005530 Bacteria 2023
37 Ga0070672_100365210 3300005543 Bacteria 1232
38 Ga0070693_100006536 3300005547 Bacteria 5653
39 Ga0070693_100210615 3300005547 Bacteria 1268
40 Ga0070664_100328578 3300005564 Bacteria 1387
41 Ga0070702_100015855 3300005615 Bacteria 3856
42 Ga0070702_100234662 3300005615 Bacteria 1235
43 Ga0068852_100094066 3300005616 Bacteria 2688
44 Ga0068866_10333866 3300005718 Bacteria 958
45 Ga0068863_101173746 3300005841 Bacteria 773
46 Ga0081539_10001179 3300005985 Bacteria 47264
47 Ga0070717_10625685 3300006028 Bacteria 977
48 Ga0075365_10158595 3300006038 Bacteria 1576
49 Ga0075432_10003166 3300006058 Bacteria 5551
50 Ga0070716_100185000 3300006173 Bacteria 1371
51 Ga0075366_10314461 3300006195 Bacteria 959
52 Ga0068871_100729616 3300006358 Bacteria 909
53 Ga0068865_100277989 3300006881 Bacteria 1332
54 Ga0105245_10055442 3300009098 Bacteria 3560
55 Ga0105243_10132481 3300009148 Bacteria 2117
56 Ga0105243_10165517 3300009148 Bacteria 1910
57 Ga0105243_10650097 3300009148 Bacteria 1022
58 Ga0105243_10734834 3300009148 Bacteria 966
59 Ga0105241_10388127 3300009174 Bacteria 1222
60 Ga0105242_10188981 3300009176 Bacteria 1822
61 Ga0105242_10415271 3300009176 Bacteria 1259
62 Ga0105248_10206342 3300009177 Bacteria 2214
63 Ga0105248_10485604 3300009177 Bacteria 1392
64 Ga0105237_10514327 3300009545 Bacteria 1204
65 Ga0105237_10775195 3300009545 Bacteria 966
66 Ga0105238_10102242 3300009551 Bacteria 2848
67 Ga0105238_10881050 3300009551 Bacteria 913
68 Ga0105249_10071139 3300009553 Bacteria 3213
69 Ga0105239_10231793 3300010375 Bacteria 2071
70 Ga0105239_10884637 3300010375 Bacteria 1025
71 Ga0105239_11177803 3300010375 Bacteria 883
72 Ga0105246_10095584 3300011119 Bacteria 2152
73 Ga0105246_10123820 3300011119 Bacteria 1920
74 Ga0157371_10181062 3300013102 Bacteria 1507
75 Ga0157369_10030211 3300013105 Bacteria 5977
76 Ga0157369_10241212 3300013105 Bacteria 1888
77 Ga0157378_10602161 3300013297 Bacteria 1110
78 Ga0163162_10619986 3300013306 Bacteria 1207
79 Ga0163162_10879194 3300013306 Bacteria 1010
80 Ga0157372_10157021 3300013307 Bacteria 2628
81 Ga0157372_10181282 3300013307 Bacteria 2438
82 Ga0157372_10468554 3300013307 Bacteria 1468
83 Ga0157375_10075073 3300013308 Bacteria 3404
84 Ga0157375_10215058 3300013308 Bacteria 2080
85 Ga0163161_10278534 3300017792 Bacteria 1311
86 Ga0163161_10877791 3300017792 Bacteria 758
87 Ga0206355_1062385 3300020076 Bacteria 2200
88 Ga0206355_1376753 3300020076 Bacteria 1247
89 Ga0206350_10422469 3300020080 Bacteria 1423
90 Ga0206350_10467590 3300020080 Bacteria 1081
91 Ga0206353_10276985 3300020082 Bacteria 1712
92 Ga0224712_10198473 3300022467 Bacteria 911
93 Ga0207692_10078502 3300025898 Bacteria 1759
94 Ga0207647_10008541 3300025904 Bacteria 7334
95 Ga0207705_10281721 3300025909 Bacteria 1273
96 Ga0207684_10499509 3300025910 Bacteria 1043
97 Ga0207693_10093794 3300025915 Bacteria 2353
98 Ga0207660_10290159 3300025917 Bacteria 1301
99 Ga0207657_10513344 3300025919 Bacteria 938
100 Ga0207652_10019476 3300025921 Bacteria 5582
101 Ga0207681_10330444 3300025923 Bacteria 1215
102 Ga0207694_10155871 3300025924 Bacteria 1842
103 Ga0207694_10268909 3300025924 Bacteria 1398
104 Ga0207687_10183871 3300025927 Bacteria 1621
105 Ga0207687_10218582 3300025927 Bacteria 1499
106 Ga0207664_10025995 3300025929 Bacteria 4418
107 Ga0207664_10151673 3300025929 Bacteria 1969
108 Ga0207709_10060703 3300025935 Bacteria 2359
109 Ga0207709_10157579 3300025935 Bacteria 1580
110 Ga0207709_10192356 3300025935 Bacteria 1450
111 Ga0207669_10376442 3300025937 Bacteria 1105
112 Ga0207704_10013477 3300025938 Bacteria 4092
113 Ga0207691_10136639 3300025940 Bacteria 2162
114 Ga0207691_10392597 3300025940 Bacteria 1184
115 Ga0207661_10215847 3300025944 Bacteria 1693
116 Ga0207661_10259201 3300025944 Bacteria 1548
117 Ga0207703_10365812 3300026035 Bacteria 1331
118 Ga0207678_10149348 3300026067 Bacteria 1995
119 Ga0207678_10215220 3300026067 Bacteria 1644
120 Ga0207678_10470458 3300026067 Bacteria 1094
121 Ga0207678_10511187 3300026067 Bacteria 1048
122 Ga0207708_10107229 3300026075 Bacteria 2166
123 Ga0207702_10888915 3300026078 Bacteria 883
124 Ga0207641_10293283 3300026088 Bacteria 1534
125 Ga0207648_10063684 3300026089 Bacteria 3213
126 Ga0207676_10460592 3300026095 Bacteria 1201
127 Ga0207675_100318820 3300026118 Bacteria 1517
128 Ga0207683_10021001 3300026121 Bacteria 5589
129 Ga0207683_10066226 3300026121 Bacteria 3185
130 Ga0207683_10120427 3300026121 Bacteria 2355
131 Ga0207683_10197797 3300026121 Bacteria 1826
132 Ga0207683_10376529 3300026121 Bacteria 1304
133 Ga0207698_10077589 3300026142 Bacteria 2664
134 Ga0207698_10428121 3300026142 Bacteria 1272
135 Ga0207698_10457734 3300026142 Bacteria 1233
136 Ga0268264_10391043 3300028381 Bacteria 1334
137 Ga0265327_10205154 3300031251 Bacteria 891
138 Ga0307514_10210324 3300031649 Bacteria 1209
139 Ga0316575_10000110 3300031665 Bacteria 20680
140 Ga0316575_10021877 3300031665 Bacteria 2465
141 Ga0316575_10034532 3300031665 Bacteria 1986
142 Ga0316579_10003025 3300031691 Bacteria 6467
143 Ga0316579_10024138 3300031691 Bacteria 2735
144 Ga0316579_10149810 3300031691 Bacteria 1125
145 Ga0316576_10032724 3300031727 Bacteria 3696
146 Ga0316576_10040200 3300031727 Bacteria 3360
147 Ga0316576_10234769 3300031727 Bacteria 1378
148 Ga0316576_10442841 3300031727 Bacteria 960
149 Ga0316578_10000866 3300031728 Bacteria 11358
150 Ga0316578_10057638 3300031728 Bacteria 2282
151 Ga0316578_10080439 3300031728 Bacteria 1938
152 Ga0307405_10069842 3300031731 Bacteria 2253
153 Ga0307405_10365861 3300031731 Bacteria 1118
154 Ga0307405_10638937 3300031731 Bacteria 874
155 Ga0316577_10005539 3300031733 Bacteria 6626
156 Ga0316577_10151235 3300031733 Bacteria 1308
157 Ga0307413_10083565 3300031824 Bacteria 2055
158 Ga0307413_10093935 3300031824 Bacteria 1962
159 Ga0307413_10548302 3300031824 Bacteria 937
160 Ga0307413_10613463 3300031824 Bacteria 892
161 Ga0307410_10000904 3300031852 Bacteria 12655
162 Ga0307410_10013185 3300031852 Bacteria 4812
163 Ga0307410_10086142 3300031852 Bacteria 2219
164 Ga0307410_10140530 3300031852 Bacteria 1786
165 Ga0307406_10193850 3300031901 Bacteria 1490
166 Ga0307407_10035928 3300031903 Bacteria 2726
167 Ga0307407_10153920 3300031903 Bacteria 1497
168 Ga0307407_10165928 3300031903 Bacteria 1450
169 Ga0307412_10067669 3300031911 Bacteria 2426
170 Ga0307409_100011105 3300031995 Bacteria 5653
171 Ga0307409_100033653 3300031995 Bacteria 3733
172 Ga0307409_100073070 3300031995 Bacteria 2734
173 Ga0307409_100113904 3300031995 Bacteria 2274
174 Ga0307409_100320672 3300031995 Bacteria 1450
175 Ga0307416_100018744 3300032002 Bacteria 4886
176 Ga0307416_100025077 3300032002 Bacteria 4365
177 Ga0307416_100116719 3300032002 Bacteria 2367
178 Ga0307416_100162832 3300032002 Bacteria 2064
179 Ga0307416_100337054 3300032002 Bacteria 1519
180 Ga0307416_100339213 3300032002 Bacteria 1515
181 Ga0307411_10127409 3300032005 Bacteria 1854
182 Ga0307411_10261954 3300032005 Bacteria 1366
183 Ga0316583_10032635 3300032133 Bacteria 1851
184 Ga0316583_10034824 3300032133 Bacteria 1787
185 Ga0316585_10010464 3300032137 Bacteria 2721
186 Ga0316585_10017658 3300032137 Bacteria 2159
187 Ga0316580_10009328 3300032139 Bacteria 2947
188 Ga0316580_10018842 3300032139 Bacteria 2125
189 Ga0316580_10081558 3300032139 Bacteria 989
190 Ga0316593_10011608 3300032168 Bacteria 2565
191 Ga0316593_10033899 3300032168 Bacteria 1674
192 Ga0316592_1012981 3300033524 Bacteria 1713
193 Ga0316592_1018983 3300033524 Bacteria 1452
194 Ga0316588_1023421 3300033528 Bacteria 1417
195 Ga0316596_1016716 3300033541 Bacteria 1839
196 Ga0316596_1029083 3300033541 Bacteria 1430
197 Ga0373934_0054323 3300035086 Bacteria 1590
198 Ga0373936_0005616 3300035113 Bacteria 4728
199 Ga0373957_0011556 3300035120 Bacteria 2951
200 Ga0373943_0076684 3300035170 Bacteria 1706
201 Ga0373955_0103755 3300035172 Bacteria 1635
202 Ga0316574_0004218 3300035398 Bacteria 7498
203 Ga0316574_0014758 3300035398 Bacteria 4521
204 Ga0316574_0019250 3300035398 Bacteria 4023
205 Ga0316574_0342208 3300035398 Bacteria 947
206 Ga0373924_0059723 3300035410 Bacteria 1593
207 Ga0373931_0259884 3300035691 Bacteria 1059
208 Ga0373933_0008290 3300035724 Bacteria 5674
209 Ga0373937_0038156 3300036401 Bacteria 4378
210 Ga0265778_005353 3300036457 Bacteria 1355
211 Ga0316582_0008420 3300036647 Bacteria 5543
212 Ga0316582_0028696 3300036647 Bacteria 3373
213 Ga0316584_0003768 3300036712 Bacteria 9934
214 Ga0316584_0011467 3300036712 Bacteria 6227
215 Ga0316584_0077362 3300036712 Bacteria 2492
216 Ga0316584_0495335 3300036712 Bacteria 859
217 Ga0395900_0034125 3300037418 Bacteria 5238
218 Ga0395898_0030371 3300037466 Bacteria 5407
219 Ga0395898_0259204 3300037466 Bacteria 1658
220 Ga0395905_0029015 3300037471 Bacteria 5215
221 Ga0395905_0139852 3300037471 Bacteria 2278
222 Ga0395901_0037105 3300038443 Bacteria 5041
223 Ga0395901_0048393 3300038443 Bacteria 4415
224 Ga0395901_0183072 3300038443 Bacteria 2197
225 Ga0395901_0313536 3300038443 Bacteria 1624
226 Ga0395901_0893106 3300038443 Bacteria 871
227 Ga0400485_11442 3300038735 Bacteria 19231
228 Ga0400486_30354 3300038742 Bacteria 18891
229 Ga0436363_1538985 3300039450 Bacteria 785
230 Ga0436362_0346297 3300039453 Bacteria 1161
231 Ga0439436_0013087 3300041404 Bacteria 2512
232 Ga0439436_0016804 3300041404 Bacteria 2192
233 Ga0439436_0081075 3300041404 Bacteria 903
234 Ga0439438_006435 3300041405 Bacteria 4139
235 Ga0439438_046453 3300041405 Bacteria 1115
236 Ga0439439_0000385 3300041406 Bacteria 7277
237 Ga0439447_016195 3300041407 Bacteria 2052
238 Ga0439447_027150 3300041407 Bacteria 1463
239 Ga0439461_0009321 3300041410 Bacteria 1778
240 Ga0439466_0002897 3300041411 Bacteria 6706
241 Ga0439465_0084365 3300041413 Bacteria 1081
242 Ga0451791_0326913 3300041451 Bacteria 1644
243 Ga0451793_0215134 3300041452 Bacteria 2777
244 Ga0451797_0495029 3300041453 Bacteria 1633
245 Ga0451797_1029940 3300041453 Bacteria 1081
246 Ga0451802_0226522 3300041460 Bacteria 1163
247 Ga0451807_0001797 3300041486 Bacteria 2102
248 Ga0451833_0450366 3300041491 Bacteria 1778
249 Ga0451837_0259585 3300041494 Bacteria 3931
250 Ga0451849_0359593 3300041505 Bacteria 948
251 Ga0451843_0765211 3300041509 Bacteria 893
252 Ga0451853_1980724 3300041512 Bacteria 1848
253 Ga0439433_0000411 3300041999 Bacteria 7761
254 Ga0439433_0000904 3300041999 Bacteria 5911
255 Ga0439442_021836 3300042002 Bacteria 1327
256 Ga0439432_028835 3300042006 Bacteria 1806
257 Ga0439432_044806 3300042006 Bacteria 1393
258 Ga0439449_0000879 3300042007 Bacteria 11744
259 Ga0439449_0025193 3300042007 Bacteria 2223
260 Ga0439452_002345 3300042010 Bacteria 7059
261 Ga0439457_003049 3300042014 Bacteria 4637
262 Ga0439462_0016900 3300042015 Bacteria 1888
263 Ga0439462_0022181 3300042015 Bacteria 1660
264 Ga0439462_0064009 3300042015 Bacteria 996
265 Ga0450919_004567 3300042121 Bacteria 1688
266 Ga0450920_001738 3300042122 Bacteria 3651
267 Ga0450900_014169 3300042136 Bacteria 1061
268 Ga0450910_011533 3300042147 Bacteria 1269
269 Ga0439446_0000569 3300042156 Bacteria 7508
270 Ga0439434_0002125 3300042435 Bacteria 5733
271 Ga0439434_0018392 3300042435 Bacteria 2092
272 Ga0439460_0112154 3300042461 Bacteria 886
273 Ga0450918_002295 3300042531 Bacteria 3620
274 Ga0450901_016597 3300042533 Bacteria 777
275 Ga0466965_0016847 3300044683 Bacteria 3485
276 Ga0466960_0018942 3300044901 Bacteria 3024
277 Ga0466960_0149145 3300044901 Bacteria 1248
278 Ga0466958_0042912 3300045836 Bacteria 2723
279 Ga0466967_0311693 3300045976 Bacteria 1516
280 Ga0495592_0358786 3300046454 Bacteria 933
281 Ga0495603_0168357 3300046455 Bacteria 1269
282 Ga0495629_0024271 3300046459 Bacteria 4317
283 Ga0495641_0081627 3300046461 Bacteria 1448
284 Ga0495651_0036045 3300046462 Bacteria 3850
285 Ga0495653_0011041 3300046463 Bacteria 7387
286 Ga0495653_0081953 3300046463 Bacteria 2383
287 Ga0495653_0416997 3300046463 Bacteria 850
288 Ga0495582_0352327 3300046473 Bacteria 848
289 Ga0495664_0151898 3300046477 Bacteria 1405
290 Ga0495585_0012050 3300046492 Bacteria 5102
291 Ga0495585_0078252 3300046492 Bacteria 1794
292 Ga0495594_0015192 3300046499 Bacteria 4044
293 Ga0495607_0149540 3300046501 Bacteria 1196
294 Ga0495620_0073825 3300046515 Bacteria 1390
295 Ga0495628_0224778 3300046516 Bacteria 1409
296 Ga0495631_0168884 3300046518 Bacteria 938
297 Ga0495648_0241317 3300046524 Bacteria 878
298 Ga0495666_0173516 3300046526 Bacteria 997
299 Ga0495665_0357243 3300046531 Bacteria 744
300 Ga0495640_0167030 3300046533 Bacteria 1407
301 Ga0495640_0178999 3300046533 Bacteria 1352
302 Ga0495640_0280039 3300046533 Bacteria 1039
303 Ga0495587_0131288 3300046536 Bacteria 1431
304 Ga0495645_0330123 3300046543 Bacteria 988
305 Ga0495622_0007761 3300046557 Bacteria 4984
306 Ga0495667_0002317 3300046559 Bacteria 12755
307 Ga0495667_0113642 3300046559 Bacteria 1750
308 Ga0495656_0243595 3300046615 Bacteria 906
309 Ga0495611_0026629 3300046648 Bacteria 2523
310 Ga0495625_0100062 3300046660 Bacteria 1993
311 Ga0495625_0256158 3300046660 Bacteria 1134
312 Ga0495635_0010704 3300046663 Bacteria 6423
313 Ga0495635_0379937 3300046663 Bacteria 940
314 Ga0495635_0489021 3300046663 Bacteria 811
315 Ga0495588_0012319 3300046674 Bacteria 4038
316 Ga0495588_0118071 3300046674 Bacteria 1398
317 Ga0495657_0174647 3300046675 Bacteria 1321
318 Ga0495623_0074204 3300046679 Bacteria 2114
319 Ga0495646_0026169 3300046680 Bacteria 3665
320 Ga0495646_0278368 3300046680 Bacteria 890
321 Ga0495658_0089870 3300046683 Bacteria 1817
322 Ga0495613_0000533 3300046689 Bacteria 31681
323 Ga0495624_0411133 3300046690 Bacteria 812
324 Ga0495649_0120794 3300046694 Bacteria 1386
325 Ga0495589_0036718 3300046794 Bacteria 2455
326 Ga0495600_0155279 3300046809 Bacteria 1480
327 Ga0495581_0057699 3300047315 Bacteria 2241
328 Ga0495581_0264880 3300047315 Bacteria 1005
329 Ga0495604_0176869 3300047317 Bacteria 1495
330 Ga0495636_0019555 3300047318 Bacteria 2723
331 Ga0495636_0166347 3300047318 Bacteria 995
332 Ga0495674_0410585 3300047319 Bacteria 1092
333 Ga0495676_0004789 3300047321 Bacteria 12393
334 Ga0495676_0072644 3300047321 Bacteria 2641
335 Ga0495676_0165604 3300047321 Bacteria 1560
336 Ga0495676_0300912 3300047321 Bacteria 1082
337 Ga0495680_0039019 3300047322 Bacteria 3791
338 Ga0495680_0619197 3300047322 Bacteria 722
339 Ga0495675_0197625 3300047444 Bacteria 1225
340 Ga0495684_0037735 3300047471 Bacteria 3706
341 Ga0495593_0130935 3300047673 Bacteria 1273
342 Ga0495593_0173614 3300047673 Bacteria 1086
343 Ga0495614_0004809 3300048089 Bacteria 6098
344 Ga0495614_0023284 3300048089 Bacteria 2672
345 Ga0496100_0255735 3300048903 Bacteria 1297
346 Ga0496100_0279775 3300048903 Bacteria 1243
347 Ga0496100_0401377 3300048903 Bacteria 1044
348 Ga0496100_0794841 3300048903 Bacteria 741
349 Ga0496101_0033137 3300048904 Bacteria 3642
350 Ga0496101_0121286 3300048904 Bacteria 1977
351 Ga0496101_0156336 3300048904 Bacteria 1747
352 Ga0496101_0168283 3300048904 Bacteria 1683
353 Ga0496101_0294793 3300048904 Bacteria 1269
354 Ga0496101_0395340 3300048904 Bacteria 1088
355 Ga0496102_0002600 3300048905 Bacteria 15400
356 Ga0496102_0062548 3300048905 Bacteria 3408
357 Ga0496102_0083055 3300048905 Bacteria 2955
358 Ga0496102_0185161 3300048905 Bacteria 1962
359 Ga0496102_0189069 3300048905 Bacteria 1940
360 Ga0496102_0634561 3300048905 Bacteria 991
361 Ga0496103_0030356 3300048906 Bacteria 3289
362 Ga0496103_0043837 3300048906 Bacteria 2755
363 Ga0496103_0050247 3300048906 Bacteria 2579
364 Ga0496104_0010288 3300048907 Bacteria 8353
365 Ga0496104_0088185 3300048907 Bacteria 2963
366 Ga0496104_0100415 3300048907 Bacteria 2770
367 Ga0496104_0203065 3300048907 Bacteria 1894
368 Ga0496104_0225201 3300048907 Bacteria 1787
369 Ga0496104_0232225 3300048907 Bacteria 1756
370 Ga0496104_0286174 3300048907 Bacteria 1561
371 Ga0496104_0325222 3300048907 Bacteria 1451
372 Ga0496104_0349470 3300048907 Bacteria 1391
373 Ga0496105_0000828 3300048908 Bacteria 21030
374 Ga0496105_0096997 3300048908 Bacteria 2435
375 Ga0496105_0159610 3300048908 Bacteria 1851
376 Ga0496105_0487207 3300048908 Bacteria 969
377 Ga0496105_0549371 3300048908 Bacteria 901
378 Ga0496106_0064977 3300048909 Bacteria 2777
379 Ga0496106_0204155 3300048909 Bacteria 1573
380 Ga0496106_0297572 3300048909 Bacteria 1294
381 Ga0496107_0089273 3300048910 Bacteria 2251
382 Ga0496107_0091736 3300048910 Bacteria 2220
383 Ga0496107_0267775 3300048910 Bacteria 1272
384 Ga0496108_0074897 3300048911 Bacteria 2859
385 Ga0496108_0249133 3300048911 Bacteria 1545
386 Ga0496108_0644275 3300048911 Bacteria 921
387 Ga0496109_0055975 3300048912 Bacteria 3598
388 Ga0496109_0280545 3300048912 Bacteria 1570
389 Ga0496109_0374598 3300048912 Bacteria 1345
390 Ga0496110_0051176 3300048913 Bacteria 3630
391 Ga0496110_0070348 3300048913 Bacteria 3100
392 Ga0496110_0108648 3300048913 Bacteria 2491
393 Ga0496111_0068418 3300048914 Bacteria 2581
394 Ga0496111_0078278 3300048914 Bacteria 2411
395 Ga0496111_0088231 3300048914 Bacteria 2271
396 Ga0496111_0133156 3300048914 Bacteria 1840
397 Ga0496111_0159139 3300048914 Bacteria 1676
398 Ga0496111_0701701 3300048914 Bacteria 736
399 Ga0496113_0219459 3300048916 Bacteria 1515
400 Ga0496113_0293870 3300048916 Bacteria 1300
401 Ga0496113_0460595 3300048916 Bacteria 1022
402 Ga0496114_0045246 3300048917 Bacteria 3656
403 Ga0496114_0061484 3300048917 Bacteria 3141
404 Ga0496114_0115947 3300048917 Bacteria 2299
405 Ga0496114_0117401 3300048917 Bacteria 2285
406 Ga0496114_0156235 3300048917 Bacteria 1981
407 Ga0496114_0246599 3300048917 Bacteria 1571
408 Ga0496114_0619441 3300048917 Bacteria 953
409 Ga0496114_0682859 3300048917 Bacteria 901
410 Ga0496115_0038896 3300048918 Bacteria 3777
411 Ga0496115_0043528 3300048918 Bacteria 3581
412 Ga0496115_0185808 3300048918 Bacteria 1717
413 Ga0496115_0275668 3300048918 Bacteria 1381
414 Ga0496115_0398000 3300048918 Bacteria 1118
415 Ga0496118_0089381 3300048921 Bacteria 2126
416 Ga0496118_0227595 3300048921 Bacteria 1079
417 Ga0496119_0026366 3300048922 Bacteria 4031
418 Ga0496122_0001714 3300048925 Bacteria 34008
419 Ga0496122_0004828 3300048925 Bacteria 16430
420 Ga0496123_0000800 3300048926 Bacteria 50902
421 Ga0496124_0001400 3300048927 Bacteria 36096
422 Ga0496124_0034703 3300048927 Bacteria 4422
423 Ga0496125_0000079 3300048928 Bacteria 230066
424 Ga0496125_0000350 3300048928 Bacteria 87293
425 Ga0496126_0011797 3300048929 Bacteria 8993
426 Ga0496126_0131423 3300048929 Bacteria 2163
427 Ga0501306_000430 3300049127 Bacteria 3171
428 Ga0501308_007801 3300049128 Bacteria 1130
429 Ga0501309_001111 3300049129 Bacteria 2515
430 Ga0501309_008157 3300049129 Bacteria 1312
431 Ga0501305_000363 3300049161 Bacteria 3613
432 Ga0501305_010472 3300049161 Bacteria 1238
433 Ga0501305_038652 3300049161 Bacteria 770
434 Ga0501311_005412 3300049527 Bacteria 1399
435 Ga0501311_010285 3300049527 Bacteria 1133
436 Ga0501311_020480 3300049527 Bacteria 895
437 Ga0501312_006972 3300049528 Bacteria 1427
438 Ga0501312_016926 3300049528 Bacteria 1048
439 Ga0501313_014693 3300049529 Bacteria 928
440 Ga0501313_021089 3300049529 Bacteria 806
441 Ga0501314_003014 3300049530 Bacteria 1337
442 Ga0501315_005366 3300049531 Bacteria 1386
443 Ga0501315_027225 3300049531 Bacteria 806
444 Ga0501316_000806 3300049532 Bacteria 2398
445 Ga0501316_006681 3300049532 Bacteria 1233
446 Ga0501316_008287 3300049532 Bacteria 1145
447 Ga0501317_000791 3300049533 Bacteria 2438
448 Ga0501317_001278 3300049533 Bacteria 2130
449 Ga0501317_004846 3300049533 Bacteria 1417
450 Ga0501317_006012 3300049533 Bacteria 1320
451 Ga0501317_010085 3300049533 Bacteria 1123
452 Ga0501317_011545 3300049533 Bacteria 1076
453 Ga0501318_000267 3300049534 Bacteria 2992
454 Ga0501318_006099 3300049534 Bacteria 1221
455 Ga0501318_010137 3300049534 Bacteria 1040
456 Ga0501318_011249 3300049534 Bacteria 1008
457 Ga0501318_025807 3300049534 Bacteria 772
458 Ga0501318_039139 3300049534 Bacteria 672
459 Ga0501319_005838 3300049535 Bacteria 893
460 Ga0501319_009547 3300049535 Bacteria 761
461 Ga0501320_017617 3300049536 Bacteria 800
462 Ga0501321_003348 3300049537 Bacteria 1461
463 Ga0501321_003647 3300049537 Bacteria 1424
464 Ga0501321_003710 3300049537 Bacteria 1418
465 Ga0501321_009074 3300049537 Bacteria 1068
466 Ga0501323_008812 3300049539 Bacteria 1178
467 Ga0501323_020556 3300049539 Bacteria 868
468 Ga0501324_016024 3300049540 Bacteria 732
469 Ga0501325_001524 3300049541 Bacteria 1441
470 Ga0501325_003713 3300049541 Bacteria 1129
471 Ga0501325_005751 3300049541 Bacteria 996
472 Ga0501328_03360 3300049544 Bacteria 739
473 Ga0501330_000989 3300049546 Bacteria 1394
474 Ga0501332_07784 3300049548 Bacteria 688
475 Ga0501336_002196 3300049552 Bacteria 1239
476 Ga0501336_012196 3300049552 Bacteria 707
477 Ga0501337_002535 3300049553 Bacteria 1122
478 Ga0501031_0000642 3300049568 Bacteria 20719
479 Ga0501031_0001578 3300049568 Bacteria 14208
480 Ga0501032_0003050 3300049569 Bacteria 12975
481 Ga0501032_0065939 3300049569 Bacteria 2420
482 Ga0501032_0125790 3300049569 Bacteria 1693
483 Ga0501033_0011827 3300049570 Bacteria 6671
484 Ga0501033_0141404 3300049570 Bacteria 1739
485 Ga0501033_0226017 3300049570 Bacteria 1331
486 Ga0501034_0074597 3300049571 Bacteria 3400
487 Ga0501034_0094356 3300049571 Bacteria 2988
488 Ga0501036_0009923 3300049572 Bacteria 7843
489 Ga0501036_0036436 3300049572 Bacteria 4163
490 Ga0501037_0000644 3300049573 Bacteria 26982
491 Ga0501037_0127659 3300049573 Bacteria 1825
492 Ga0501037_0169662 3300049573 Bacteria 1552
493 Ga0501038_0002939 3300049574 Bacteria 15900
494 Ga0501038_0008626 3300049574 Bacteria 9357
495 Ga0501039_0004517 3300049575 Bacteria 10509
496 Ga0501039_0012029 3300049575 Bacteria 6594
497 Ga0501039_0436160 3300049575 Bacteria 1029
498 Ga0501040_0000683 3300049576 Bacteria 20884
499 Ga0501040_0015785 3300049576 Bacteria 4992
500 Ga0501041_0003388 3300049577 Bacteria 9172
501 Ga0501041_0026224 3300049577 Bacteria 3505
502 Ga0501041_0037023 3300049577 Bacteria 2955
503 Ga0501041_0161646 3300049577 Bacteria 1400
504 Ga0501041_0516041 3300049577 Bacteria 761
505 Ga0501042_0028841 3300049578 Bacteria 3913
506 Ga0501042_0106265 3300049578 Bacteria 2020
507 Ga0501043_0015445 3300049579 Bacteria 5980
508 Ga0501043_0185785 3300049579 Bacteria 1618
509 Ga0501043_0374225 3300049579 Bacteria 1079
510 Ga0501043_0599528 3300049579 Bacteria 814
511 Ga0501046_0002882 3300049580 Bacteria 15943
512 Ga0501046_0008435 3300049580 Bacteria 8989
513 Ga0501046_0099102 3300049580 Bacteria 2237
514 Ga0501047_0001101 3300049581 Bacteria 26872
515 Ga0501047_0005206 3300049581 Bacteria 12210
516 Ga0501048_0003317 3300049582 Bacteria 12262
517 Ga0501048_0010765 3300049582 Bacteria 6819
518 Ga0501048_0020446 3300049582 Bacteria 4851
519 Ga0501067_0003258 3300049583 Bacteria 8938
520 Ga0501067_0040560 3300049583 Bacteria 2585
521 Ga0501068_0006107 3300049584 Bacteria 6621
522 Ga0501069_0006328 3300049585 Bacteria 6190
523 Ga0501070_0011764 3300049586 Bacteria 7391
524 Ga0501071_0002381 3300049587 Bacteria 11387
525 Ga0501071_0037241 3300049587 Bacteria 3472
526 Ga0501071_0041996 3300049587 Bacteria 3275
527 Ga0501071_0617818 3300049587 Bacteria 833
528 Ga0501072_0000272 3300049588 Bacteria 37385
529 Ga0501072_0003741 3300049588 Bacteria 11483
530 Ga0501073_0034060 3300049589 Bacteria 3625
531 Ga0501074_0032418 3300049590 Bacteria 3785
532 Ga0501074_0146433 3300049590 Bacteria 1689
533 Ga0501075_0002860 3300049591 Bacteria 11571
534 Ga0501075_0518965 3300049591 Bacteria 909
535 Ga0501076_0012191 3300049592 Bacteria 6427
536 Ga0501076_0013200 3300049592 Bacteria 6190
537 Ga0501076_0029246 3300049592 Bacteria 4284
538 Ga0501076_0307900 3300049592 Bacteria 1299
539 Ga0501077_0050145 3300049593 Bacteria 2653
540 Ga0501077_0129884 3300049593 Bacteria 1597
541 Ga0501079_0002499 3300049741 Bacteria 13354
542 Ga0501079_0027019 3300049741 Bacteria 4399
543 Ga0501080_0071086 3300049742 Bacteria 3236
544 Ga0501080_0469812 3300049742 Bacteria 1126
545 Ga0501081_0077251 3300049743 Bacteria 2326
546 Ga0501081_0176867 3300049743 Bacteria 1542
547 Ga0501083_0042679 3300049744 Bacteria 3073
548 Ga0501083_0332887 3300049744 Bacteria 987
549 Ga0501035_0020790 3300049822 Bacteria 6031
550 Ga0501035_0053265 3300049822 Bacteria 3619
551 Ga0501035_0069700 3300049822 Bacteria 3115
552 Ga0501044_0009255 3300049823 Bacteria 10759
553 Ga0501044_0030386 3300049823 Bacteria 5695
554 Ga0501044_0087970 3300049823 Bacteria 3137
555 Ga0501045_0001668 3300049824 Bacteria 14924
556 Ga0501045_0024516 3300049824 Bacteria 4332
557 Ga0501045_0028168 3300049824 Bacteria 4051
558 nmdc:mga03n38_370031_c1 3300050490 Bacteria 783
559 nmdc:mga00v17_61728_c1 3300050491 Bacteria 2304
560 nmdc:mga0yw44_189887_c1 3300050492 Bacteria 1355
561 Ga0495595_0046370 3300053084 Bacteria 2002
562 Ga0495595_0150089 3300053084 Bacteria 1147
563 Ga0495619_0130822 3300053085 Bacteria 1725
564 Ga0495619_0192119 3300053085 Bacteria 1413
565 Ga0500616_0000322 3300053153 Bacteria 68577
566 Ga0500620_137430 3300053155 Bacteria 854
567 Ga0501084_0036974 3300054114 Bacteria 4079
568 Ga0501084_0424727 3300054114 Bacteria 1123
569 Ga0501084_0550152 3300054114 Bacteria 975
570 Ga0587090_011029 3300059510 Bacteria 1264
571 Ga0587106_024304 3300059605 Bacteria 926
572 Ga0587106_026765 3300059605 Bacteria 898
573 Ga0587101_024205 3300059623 Bacteria 900
574 Ga0587072_021749 3300059643 Bacteria 1141
575 Ga0587072_066928 3300059643 Bacteria 752
576 Ga0587079_058739 3300059647 Bacteria 828
577 Ga0587110_006682 3300059654 Bacteria 1075
578 Ga0587119_038615 3300059658 Bacteria 677
579 Ga0501082_0020021 3300060353 Bacteria 5765
580 Ga0501082_0020703 3300060353 Bacteria 5670
581 Ga0501082_0087340 3300060353 Bacteria 2690
582 Ga0501082_0363846 3300060353 Bacteria 1262
583 Ga0530510_0004600 3300061734 Bacteria 9542
584 Ga0530510_0066133 3300061734 Bacteria 2620
585 Ga0530510_0587734 3300061734 Bacteria 847
586 2812365671 2811994880 Bacteria 4147780
587 2537898470 2537561592 Bacteria 4348607
588 2585301919 2582581312 Bacteria 7308206
589 2616899898 2616644941 Bacteria 8510691
590 2643759770 2643221548 Bacteria 8053412
591 2643853459 2643221567 Bacteria 4163945
592 2643897895 2643221578 Bacteria 9213798
593 2643944667 2643221587 Bacteria 7586415
594 2644137419 2643221624 Bacteria 4384879
595 2644385410 2643221670 Bacteria 6497041
596 2644409040 2643221673 Bacteria 9196637
597 2644431565 2643221677 Bacteria 7584031
598 2644444656 2643221679 Bacteria 3839507
599 2644462811 2643221682 Bacteria 6743283
600 2644506679 2643221690 Bacteria 4654705
601 2644526415 2643221694 Bacteria 4392972
602 2644611450 2643221711 Bacteria 4865335
603 2644671081 2643221722 Bacteria 4247614
604 2738692607 2738541272 Bacteria 6848551
605 2739323684 2738543027 Bacteria 6409078
606 2808874872 2808606365 Bacteria 4301966
607 2811848289 2808606982 Bacteria 7791042
608 2812375421 2811994882 Bacteria 4688362
609 2819428153 2818991318 Bacteria 5266538
610 2819668294 2818991458 Bacteria 4794049
611 2819692144 2818991462 Bacteria 4320267
612 2819693660 2818991463 Bacteria 7948711
613 2819729885 2818991469 Bacteria 4644110
614 2835191115 2835188231 Bacteria 3476928
615 2848551784 2848551377 Bacteria 3720646
616 2857480945 2857479173 Bacteria 2469263
617 2857633497 2857632687 Bacteria 2448521
618 2862184881 2862178590 Bacteria 8583590
619 2862579987 2862574272 Bacteria 10567477
620 2870802665 2870801768 Bacteria 2710986
621 2870804745 2870804320 Bacteria 2552467
622 2873156544 2873151551 Bacteria 8625867
623 2875393806 2875391855 Bacteria 7600475
624 2884994952 2884994152 Bacteria 4492978
625 2887443840 2887443736 Bacteria 4426037
626 2912725007 2912723979 Bacteria 8557534
627 2918503837 2918501144 Bacteria 8668083
628 2919447229 2919446982 Bacteria 3994487
629 2935392292 2935390628 Bacteria 7043367
630 2946050846 2946045630 Bacteria 8527308
631 2947230329 2947224130 Bacteria 9938529
632 2966603272 2966598605 Bacteria 7676064
633 3001891867 3001889506 Bacteria 2975194
634 3002998783 3002998708 Bacteria 11715108
635 3006321816 3006321560 Bacteria 8247479
636 3006493232 3006486233 Bacteria 8157040
637 JGI24740J21852_10017617
638 JGI24735J21928_10057845
639 Ga0006778J45830_1054830
640 JGI25406J46586_10024934
641 Ga0006562J51391_1016339
642 Ga0006562J51391_1037323
643 Ga0058863_10168630
644 Ga0070658_10204293
645 Ga0070658_10651637
646 Ga0070683_100081608
647 Ga0070683_100282242
648 Ga0070680_100144028
649 Ga0070680_100224560
650 Ga0070682_100041162
651 Ga0070682_100107696
652 Ga0070682_100534371
653 Ga0070660_100114343
654 Ga0070660_100474291
655 Ga0070687_100181945
656 Ga0070674_100051183
657 Ga0070659_100320024
658 Ga0070714_100001789
659 Ga0070705_100013976
660 Ga0070663_100104701
661 Ga0070663_100693915
662 Ga0070678_100051769
663 Ga0070678_100129343
664 Ga0070678_100341564
665 Ga0070678_100608265
666 Ga0070681_10187459
667 Ga0070681_10584564
668 Ga0068867_100157664
669 Ga0070706_100397046
670 Ga0070698_100756395
671 Ga0070679_100020810
672 Ga0070679_100189952
673 Ga0070672_100365210
674 Ga0070693_100006536
675 Ga0070693_100210615
676 Ga0070664_100328578
677 Ga0070702_100015855
678 Ga0070702_100234662
679 Ga0068852_100094066
680 Ga0068866_10333866
681 Ga0068863_101173746
682 Ga0081539_10001179
683 Ga0070717_10625685
684 Ga0075365_10158595
685 Ga0075432_10003166
686 Ga0070716_100185000
687 Ga0075366_10314461
688 Ga0068871_100729616
689 Ga0068865_100277989
690 Ga0105245_10055442
691 Ga0105243_10132481
692 Ga0105243_10165517
693 Ga0105243_10650097
694 Ga0105243_10734834
695 Ga0105241_10388127
696 Ga0105242_10188981
697 Ga0105242_10415271
698 Ga0105248_10206342
699 Ga0105248_10485604
700 Ga0105237_10514327
701 Ga0105237_10775195
702 Ga0105238_10102242
703 Ga0105238_10881050
704 Ga0105249_10071139
705 Ga0105239_10231793
706 Ga0105239_10884637
707 Ga0105239_11177803
708 Ga0105246_10095584
709 Ga0105246_10123820
710 Ga0157371_10181062
711 Ga0157369_10030211
712 Ga0157369_10241212
713 Ga0157378_10602161
714 Ga0163162_10619986
715 Ga0163162_10879194
716 Ga0157372_10157021
717 Ga0157372_10181282
718 Ga0157372_10468554
719 Ga0157375_10075073
720 Ga0157375_10215058
721 Ga0163161_10278534
722 Ga0163161_10877791
723 Ga0206355_1062385
724 Ga0206355_1376753
725 Ga0206350_10422469
726 Ga0206350_10467590
727 Ga0206353_10276985
728 Ga0224712_10198473
729 Ga0207692_10078502
730 Ga0207647_10008541
731 Ga0207705_10281721
732 Ga0207684_10499509
733 Ga0207693_10093794
734 Ga0207660_10290159
735 Ga0207657_10513344
736 Ga0207652_10019476
737 Ga0207681_10330444
738 Ga0207694_10155871
739 Ga0207694_10268909
740 Ga0207687_10183871
741 Ga0207687_10218582
742 Ga0207664_10025995
743 Ga0207664_10151673
744 Ga0207709_10060703
745 Ga0207709_10157579
746 Ga0207709_10192356
747 Ga0207669_10376442
748 Ga0207704_10013477
749 Ga0207691_10136639
750 Ga0207691_10392597
751 Ga0207661_10215847
752 Ga0207661_10259201
753 Ga0207703_10365812
754 Ga0207678_10149348
755 Ga0207678_10215220
756 Ga0207678_10470458
757 Ga0207678_10511187
758 Ga0207708_10107229
759 Ga0207702_10888915
760 Ga0207641_10293283
761 Ga0207648_10063684
762 Ga0207676_10460592
763 Ga0207675_100318820
764 Ga0207683_10021001
765 Ga0207683_10066226
766 Ga0207683_10120427
767 Ga0207683_10197797
768 Ga0207683_10376529
769 Ga0207698_10077589
770 Ga0207698_10428121
771 Ga0207698_10457734
772 Ga0268264_10391043
773 Ga0265327_10205154
774 Ga0307514_10210324
775 Ga0316575_10000110
776 Ga0316575_10021877
777 Ga0316575_10034532
778 Ga0316579_10003025
779 Ga0316579_10024138
780 Ga0316579_10149810
781 Ga0316576_10032724
782 Ga0316576_10040200
783 Ga0316576_10234769
784 Ga0316576_10442841
785 Ga0316578_10000866
786 Ga0316578_10057638
787 Ga0316578_10080439
788 Ga0307405_10069842
789 Ga0307405_10365861
790 Ga0307405_10638937
791 Ga0316577_10005539
792 Ga0316577_10151235
793 Ga0307413_10083565
794 Ga0307413_10093935
795 Ga0307413_10548302
796 Ga0307413_10613463
797 Ga0307410_10000904
798 Ga0307410_10013185
799 Ga0307410_10086142
800 Ga0307410_10140530
801 Ga0307406_10193850
802 Ga0307407_10035928
803 Ga0307407_10153920
804 Ga0307407_10165928
805 Ga0307412_10067669
806 Ga0307409_100011105
807 Ga0307409_100033653
808 Ga0307409_100073070
809 Ga0307409_100113904
810 Ga0307409_100320672
811 Ga0307416_100018744
812 Ga0307416_100025077
813 Ga0307416_100116719
814 Ga0307416_100162832
815 Ga0307416_100337054
816 Ga0307416_100339213
817 Ga0307411_10127409
818 Ga0307411_10261954
819 Ga0316583_10032635
820 Ga0316583_10034824
821 Ga0316585_10010464
822 Ga0316585_10017658
823 Ga0316580_10009328
824 Ga0316580_10018842
825 Ga0316580_10081558
826 Ga0316593_10011608
827 Ga0316593_10033899
828 Ga0316592_1012981
829 Ga0316592_1018983
830 Ga0316588_1023421
831 Ga0316596_1016716
832 Ga0316596_1029083
833 Ga0373934_0054323
834 Ga0373936_0005616
835 Ga0373957_0011556
836 Ga0373943_0076684
837 Ga0373955_0103755
838 Ga0316574_0004218
839 Ga0316574_0014758
840 Ga0316574_0019250
841 Ga0316574_0342208
842 Ga0373924_0059723
843 Ga0373931_0259884
844 Ga0373933_0008290
845 Ga0373937_0038156
846 Ga0265778_005353
847 Ga0316582_0008420
848 Ga0316582_0028696
849 Ga0316584_0003768
850 Ga0316584_0011467
851 Ga0316584_0077362
852 Ga0316584_0495335
853 Ga0395900_0034125
854 Ga0395898_0030371
855 Ga0395898_0259204
856 Ga0395905_0029015
857 Ga0395905_0139852
858 Ga0395901_0037105
859 Ga0395901_0048393
860 Ga0395901_0183072
861 Ga0395901_0313536
862 Ga0395901_0893106
863 Ga0400485_11442
864 Ga0400486_30354
865 Ga0436363_1538985
866 Ga0436362_0346297
867 Ga0439436_0013087
868 Ga0439436_0016804
869 Ga0439436_0081075
870 Ga0439438_006435
871 Ga0439438_046453
872 Ga0439439_0000385
873 Ga0439447_016195
874 Ga0439447_027150
875 Ga0439461_0009321
876 Ga0439466_0002897
877 Ga0439465_0084365
878 Ga0451791_0326913
879 Ga0451793_0215134
880 Ga0451797_0495029
881 Ga0451797_1029940
882 Ga0451802_0226522
883 Ga0451807_0001797
884 Ga0451833_0450366
885 Ga0451837_0259585
886 Ga0451849_0359593
887 Ga0451843_0765211
888 Ga0451853_1980724
889 Ga0439433_0000411
890 Ga0439433_0000904
891 Ga0439442_021836
892 Ga0439432_028835
893 Ga0439432_044806
894 Ga0439449_0000879
895 Ga0439449_0025193
896 Ga0439452_002345
897 Ga0439457_003049
898 Ga0439462_0016900
899 Ga0439462_0022181
900 Ga0439462_0064009
901 Ga0450919_004567
902 Ga0450920_001738
903 Ga0450900_014169
904 Ga0450910_011533
905 Ga0439446_0000569
906 Ga0439434_0002125
907 Ga0439434_0018392
908 Ga0439460_0112154
909 Ga0450918_002295
910 Ga0450901_016597
911 Ga0466965_0016847
912 Ga0466960_0018942
913 Ga0466960_0149145
914 Ga0466958_0042912
915 Ga0466967_0311693
916 Ga0495592_0358786
917 Ga0495603_0168357
918 Ga0495629_0024271
919 Ga0495641_0081627
920 Ga0495651_0036045
921 Ga0495653_0011041
922 Ga0495653_0081953
923 Ga0495653_0416997
924 Ga0495582_0352327
925 Ga0495664_0151898
926 Ga0495585_0012050
927 Ga0495585_0078252
928 Ga0495594_0015192
929 Ga0495607_0149540
930 Ga0495620_0073825
931 Ga0495628_0224778
932 Ga0495631_0168884
933 Ga0495648_0241317
934 Ga0495666_0173516
935 Ga0495665_0357243
936 Ga0495640_0167030
937 Ga0495640_0178999
938 Ga0495640_0280039
939 Ga0495587_0131288
940 Ga0495645_0330123
941 Ga0495622_0007761
942 Ga0495667_0002317
943 Ga0495667_0113642
944 Ga0495656_0243595
945 Ga0495611_0026629
946 Ga0495625_0100062
947 Ga0495625_0256158
948 Ga0495635_0010704
949 Ga0495635_0379937
950 Ga0495635_0489021
951 Ga0495588_0012319
952 Ga0495588_0118071
953 Ga0495657_0174647
954 Ga0495623_0074204
955 Ga0495646_0026169
956 Ga0495646_0278368
957 Ga0495658_0089870
958 Ga0495613_0000533
959 Ga0495624_0411133
960 Ga0495649_0120794
961 Ga0495589_0036718
962 Ga0495600_0155279
963 Ga0495581_0057699
964 Ga0495581_0264880
965 Ga0495604_0176869
966 Ga0495636_0019555
967 Ga0495636_0166347
968 Ga0495674_0410585
969 Ga0495676_0004789
970 Ga0495676_0072644
971 Ga0495676_0165604
972 Ga0495676_0300912
973 Ga0495680_0039019
974 Ga0495680_0619197
975 Ga0495675_0197625
976 Ga0495684_0037735
977 Ga0495593_0130935
978 Ga0495593_0173614
979 Ga0495614_0004809
980 Ga0495614_0023284
981 Ga0496100_0255735
982 Ga0496100_0279775
983 Ga0496100_0401377
984 Ga0496100_0794841
985 Ga0496101_0033137
986 Ga0496101_0121286
987 Ga0496101_0156336
988 Ga0496101_0168283
989 Ga0496101_0294793
990 Ga0496101_0395340
991 Ga0496102_0002600
992 Ga0496102_0062548
993 Ga0496102_0083055
994 Ga0496102_0185161
995 Ga0496102_0189069
996 Ga0496102_0634561
997 Ga0496103_0030356
998 Ga0496103_0043837
999 Ga0496103_0050247
1000 Ga0496104_0010288
1001 Ga0496104_0088185
1002 Ga0496104_0100415
1003 Ga0496104_0203065
1004 Ga0496104_0225201
1005 Ga0496104_0232225
1006 Ga0496104_0286174
1007 Ga0496104_0325222
1008 Ga0496104_0349470
1009 Ga0496105_0000828
1010 Ga0496105_0096997
1011 Ga0496105_0159610
1012 Ga0496105_0487207
1013 Ga0496105_0549371
1014 Ga0496106_0064977
1015 Ga0496106_0204155
1016 Ga0496106_0297572
1017 Ga0496107_0089273
1018 Ga0496107_0091736
1019 Ga0496107_0267775
1020 Ga0496108_0074897
1021 Ga0496108_0249133
1022 Ga0496108_0644275
1023 Ga0496109_0055975
1024 Ga0496109_0280545
1025 Ga0496109_0374598
1026 Ga0496110_0051176
1027 Ga0496110_0070348
1028 Ga0496110_0108648
1029 Ga0496111_0068418
1030 Ga0496111_0078278
1031 Ga0496111_0088231
1032 Ga0496111_0133156
1033 Ga0496111_0159139
1034 Ga0496111_0701701
1035 Ga0496113_0219459
1036 Ga0496113_0293870
1037 Ga0496113_0460595
1038 Ga0496114_0045246
1039 Ga0496114_0061484
1040 Ga0496114_0115947
1041 Ga0496114_0117401
1042 Ga0496114_0156235
1043 Ga0496114_0246599
1044 Ga0496114_0619441
1045 Ga0496114_0682859
1046 Ga0496115_0038896
1047 Ga0496115_0043528
1048 Ga0496115_0185808
1049 Ga0496115_0275668
1050 Ga0496115_0398000
1051 Ga0496118_0089381
1052 Ga0496118_0227595
1053 Ga0496119_0026366
1054 Ga0496122_0001714
1055 Ga0496122_0004828
1056 Ga0496123_0000800
1057 Ga0496124_0001400
1058 Ga0496124_0034703
1059 Ga0496125_0000079
1060 Ga0496125_0000350
1061 Ga0496126_0011797
1062 Ga0496126_0131423
1063 Ga0501306_000430
1064 Ga0501308_007801
1065 Ga0501309_001111
1066 Ga0501309_008157
1067 Ga0501305_000363
1068 Ga0501305_010472
1069 Ga0501305_038652
1070 Ga0501311_005412
1071 Ga0501311_010285
1072 Ga0501311_020480
1073 Ga0501312_006972
1074 Ga0501312_016926
1075 Ga0501313_014693
1076 Ga0501313_021089
1077 Ga0501314_003014
1078 Ga0501315_005366
1079 Ga0501315_027225
1080 Ga0501316_000806
1081 Ga0501316_006681
1082 Ga0501316_008287
1083 Ga0501317_000791
1084 Ga0501317_001278
1085 Ga0501317_004846
1086 Ga0501317_006012
1087 Ga0501317_010085
1088 Ga0501317_011545
1089 Ga0501318_000267
1090 Ga0501318_006099
1091 Ga0501318_010137
1092 Ga0501318_011249
1093 Ga0501318_025807
1094 Ga0501318_039139
1095 Ga0501319_005838
1096 Ga0501319_009547
1097 Ga0501320_017617
1098 Ga0501321_003348
1099 Ga0501321_003647
1100 Ga0501321_003710
1101 Ga0501321_009074
1102 Ga0501323_008812
1103 Ga0501323_020556
1104 Ga0501324_016024
1105 Ga0501325_001524
1106 Ga0501325_003713
1107 Ga0501325_005751
1108 Ga0501328_03360
1109 Ga0501330_000989
1110 Ga0501332_07784
1111 Ga0501336_002196
1112 Ga0501336_012196
1113 Ga0501337_002535
1114 Ga0501031_0000642
1115 Ga0501031_0001578
1116 Ga0501032_0003050
1117 Ga0501032_0065939
1118 Ga0501032_0125790
1119 Ga0501033_0011827
1120 Ga0501033_0141404
1121 Ga0501033_0226017
1122 Ga0501034_0074597
1123 Ga0501034_0094356
1124 Ga0501036_0009923
1125 Ga0501036_0036436
1126 Ga0501037_0000644
1127 Ga0501037_0127659
1128 Ga0501037_0169662
1129 Ga0501038_0002939
1130 Ga0501038_0008626
1131 Ga0501039_0004517
1132 Ga0501039_0012029
1133 Ga0501039_0436160
1134 Ga0501040_0000683
1135 Ga0501040_0015785
1136 Ga0501041_0003388
1137 Ga0501041_0026224
1138 Ga0501041_0037023
1139 Ga0501041_0161646
1140 Ga0501041_0516041
1141 Ga0501042_0028841
1142 Ga0501042_0106265
1143 Ga0501043_0015445
1144 Ga0501043_0185785
1145 Ga0501043_0374225
1146 Ga0501043_0599528
1147 Ga0501046_0002882
1148 Ga0501046_0008435
1149 Ga0501046_0099102
1150 Ga0501047_0001101
1151 Ga0501047_0005206
1152 Ga0501048_0003317
1153 Ga0501048_0010765
1154 Ga0501048_0020446
1155 Ga0501067_0003258
1156 Ga0501067_0040560
1157 Ga0501068_0006107
1158 Ga0501069_0006328
1159 Ga0501070_0011764
1160 Ga0501071_0002381
1161 Ga0501071_0037241
1162 Ga0501071_0041996
1163 Ga0501071_0617818
1164 Ga0501072_0000272
1165 Ga0501072_0003741
1166 Ga0501073_0034060
1167 Ga0501074_0032418
1168 Ga0501074_0146433
1169 Ga0501075_0002860
1170 Ga0501075_0518965
1171 Ga0501076_0012191
1172 Ga0501076_0013200
1173 Ga0501076_0029246
1174 Ga0501076_0307900
1175 Ga0501077_0050145
1176 Ga0501077_0129884
1177 Ga0501079_0002499
1178 Ga0501079_0027019
1179 Ga0501080_0071086
1180 Ga0501080_0469812
1181 Ga0501081_0077251
1182 Ga0501081_0176867
1183 Ga0501083_0042679
1184 Ga0501083_0332887
1185 Ga0501035_0020790
1186 Ga0501035_0053265
1187 Ga0501035_0069700
1188 Ga0501044_0009255
1189 Ga0501044_0030386
1190 Ga0501044_0087970
1191 Ga0501045_0001668
1192 Ga0501045_0024516
1193 Ga0501045_0028168
1194 nmdc:mga03n38_370031_c1
1195 nmdc:mga00v17_61728_c1
1196 nmdc:mga0yw44_189887_c1
1197 Ga0495595_0046370
1198 Ga0495595_0150089
1199 Ga0495619_0130822
1200 Ga0495619_0192119
1201 Ga0500616_0000322
1202 Ga0500620_137430
1203 Ga0501084_0036974
1204 Ga0501084_0424727
1205 Ga0501084_0550152
1206 Ga0587090_011029
1207 Ga0587106_024304
1208 Ga0587106_026765
1209 Ga0587101_024205
1210 Ga0587072_021749
1211 Ga0587072_066928
1212 Ga0587079_058739
1213 Ga0587110_006682
1214 Ga0587119_038615
1215 Ga0501082_0020021
1216 Ga0501082_0020703
1217 Ga0501082_0087340
1218 Ga0501082_0363846
1219 Ga0530510_0004600
1220 Ga0530510_0066133
1221 Ga0530510_0587734
1222 2812365671
1223 2537898470
1224 2585301919
1225 2616899898
1226 2643759770
1227 2643853459
1228 2643897895
1229 2643944667
1230 2644137419
1231 2644385410
1232 2644409040
1233 2644431565
1234 2644444656
1235 2644462811
1236 2644506679
1237 2644526415
1238 2644611450
1239 2644671081
1240 2738692607
1241 2739323684
1242 2808874872
1243 2811848289
1244 2812375421
1245 2819428153
1246 2819668294
1247 2819692144
1248 2819693660
1249 2819729885
1250 2835191115
1251 2848551784
1252 2857480945
1253 2857633497
1254 2862184881
1255 2862579987
1256 2870802665
1257 2870804745
1258 2873156544
1259 2875393806
1260 2884994952
1261 2887443840
1262 2912725007
1263 2918503837
1264 2919447229
1265 2935392292
1266 2946050846
1267 2947230329
1268 2966603272
1269 3001891867
1270 3002998783
1271 3006321816
1272 3006493232

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00574

CLP_protease

Clp protease

53

232

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p81-assembly2.cif.gz_R crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) 0.988 14 185
7p81-assembly2.cif.gz_T crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) 0.9866 14 185
7p81-assembly1.cif.gz_K crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) 0.986 14 185
3hln-assembly2.cif.gz_T crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds 0.9851 14 186
6hwn-assembly1.cif.gz_A structure of thermus thermophilus clpp in complex with a tripeptide. 0.9822 14 186
ID Description Score Start End Superfamily
1yg8S00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9733 14 186 3.90.226.10
af_P9WPC3_1_214_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9627 15 184 3.90.226.10
4u0hE00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9386 8 187 3.90.226.10
1yg8S00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9362 14 186 3.90.226.10
1y7oA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9331 8 186 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2G6R668-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9938 71 189 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117
AF-A0A199VE53-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9918 94 184 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0009536
GO:0051117
AF-A0A1M3LVE2-F1-model_v4 ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92) (Endopeptidase Clp) 0.9893 15 186 GO:0004176
GO:0004252
GO:0005737
GO:0006515
GO:0009368
GO:0051117
AF-A0A2V7JB18-F1-model_v4 ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92) 0.9891 14 122 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0016020
GO:0051117
AF-N6WC57-F1-model_v4 ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92) (Endopeptidase Clp) 0.9882 12 191 GO:0004176
GO:0004252
GO:0005737
GO:0006515
GO:0009368
GO:0051117

Map