F471393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 636 | 360 | 1272 | 208 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2811994880|2812365671 |
| Length | 244 |
| Sequence | SRALGSLQRADAGRGGCHRHRPPGGGDELDESDEGAFVNEQVPAIARAESPGLGLNDHIYNRLLRERIIWLGSEVRDENANAICAQMMLLAAEDPDKDIWLYINSPGGSITAGMAIYDTMQYIKPDVATIAMGMAASMGQFLLSSGAKGKRYATPHARVMMHQPSGGIGGTATDVRINAQLILHMKKVLADLIAEQTGKTSEQIHADSDRDRWFTAPEALEYGFIDHVVTSAHSVAGGGGTARG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 57 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 89 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 90 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 91 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 92 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 93 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 94 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 96 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 97 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 98 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 99 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 100 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 102 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 103 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 104 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 105 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 106 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 107 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 112 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 113 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 114 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 115 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 116 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 117 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 118 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 119 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 120 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 123 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 129 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 130 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 131 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 132 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 133 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 134 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 135 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 136 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 137 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 138 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 139 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 145 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 146 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 147 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 148 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 149 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 150 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 151 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 152 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 153 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 154 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 155 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 156 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 157 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 158 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 159 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 160 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 161 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 162 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 163 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 164 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 165 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 166 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 231 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 232 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 233 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 234 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 299 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 300 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 310 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 311 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 312 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 313 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 314 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 315 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 316 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 317 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 318 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 319 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 320 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 321 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 322 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 323 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 324 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 325 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 326 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 327 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 328 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 329 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 330 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 331 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 332 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 333 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 334 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 335 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 336 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 337 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 338 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 339 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 340 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 341 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 342 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 343 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 344 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 345 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 346 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 347 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 348 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 349 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 350 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 351 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 352 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 353 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 354 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 355 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 356 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 357 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 358 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 359 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 360 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.72 |
| Metatranscriptomes | 12.26 |
| Isolates | 8.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.1 |
| Nodule | 0.16 |
| Rhizoplane | 11.95 |
| Rhizosphere | 78.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10017617 | 3300001979 | Bacteria | 2549 |
| 2 | JGI24735J21928_10057845 | 3300002067 | Bacteria | 1115 |
| 3 | Ga0006778J45830_1054830 | 3300003162 | Bacteria | 675 |
| 4 | JGI25406J46586_10024934 | 3300003203 | Bacteria | 2332 |
| 5 | Ga0006562J51391_1016339 | 3300003578 | Bacteria | 2720 |
| 6 | Ga0006562J51391_1037323 | 3300003578 | Bacteria | 2893 |
| 7 | Ga0058863_10168630 | 3300004799 | Bacteria | 742 |
| 8 | Ga0070658_10204293 | 3300005327 | Bacteria | 1668 |
| 9 | Ga0070658_10651637 | 3300005327 | Bacteria | 914 |
| 10 | Ga0070683_100081608 | 3300005329 | Bacteria | 3028 |
| 11 | Ga0070683_100282242 | 3300005329 | Bacteria | 1579 |
| 12 | Ga0070680_100144028 | 3300005336 | Bacteria | 1999 |
| 13 | Ga0070680_100224560 | 3300005336 | Bacteria | 1585 |
| 14 | Ga0070682_100041162 | 3300005337 | Bacteria | 2847 |
| 15 | Ga0070682_100107696 | 3300005337 | Bacteria | 1851 |
| 16 | Ga0070682_100534371 | 3300005337 | Bacteria | 915 |
| 17 | Ga0070660_100114343 | 3300005339 | Bacteria | 2149 |
| 18 | Ga0070660_100474291 | 3300005339 | Bacteria | 1039 |
| 19 | Ga0070687_100181945 | 3300005343 | Bacteria | 1260 |
| 20 | Ga0070674_100051183 | 3300005356 | Bacteria | 2845 |
| 21 | Ga0070659_100320024 | 3300005366 | Bacteria | 1297 |
| 22 | Ga0070714_100001789 | 3300005435 | Bacteria | 15646 |
| 23 | Ga0070705_100013976 | 3300005440 | Bacteria | 4118 |
| 24 | Ga0070663_100104701 | 3300005455 | Bacteria | 2117 |
| 25 | Ga0070663_100693915 | 3300005455 | Bacteria | 865 |
| 26 | Ga0070678_100051769 | 3300005456 | Bacteria | 2978 |
| 27 | Ga0070678_100129343 | 3300005456 | Bacteria | 2004 |
| 28 | Ga0070678_100341564 | 3300005456 | Bacteria | 1285 |
| 29 | Ga0070678_100608265 | 3300005456 | Bacteria | 976 |
| 30 | Ga0070681_10187459 | 3300005458 | Bacteria | 1989 |
| 31 | Ga0070681_10584564 | 3300005458 | Bacteria | 1031 |
| 32 | Ga0068867_100157664 | 3300005459 | Bacteria | 1788 |
| 33 | Ga0070706_100397046 | 3300005467 | Bacteria | 1284 |
| 34 | Ga0070698_100756395 | 3300005471 | Bacteria | 915 |
| 35 | Ga0070679_100020810 | 3300005530 | Bacteria | 6399 |
| 36 | Ga0070679_100189952 | 3300005530 | Bacteria | 2023 |
| 37 | Ga0070672_100365210 | 3300005543 | Bacteria | 1232 |
| 38 | Ga0070693_100006536 | 3300005547 | Bacteria | 5653 |
| 39 | Ga0070693_100210615 | 3300005547 | Bacteria | 1268 |
| 40 | Ga0070664_100328578 | 3300005564 | Bacteria | 1387 |
| 41 | Ga0070702_100015855 | 3300005615 | Bacteria | 3856 |
| 42 | Ga0070702_100234662 | 3300005615 | Bacteria | 1235 |
| 43 | Ga0068852_100094066 | 3300005616 | Bacteria | 2688 |
| 44 | Ga0068866_10333866 | 3300005718 | Bacteria | 958 |
| 45 | Ga0068863_101173746 | 3300005841 | Bacteria | 773 |
| 46 | Ga0081539_10001179 | 3300005985 | Bacteria | 47264 |
| 47 | Ga0070717_10625685 | 3300006028 | Bacteria | 977 |
| 48 | Ga0075365_10158595 | 3300006038 | Bacteria | 1576 |
| 49 | Ga0075432_10003166 | 3300006058 | Bacteria | 5551 |
| 50 | Ga0070716_100185000 | 3300006173 | Bacteria | 1371 |
| 51 | Ga0075366_10314461 | 3300006195 | Bacteria | 959 |
| 52 | Ga0068871_100729616 | 3300006358 | Bacteria | 909 |
| 53 | Ga0068865_100277989 | 3300006881 | Bacteria | 1332 |
| 54 | Ga0105245_10055442 | 3300009098 | Bacteria | 3560 |
| 55 | Ga0105243_10132481 | 3300009148 | Bacteria | 2117 |
| 56 | Ga0105243_10165517 | 3300009148 | Bacteria | 1910 |
| 57 | Ga0105243_10650097 | 3300009148 | Bacteria | 1022 |
| 58 | Ga0105243_10734834 | 3300009148 | Bacteria | 966 |
| 59 | Ga0105241_10388127 | 3300009174 | Bacteria | 1222 |
| 60 | Ga0105242_10188981 | 3300009176 | Bacteria | 1822 |
| 61 | Ga0105242_10415271 | 3300009176 | Bacteria | 1259 |
| 62 | Ga0105248_10206342 | 3300009177 | Bacteria | 2214 |
| 63 | Ga0105248_10485604 | 3300009177 | Bacteria | 1392 |
| 64 | Ga0105237_10514327 | 3300009545 | Bacteria | 1204 |
| 65 | Ga0105237_10775195 | 3300009545 | Bacteria | 966 |
| 66 | Ga0105238_10102242 | 3300009551 | Bacteria | 2848 |
| 67 | Ga0105238_10881050 | 3300009551 | Bacteria | 913 |
| 68 | Ga0105249_10071139 | 3300009553 | Bacteria | 3213 |
| 69 | Ga0105239_10231793 | 3300010375 | Bacteria | 2071 |
| 70 | Ga0105239_10884637 | 3300010375 | Bacteria | 1025 |
| 71 | Ga0105239_11177803 | 3300010375 | Bacteria | 883 |
| 72 | Ga0105246_10095584 | 3300011119 | Bacteria | 2152 |
| 73 | Ga0105246_10123820 | 3300011119 | Bacteria | 1920 |
| 74 | Ga0157371_10181062 | 3300013102 | Bacteria | 1507 |
| 75 | Ga0157369_10030211 | 3300013105 | Bacteria | 5977 |
| 76 | Ga0157369_10241212 | 3300013105 | Bacteria | 1888 |
| 77 | Ga0157378_10602161 | 3300013297 | Bacteria | 1110 |
| 78 | Ga0163162_10619986 | 3300013306 | Bacteria | 1207 |
| 79 | Ga0163162_10879194 | 3300013306 | Bacteria | 1010 |
| 80 | Ga0157372_10157021 | 3300013307 | Bacteria | 2628 |
| 81 | Ga0157372_10181282 | 3300013307 | Bacteria | 2438 |
| 82 | Ga0157372_10468554 | 3300013307 | Bacteria | 1468 |
| 83 | Ga0157375_10075073 | 3300013308 | Bacteria | 3404 |
| 84 | Ga0157375_10215058 | 3300013308 | Bacteria | 2080 |
| 85 | Ga0163161_10278534 | 3300017792 | Bacteria | 1311 |
| 86 | Ga0163161_10877791 | 3300017792 | Bacteria | 758 |
| 87 | Ga0206355_1062385 | 3300020076 | Bacteria | 2200 |
| 88 | Ga0206355_1376753 | 3300020076 | Bacteria | 1247 |
| 89 | Ga0206350_10422469 | 3300020080 | Bacteria | 1423 |
| 90 | Ga0206350_10467590 | 3300020080 | Bacteria | 1081 |
| 91 | Ga0206353_10276985 | 3300020082 | Bacteria | 1712 |
| 92 | Ga0224712_10198473 | 3300022467 | Bacteria | 911 |
| 93 | Ga0207692_10078502 | 3300025898 | Bacteria | 1759 |
| 94 | Ga0207647_10008541 | 3300025904 | Bacteria | 7334 |
| 95 | Ga0207705_10281721 | 3300025909 | Bacteria | 1273 |
| 96 | Ga0207684_10499509 | 3300025910 | Bacteria | 1043 |
| 97 | Ga0207693_10093794 | 3300025915 | Bacteria | 2353 |
| 98 | Ga0207660_10290159 | 3300025917 | Bacteria | 1301 |
| 99 | Ga0207657_10513344 | 3300025919 | Bacteria | 938 |
| 100 | Ga0207652_10019476 | 3300025921 | Bacteria | 5582 |
| 101 | Ga0207681_10330444 | 3300025923 | Bacteria | 1215 |
| 102 | Ga0207694_10155871 | 3300025924 | Bacteria | 1842 |
| 103 | Ga0207694_10268909 | 3300025924 | Bacteria | 1398 |
| 104 | Ga0207687_10183871 | 3300025927 | Bacteria | 1621 |
| 105 | Ga0207687_10218582 | 3300025927 | Bacteria | 1499 |
| 106 | Ga0207664_10025995 | 3300025929 | Bacteria | 4418 |
| 107 | Ga0207664_10151673 | 3300025929 | Bacteria | 1969 |
| 108 | Ga0207709_10060703 | 3300025935 | Bacteria | 2359 |
| 109 | Ga0207709_10157579 | 3300025935 | Bacteria | 1580 |
| 110 | Ga0207709_10192356 | 3300025935 | Bacteria | 1450 |
| 111 | Ga0207669_10376442 | 3300025937 | Bacteria | 1105 |
| 112 | Ga0207704_10013477 | 3300025938 | Bacteria | 4092 |
| 113 | Ga0207691_10136639 | 3300025940 | Bacteria | 2162 |
| 114 | Ga0207691_10392597 | 3300025940 | Bacteria | 1184 |
| 115 | Ga0207661_10215847 | 3300025944 | Bacteria | 1693 |
| 116 | Ga0207661_10259201 | 3300025944 | Bacteria | 1548 |
| 117 | Ga0207703_10365812 | 3300026035 | Bacteria | 1331 |
| 118 | Ga0207678_10149348 | 3300026067 | Bacteria | 1995 |
| 119 | Ga0207678_10215220 | 3300026067 | Bacteria | 1644 |
| 120 | Ga0207678_10470458 | 3300026067 | Bacteria | 1094 |
| 121 | Ga0207678_10511187 | 3300026067 | Bacteria | 1048 |
| 122 | Ga0207708_10107229 | 3300026075 | Bacteria | 2166 |
| 123 | Ga0207702_10888915 | 3300026078 | Bacteria | 883 |
| 124 | Ga0207641_10293283 | 3300026088 | Bacteria | 1534 |
| 125 | Ga0207648_10063684 | 3300026089 | Bacteria | 3213 |
| 126 | Ga0207676_10460592 | 3300026095 | Bacteria | 1201 |
| 127 | Ga0207675_100318820 | 3300026118 | Bacteria | 1517 |
| 128 | Ga0207683_10021001 | 3300026121 | Bacteria | 5589 |
| 129 | Ga0207683_10066226 | 3300026121 | Bacteria | 3185 |
| 130 | Ga0207683_10120427 | 3300026121 | Bacteria | 2355 |
| 131 | Ga0207683_10197797 | 3300026121 | Bacteria | 1826 |
| 132 | Ga0207683_10376529 | 3300026121 | Bacteria | 1304 |
| 133 | Ga0207698_10077589 | 3300026142 | Bacteria | 2664 |
| 134 | Ga0207698_10428121 | 3300026142 | Bacteria | 1272 |
| 135 | Ga0207698_10457734 | 3300026142 | Bacteria | 1233 |
| 136 | Ga0268264_10391043 | 3300028381 | Bacteria | 1334 |
| 137 | Ga0265327_10205154 | 3300031251 | Bacteria | 891 |
| 138 | Ga0307514_10210324 | 3300031649 | Bacteria | 1209 |
| 139 | Ga0316575_10000110 | 3300031665 | Bacteria | 20680 |
| 140 | Ga0316575_10021877 | 3300031665 | Bacteria | 2465 |
| 141 | Ga0316575_10034532 | 3300031665 | Bacteria | 1986 |
| 142 | Ga0316579_10003025 | 3300031691 | Bacteria | 6467 |
| 143 | Ga0316579_10024138 | 3300031691 | Bacteria | 2735 |
| 144 | Ga0316579_10149810 | 3300031691 | Bacteria | 1125 |
| 145 | Ga0316576_10032724 | 3300031727 | Bacteria | 3696 |
| 146 | Ga0316576_10040200 | 3300031727 | Bacteria | 3360 |
| 147 | Ga0316576_10234769 | 3300031727 | Bacteria | 1378 |
| 148 | Ga0316576_10442841 | 3300031727 | Bacteria | 960 |
| 149 | Ga0316578_10000866 | 3300031728 | Bacteria | 11358 |
| 150 | Ga0316578_10057638 | 3300031728 | Bacteria | 2282 |
| 151 | Ga0316578_10080439 | 3300031728 | Bacteria | 1938 |
| 152 | Ga0307405_10069842 | 3300031731 | Bacteria | 2253 |
| 153 | Ga0307405_10365861 | 3300031731 | Bacteria | 1118 |
| 154 | Ga0307405_10638937 | 3300031731 | Bacteria | 874 |
| 155 | Ga0316577_10005539 | 3300031733 | Bacteria | 6626 |
| 156 | Ga0316577_10151235 | 3300031733 | Bacteria | 1308 |
| 157 | Ga0307413_10083565 | 3300031824 | Bacteria | 2055 |
| 158 | Ga0307413_10093935 | 3300031824 | Bacteria | 1962 |
| 159 | Ga0307413_10548302 | 3300031824 | Bacteria | 937 |
| 160 | Ga0307413_10613463 | 3300031824 | Bacteria | 892 |
| 161 | Ga0307410_10000904 | 3300031852 | Bacteria | 12655 |
| 162 | Ga0307410_10013185 | 3300031852 | Bacteria | 4812 |
| 163 | Ga0307410_10086142 | 3300031852 | Bacteria | 2219 |
| 164 | Ga0307410_10140530 | 3300031852 | Bacteria | 1786 |
| 165 | Ga0307406_10193850 | 3300031901 | Bacteria | 1490 |
| 166 | Ga0307407_10035928 | 3300031903 | Bacteria | 2726 |
| 167 | Ga0307407_10153920 | 3300031903 | Bacteria | 1497 |
| 168 | Ga0307407_10165928 | 3300031903 | Bacteria | 1450 |
| 169 | Ga0307412_10067669 | 3300031911 | Bacteria | 2426 |
| 170 | Ga0307409_100011105 | 3300031995 | Bacteria | 5653 |
| 171 | Ga0307409_100033653 | 3300031995 | Bacteria | 3733 |
| 172 | Ga0307409_100073070 | 3300031995 | Bacteria | 2734 |
| 173 | Ga0307409_100113904 | 3300031995 | Bacteria | 2274 |
| 174 | Ga0307409_100320672 | 3300031995 | Bacteria | 1450 |
| 175 | Ga0307416_100018744 | 3300032002 | Bacteria | 4886 |
| 176 | Ga0307416_100025077 | 3300032002 | Bacteria | 4365 |
| 177 | Ga0307416_100116719 | 3300032002 | Bacteria | 2367 |
| 178 | Ga0307416_100162832 | 3300032002 | Bacteria | 2064 |
| 179 | Ga0307416_100337054 | 3300032002 | Bacteria | 1519 |
| 180 | Ga0307416_100339213 | 3300032002 | Bacteria | 1515 |
| 181 | Ga0307411_10127409 | 3300032005 | Bacteria | 1854 |
| 182 | Ga0307411_10261954 | 3300032005 | Bacteria | 1366 |
| 183 | Ga0316583_10032635 | 3300032133 | Bacteria | 1851 |
| 184 | Ga0316583_10034824 | 3300032133 | Bacteria | 1787 |
| 185 | Ga0316585_10010464 | 3300032137 | Bacteria | 2721 |
| 186 | Ga0316585_10017658 | 3300032137 | Bacteria | 2159 |
| 187 | Ga0316580_10009328 | 3300032139 | Bacteria | 2947 |
| 188 | Ga0316580_10018842 | 3300032139 | Bacteria | 2125 |
| 189 | Ga0316580_10081558 | 3300032139 | Bacteria | 989 |
| 190 | Ga0316593_10011608 | 3300032168 | Bacteria | 2565 |
| 191 | Ga0316593_10033899 | 3300032168 | Bacteria | 1674 |
| 192 | Ga0316592_1012981 | 3300033524 | Bacteria | 1713 |
| 193 | Ga0316592_1018983 | 3300033524 | Bacteria | 1452 |
| 194 | Ga0316588_1023421 | 3300033528 | Bacteria | 1417 |
| 195 | Ga0316596_1016716 | 3300033541 | Bacteria | 1839 |
| 196 | Ga0316596_1029083 | 3300033541 | Bacteria | 1430 |
| 197 | Ga0373934_0054323 | 3300035086 | Bacteria | 1590 |
| 198 | Ga0373936_0005616 | 3300035113 | Bacteria | 4728 |
| 199 | Ga0373957_0011556 | 3300035120 | Bacteria | 2951 |
| 200 | Ga0373943_0076684 | 3300035170 | Bacteria | 1706 |
| 201 | Ga0373955_0103755 | 3300035172 | Bacteria | 1635 |
| 202 | Ga0316574_0004218 | 3300035398 | Bacteria | 7498 |
| 203 | Ga0316574_0014758 | 3300035398 | Bacteria | 4521 |
| 204 | Ga0316574_0019250 | 3300035398 | Bacteria | 4023 |
| 205 | Ga0316574_0342208 | 3300035398 | Bacteria | 947 |
| 206 | Ga0373924_0059723 | 3300035410 | Bacteria | 1593 |
| 207 | Ga0373931_0259884 | 3300035691 | Bacteria | 1059 |
| 208 | Ga0373933_0008290 | 3300035724 | Bacteria | 5674 |
| 209 | Ga0373937_0038156 | 3300036401 | Bacteria | 4378 |
| 210 | Ga0265778_005353 | 3300036457 | Bacteria | 1355 |
| 211 | Ga0316582_0008420 | 3300036647 | Bacteria | 5543 |
| 212 | Ga0316582_0028696 | 3300036647 | Bacteria | 3373 |
| 213 | Ga0316584_0003768 | 3300036712 | Bacteria | 9934 |
| 214 | Ga0316584_0011467 | 3300036712 | Bacteria | 6227 |
| 215 | Ga0316584_0077362 | 3300036712 | Bacteria | 2492 |
| 216 | Ga0316584_0495335 | 3300036712 | Bacteria | 859 |
| 217 | Ga0395900_0034125 | 3300037418 | Bacteria | 5238 |
| 218 | Ga0395898_0030371 | 3300037466 | Bacteria | 5407 |
| 219 | Ga0395898_0259204 | 3300037466 | Bacteria | 1658 |
| 220 | Ga0395905_0029015 | 3300037471 | Bacteria | 5215 |
| 221 | Ga0395905_0139852 | 3300037471 | Bacteria | 2278 |
| 222 | Ga0395901_0037105 | 3300038443 | Bacteria | 5041 |
| 223 | Ga0395901_0048393 | 3300038443 | Bacteria | 4415 |
| 224 | Ga0395901_0183072 | 3300038443 | Bacteria | 2197 |
| 225 | Ga0395901_0313536 | 3300038443 | Bacteria | 1624 |
| 226 | Ga0395901_0893106 | 3300038443 | Bacteria | 871 |
| 227 | Ga0400485_11442 | 3300038735 | Bacteria | 19231 |
| 228 | Ga0400486_30354 | 3300038742 | Bacteria | 18891 |
| 229 | Ga0436363_1538985 | 3300039450 | Bacteria | 785 |
| 230 | Ga0436362_0346297 | 3300039453 | Bacteria | 1161 |
| 231 | Ga0439436_0013087 | 3300041404 | Bacteria | 2512 |
| 232 | Ga0439436_0016804 | 3300041404 | Bacteria | 2192 |
| 233 | Ga0439436_0081075 | 3300041404 | Bacteria | 903 |
| 234 | Ga0439438_006435 | 3300041405 | Bacteria | 4139 |
| 235 | Ga0439438_046453 | 3300041405 | Bacteria | 1115 |
| 236 | Ga0439439_0000385 | 3300041406 | Bacteria | 7277 |
| 237 | Ga0439447_016195 | 3300041407 | Bacteria | 2052 |
| 238 | Ga0439447_027150 | 3300041407 | Bacteria | 1463 |
| 239 | Ga0439461_0009321 | 3300041410 | Bacteria | 1778 |
| 240 | Ga0439466_0002897 | 3300041411 | Bacteria | 6706 |
| 241 | Ga0439465_0084365 | 3300041413 | Bacteria | 1081 |
| 242 | Ga0451791_0326913 | 3300041451 | Bacteria | 1644 |
| 243 | Ga0451793_0215134 | 3300041452 | Bacteria | 2777 |
| 244 | Ga0451797_0495029 | 3300041453 | Bacteria | 1633 |
| 245 | Ga0451797_1029940 | 3300041453 | Bacteria | 1081 |
| 246 | Ga0451802_0226522 | 3300041460 | Bacteria | 1163 |
| 247 | Ga0451807_0001797 | 3300041486 | Bacteria | 2102 |
| 248 | Ga0451833_0450366 | 3300041491 | Bacteria | 1778 |
| 249 | Ga0451837_0259585 | 3300041494 | Bacteria | 3931 |
| 250 | Ga0451849_0359593 | 3300041505 | Bacteria | 948 |
| 251 | Ga0451843_0765211 | 3300041509 | Bacteria | 893 |
| 252 | Ga0451853_1980724 | 3300041512 | Bacteria | 1848 |
| 253 | Ga0439433_0000411 | 3300041999 | Bacteria | 7761 |
| 254 | Ga0439433_0000904 | 3300041999 | Bacteria | 5911 |
| 255 | Ga0439442_021836 | 3300042002 | Bacteria | 1327 |
| 256 | Ga0439432_028835 | 3300042006 | Bacteria | 1806 |
| 257 | Ga0439432_044806 | 3300042006 | Bacteria | 1393 |
| 258 | Ga0439449_0000879 | 3300042007 | Bacteria | 11744 |
| 259 | Ga0439449_0025193 | 3300042007 | Bacteria | 2223 |
| 260 | Ga0439452_002345 | 3300042010 | Bacteria | 7059 |
| 261 | Ga0439457_003049 | 3300042014 | Bacteria | 4637 |
| 262 | Ga0439462_0016900 | 3300042015 | Bacteria | 1888 |
| 263 | Ga0439462_0022181 | 3300042015 | Bacteria | 1660 |
| 264 | Ga0439462_0064009 | 3300042015 | Bacteria | 996 |
| 265 | Ga0450919_004567 | 3300042121 | Bacteria | 1688 |
| 266 | Ga0450920_001738 | 3300042122 | Bacteria | 3651 |
| 267 | Ga0450900_014169 | 3300042136 | Bacteria | 1061 |
| 268 | Ga0450910_011533 | 3300042147 | Bacteria | 1269 |
| 269 | Ga0439446_0000569 | 3300042156 | Bacteria | 7508 |
| 270 | Ga0439434_0002125 | 3300042435 | Bacteria | 5733 |
| 271 | Ga0439434_0018392 | 3300042435 | Bacteria | 2092 |
| 272 | Ga0439460_0112154 | 3300042461 | Bacteria | 886 |
| 273 | Ga0450918_002295 | 3300042531 | Bacteria | 3620 |
| 274 | Ga0450901_016597 | 3300042533 | Bacteria | 777 |
| 275 | Ga0466965_0016847 | 3300044683 | Bacteria | 3485 |
| 276 | Ga0466960_0018942 | 3300044901 | Bacteria | 3024 |
| 277 | Ga0466960_0149145 | 3300044901 | Bacteria | 1248 |
| 278 | Ga0466958_0042912 | 3300045836 | Bacteria | 2723 |
| 279 | Ga0466967_0311693 | 3300045976 | Bacteria | 1516 |
| 280 | Ga0495592_0358786 | 3300046454 | Bacteria | 933 |
| 281 | Ga0495603_0168357 | 3300046455 | Bacteria | 1269 |
| 282 | Ga0495629_0024271 | 3300046459 | Bacteria | 4317 |
| 283 | Ga0495641_0081627 | 3300046461 | Bacteria | 1448 |
| 284 | Ga0495651_0036045 | 3300046462 | Bacteria | 3850 |
| 285 | Ga0495653_0011041 | 3300046463 | Bacteria | 7387 |
| 286 | Ga0495653_0081953 | 3300046463 | Bacteria | 2383 |
| 287 | Ga0495653_0416997 | 3300046463 | Bacteria | 850 |
| 288 | Ga0495582_0352327 | 3300046473 | Bacteria | 848 |
| 289 | Ga0495664_0151898 | 3300046477 | Bacteria | 1405 |
| 290 | Ga0495585_0012050 | 3300046492 | Bacteria | 5102 |
| 291 | Ga0495585_0078252 | 3300046492 | Bacteria | 1794 |
| 292 | Ga0495594_0015192 | 3300046499 | Bacteria | 4044 |
| 293 | Ga0495607_0149540 | 3300046501 | Bacteria | 1196 |
| 294 | Ga0495620_0073825 | 3300046515 | Bacteria | 1390 |
| 295 | Ga0495628_0224778 | 3300046516 | Bacteria | 1409 |
| 296 | Ga0495631_0168884 | 3300046518 | Bacteria | 938 |
| 297 | Ga0495648_0241317 | 3300046524 | Bacteria | 878 |
| 298 | Ga0495666_0173516 | 3300046526 | Bacteria | 997 |
| 299 | Ga0495665_0357243 | 3300046531 | Bacteria | 744 |
| 300 | Ga0495640_0167030 | 3300046533 | Bacteria | 1407 |
| 301 | Ga0495640_0178999 | 3300046533 | Bacteria | 1352 |
| 302 | Ga0495640_0280039 | 3300046533 | Bacteria | 1039 |
| 303 | Ga0495587_0131288 | 3300046536 | Bacteria | 1431 |
| 304 | Ga0495645_0330123 | 3300046543 | Bacteria | 988 |
| 305 | Ga0495622_0007761 | 3300046557 | Bacteria | 4984 |
| 306 | Ga0495667_0002317 | 3300046559 | Bacteria | 12755 |
| 307 | Ga0495667_0113642 | 3300046559 | Bacteria | 1750 |
| 308 | Ga0495656_0243595 | 3300046615 | Bacteria | 906 |
| 309 | Ga0495611_0026629 | 3300046648 | Bacteria | 2523 |
| 310 | Ga0495625_0100062 | 3300046660 | Bacteria | 1993 |
| 311 | Ga0495625_0256158 | 3300046660 | Bacteria | 1134 |
| 312 | Ga0495635_0010704 | 3300046663 | Bacteria | 6423 |
| 313 | Ga0495635_0379937 | 3300046663 | Bacteria | 940 |
| 314 | Ga0495635_0489021 | 3300046663 | Bacteria | 811 |
| 315 | Ga0495588_0012319 | 3300046674 | Bacteria | 4038 |
| 316 | Ga0495588_0118071 | 3300046674 | Bacteria | 1398 |
| 317 | Ga0495657_0174647 | 3300046675 | Bacteria | 1321 |
| 318 | Ga0495623_0074204 | 3300046679 | Bacteria | 2114 |
| 319 | Ga0495646_0026169 | 3300046680 | Bacteria | 3665 |
| 320 | Ga0495646_0278368 | 3300046680 | Bacteria | 890 |
| 321 | Ga0495658_0089870 | 3300046683 | Bacteria | 1817 |
| 322 | Ga0495613_0000533 | 3300046689 | Bacteria | 31681 |
| 323 | Ga0495624_0411133 | 3300046690 | Bacteria | 812 |
| 324 | Ga0495649_0120794 | 3300046694 | Bacteria | 1386 |
| 325 | Ga0495589_0036718 | 3300046794 | Bacteria | 2455 |
| 326 | Ga0495600_0155279 | 3300046809 | Bacteria | 1480 |
| 327 | Ga0495581_0057699 | 3300047315 | Bacteria | 2241 |
| 328 | Ga0495581_0264880 | 3300047315 | Bacteria | 1005 |
| 329 | Ga0495604_0176869 | 3300047317 | Bacteria | 1495 |
| 330 | Ga0495636_0019555 | 3300047318 | Bacteria | 2723 |
| 331 | Ga0495636_0166347 | 3300047318 | Bacteria | 995 |
| 332 | Ga0495674_0410585 | 3300047319 | Bacteria | 1092 |
| 333 | Ga0495676_0004789 | 3300047321 | Bacteria | 12393 |
| 334 | Ga0495676_0072644 | 3300047321 | Bacteria | 2641 |
| 335 | Ga0495676_0165604 | 3300047321 | Bacteria | 1560 |
| 336 | Ga0495676_0300912 | 3300047321 | Bacteria | 1082 |
| 337 | Ga0495680_0039019 | 3300047322 | Bacteria | 3791 |
| 338 | Ga0495680_0619197 | 3300047322 | Bacteria | 722 |
| 339 | Ga0495675_0197625 | 3300047444 | Bacteria | 1225 |
| 340 | Ga0495684_0037735 | 3300047471 | Bacteria | 3706 |
| 341 | Ga0495593_0130935 | 3300047673 | Bacteria | 1273 |
| 342 | Ga0495593_0173614 | 3300047673 | Bacteria | 1086 |
| 343 | Ga0495614_0004809 | 3300048089 | Bacteria | 6098 |
| 344 | Ga0495614_0023284 | 3300048089 | Bacteria | 2672 |
| 345 | Ga0496100_0255735 | 3300048903 | Bacteria | 1297 |
| 346 | Ga0496100_0279775 | 3300048903 | Bacteria | 1243 |
| 347 | Ga0496100_0401377 | 3300048903 | Bacteria | 1044 |
| 348 | Ga0496100_0794841 | 3300048903 | Bacteria | 741 |
| 349 | Ga0496101_0033137 | 3300048904 | Bacteria | 3642 |
| 350 | Ga0496101_0121286 | 3300048904 | Bacteria | 1977 |
| 351 | Ga0496101_0156336 | 3300048904 | Bacteria | 1747 |
| 352 | Ga0496101_0168283 | 3300048904 | Bacteria | 1683 |
| 353 | Ga0496101_0294793 | 3300048904 | Bacteria | 1269 |
| 354 | Ga0496101_0395340 | 3300048904 | Bacteria | 1088 |
| 355 | Ga0496102_0002600 | 3300048905 | Bacteria | 15400 |
| 356 | Ga0496102_0062548 | 3300048905 | Bacteria | 3408 |
| 357 | Ga0496102_0083055 | 3300048905 | Bacteria | 2955 |
| 358 | Ga0496102_0185161 | 3300048905 | Bacteria | 1962 |
| 359 | Ga0496102_0189069 | 3300048905 | Bacteria | 1940 |
| 360 | Ga0496102_0634561 | 3300048905 | Bacteria | 991 |
| 361 | Ga0496103_0030356 | 3300048906 | Bacteria | 3289 |
| 362 | Ga0496103_0043837 | 3300048906 | Bacteria | 2755 |
| 363 | Ga0496103_0050247 | 3300048906 | Bacteria | 2579 |
| 364 | Ga0496104_0010288 | 3300048907 | Bacteria | 8353 |
| 365 | Ga0496104_0088185 | 3300048907 | Bacteria | 2963 |
| 366 | Ga0496104_0100415 | 3300048907 | Bacteria | 2770 |
| 367 | Ga0496104_0203065 | 3300048907 | Bacteria | 1894 |
| 368 | Ga0496104_0225201 | 3300048907 | Bacteria | 1787 |
| 369 | Ga0496104_0232225 | 3300048907 | Bacteria | 1756 |
| 370 | Ga0496104_0286174 | 3300048907 | Bacteria | 1561 |
| 371 | Ga0496104_0325222 | 3300048907 | Bacteria | 1451 |
| 372 | Ga0496104_0349470 | 3300048907 | Bacteria | 1391 |
| 373 | Ga0496105_0000828 | 3300048908 | Bacteria | 21030 |
| 374 | Ga0496105_0096997 | 3300048908 | Bacteria | 2435 |
| 375 | Ga0496105_0159610 | 3300048908 | Bacteria | 1851 |
| 376 | Ga0496105_0487207 | 3300048908 | Bacteria | 969 |
| 377 | Ga0496105_0549371 | 3300048908 | Bacteria | 901 |
| 378 | Ga0496106_0064977 | 3300048909 | Bacteria | 2777 |
| 379 | Ga0496106_0204155 | 3300048909 | Bacteria | 1573 |
| 380 | Ga0496106_0297572 | 3300048909 | Bacteria | 1294 |
| 381 | Ga0496107_0089273 | 3300048910 | Bacteria | 2251 |
| 382 | Ga0496107_0091736 | 3300048910 | Bacteria | 2220 |
| 383 | Ga0496107_0267775 | 3300048910 | Bacteria | 1272 |
| 384 | Ga0496108_0074897 | 3300048911 | Bacteria | 2859 |
| 385 | Ga0496108_0249133 | 3300048911 | Bacteria | 1545 |
| 386 | Ga0496108_0644275 | 3300048911 | Bacteria | 921 |
| 387 | Ga0496109_0055975 | 3300048912 | Bacteria | 3598 |
| 388 | Ga0496109_0280545 | 3300048912 | Bacteria | 1570 |
| 389 | Ga0496109_0374598 | 3300048912 | Bacteria | 1345 |
| 390 | Ga0496110_0051176 | 3300048913 | Bacteria | 3630 |
| 391 | Ga0496110_0070348 | 3300048913 | Bacteria | 3100 |
| 392 | Ga0496110_0108648 | 3300048913 | Bacteria | 2491 |
| 393 | Ga0496111_0068418 | 3300048914 | Bacteria | 2581 |
| 394 | Ga0496111_0078278 | 3300048914 | Bacteria | 2411 |
| 395 | Ga0496111_0088231 | 3300048914 | Bacteria | 2271 |
| 396 | Ga0496111_0133156 | 3300048914 | Bacteria | 1840 |
| 397 | Ga0496111_0159139 | 3300048914 | Bacteria | 1676 |
| 398 | Ga0496111_0701701 | 3300048914 | Bacteria | 736 |
| 399 | Ga0496113_0219459 | 3300048916 | Bacteria | 1515 |
| 400 | Ga0496113_0293870 | 3300048916 | Bacteria | 1300 |
| 401 | Ga0496113_0460595 | 3300048916 | Bacteria | 1022 |
| 402 | Ga0496114_0045246 | 3300048917 | Bacteria | 3656 |
| 403 | Ga0496114_0061484 | 3300048917 | Bacteria | 3141 |
| 404 | Ga0496114_0115947 | 3300048917 | Bacteria | 2299 |
| 405 | Ga0496114_0117401 | 3300048917 | Bacteria | 2285 |
| 406 | Ga0496114_0156235 | 3300048917 | Bacteria | 1981 |
| 407 | Ga0496114_0246599 | 3300048917 | Bacteria | 1571 |
| 408 | Ga0496114_0619441 | 3300048917 | Bacteria | 953 |
| 409 | Ga0496114_0682859 | 3300048917 | Bacteria | 901 |
| 410 | Ga0496115_0038896 | 3300048918 | Bacteria | 3777 |
| 411 | Ga0496115_0043528 | 3300048918 | Bacteria | 3581 |
| 412 | Ga0496115_0185808 | 3300048918 | Bacteria | 1717 |
| 413 | Ga0496115_0275668 | 3300048918 | Bacteria | 1381 |
| 414 | Ga0496115_0398000 | 3300048918 | Bacteria | 1118 |
| 415 | Ga0496118_0089381 | 3300048921 | Bacteria | 2126 |
| 416 | Ga0496118_0227595 | 3300048921 | Bacteria | 1079 |
| 417 | Ga0496119_0026366 | 3300048922 | Bacteria | 4031 |
| 418 | Ga0496122_0001714 | 3300048925 | Bacteria | 34008 |
| 419 | Ga0496122_0004828 | 3300048925 | Bacteria | 16430 |
| 420 | Ga0496123_0000800 | 3300048926 | Bacteria | 50902 |
| 421 | Ga0496124_0001400 | 3300048927 | Bacteria | 36096 |
| 422 | Ga0496124_0034703 | 3300048927 | Bacteria | 4422 |
| 423 | Ga0496125_0000079 | 3300048928 | Bacteria | 230066 |
| 424 | Ga0496125_0000350 | 3300048928 | Bacteria | 87293 |
| 425 | Ga0496126_0011797 | 3300048929 | Bacteria | 8993 |
| 426 | Ga0496126_0131423 | 3300048929 | Bacteria | 2163 |
| 427 | Ga0501306_000430 | 3300049127 | Bacteria | 3171 |
| 428 | Ga0501308_007801 | 3300049128 | Bacteria | 1130 |
| 429 | Ga0501309_001111 | 3300049129 | Bacteria | 2515 |
| 430 | Ga0501309_008157 | 3300049129 | Bacteria | 1312 |
| 431 | Ga0501305_000363 | 3300049161 | Bacteria | 3613 |
| 432 | Ga0501305_010472 | 3300049161 | Bacteria | 1238 |
| 433 | Ga0501305_038652 | 3300049161 | Bacteria | 770 |
| 434 | Ga0501311_005412 | 3300049527 | Bacteria | 1399 |
| 435 | Ga0501311_010285 | 3300049527 | Bacteria | 1133 |
| 436 | Ga0501311_020480 | 3300049527 | Bacteria | 895 |
| 437 | Ga0501312_006972 | 3300049528 | Bacteria | 1427 |
| 438 | Ga0501312_016926 | 3300049528 | Bacteria | 1048 |
| 439 | Ga0501313_014693 | 3300049529 | Bacteria | 928 |
| 440 | Ga0501313_021089 | 3300049529 | Bacteria | 806 |
| 441 | Ga0501314_003014 | 3300049530 | Bacteria | 1337 |
| 442 | Ga0501315_005366 | 3300049531 | Bacteria | 1386 |
| 443 | Ga0501315_027225 | 3300049531 | Bacteria | 806 |
| 444 | Ga0501316_000806 | 3300049532 | Bacteria | 2398 |
| 445 | Ga0501316_006681 | 3300049532 | Bacteria | 1233 |
| 446 | Ga0501316_008287 | 3300049532 | Bacteria | 1145 |
| 447 | Ga0501317_000791 | 3300049533 | Bacteria | 2438 |
| 448 | Ga0501317_001278 | 3300049533 | Bacteria | 2130 |
| 449 | Ga0501317_004846 | 3300049533 | Bacteria | 1417 |
| 450 | Ga0501317_006012 | 3300049533 | Bacteria | 1320 |
| 451 | Ga0501317_010085 | 3300049533 | Bacteria | 1123 |
| 452 | Ga0501317_011545 | 3300049533 | Bacteria | 1076 |
| 453 | Ga0501318_000267 | 3300049534 | Bacteria | 2992 |
| 454 | Ga0501318_006099 | 3300049534 | Bacteria | 1221 |
| 455 | Ga0501318_010137 | 3300049534 | Bacteria | 1040 |
| 456 | Ga0501318_011249 | 3300049534 | Bacteria | 1008 |
| 457 | Ga0501318_025807 | 3300049534 | Bacteria | 772 |
| 458 | Ga0501318_039139 | 3300049534 | Bacteria | 672 |
| 459 | Ga0501319_005838 | 3300049535 | Bacteria | 893 |
| 460 | Ga0501319_009547 | 3300049535 | Bacteria | 761 |
| 461 | Ga0501320_017617 | 3300049536 | Bacteria | 800 |
| 462 | Ga0501321_003348 | 3300049537 | Bacteria | 1461 |
| 463 | Ga0501321_003647 | 3300049537 | Bacteria | 1424 |
| 464 | Ga0501321_003710 | 3300049537 | Bacteria | 1418 |
| 465 | Ga0501321_009074 | 3300049537 | Bacteria | 1068 |
| 466 | Ga0501323_008812 | 3300049539 | Bacteria | 1178 |
| 467 | Ga0501323_020556 | 3300049539 | Bacteria | 868 |
| 468 | Ga0501324_016024 | 3300049540 | Bacteria | 732 |
| 469 | Ga0501325_001524 | 3300049541 | Bacteria | 1441 |
| 470 | Ga0501325_003713 | 3300049541 | Bacteria | 1129 |
| 471 | Ga0501325_005751 | 3300049541 | Bacteria | 996 |
| 472 | Ga0501328_03360 | 3300049544 | Bacteria | 739 |
| 473 | Ga0501330_000989 | 3300049546 | Bacteria | 1394 |
| 474 | Ga0501332_07784 | 3300049548 | Bacteria | 688 |
| 475 | Ga0501336_002196 | 3300049552 | Bacteria | 1239 |
| 476 | Ga0501336_012196 | 3300049552 | Bacteria | 707 |
| 477 | Ga0501337_002535 | 3300049553 | Bacteria | 1122 |
| 478 | Ga0501031_0000642 | 3300049568 | Bacteria | 20719 |
| 479 | Ga0501031_0001578 | 3300049568 | Bacteria | 14208 |
| 480 | Ga0501032_0003050 | 3300049569 | Bacteria | 12975 |
| 481 | Ga0501032_0065939 | 3300049569 | Bacteria | 2420 |
| 482 | Ga0501032_0125790 | 3300049569 | Bacteria | 1693 |
| 483 | Ga0501033_0011827 | 3300049570 | Bacteria | 6671 |
| 484 | Ga0501033_0141404 | 3300049570 | Bacteria | 1739 |
| 485 | Ga0501033_0226017 | 3300049570 | Bacteria | 1331 |
| 486 | Ga0501034_0074597 | 3300049571 | Bacteria | 3400 |
| 487 | Ga0501034_0094356 | 3300049571 | Bacteria | 2988 |
| 488 | Ga0501036_0009923 | 3300049572 | Bacteria | 7843 |
| 489 | Ga0501036_0036436 | 3300049572 | Bacteria | 4163 |
| 490 | Ga0501037_0000644 | 3300049573 | Bacteria | 26982 |
| 491 | Ga0501037_0127659 | 3300049573 | Bacteria | 1825 |
| 492 | Ga0501037_0169662 | 3300049573 | Bacteria | 1552 |
| 493 | Ga0501038_0002939 | 3300049574 | Bacteria | 15900 |
| 494 | Ga0501038_0008626 | 3300049574 | Bacteria | 9357 |
| 495 | Ga0501039_0004517 | 3300049575 | Bacteria | 10509 |
| 496 | Ga0501039_0012029 | 3300049575 | Bacteria | 6594 |
| 497 | Ga0501039_0436160 | 3300049575 | Bacteria | 1029 |
| 498 | Ga0501040_0000683 | 3300049576 | Bacteria | 20884 |
| 499 | Ga0501040_0015785 | 3300049576 | Bacteria | 4992 |
| 500 | Ga0501041_0003388 | 3300049577 | Bacteria | 9172 |
| 501 | Ga0501041_0026224 | 3300049577 | Bacteria | 3505 |
| 502 | Ga0501041_0037023 | 3300049577 | Bacteria | 2955 |
| 503 | Ga0501041_0161646 | 3300049577 | Bacteria | 1400 |
| 504 | Ga0501041_0516041 | 3300049577 | Bacteria | 761 |
| 505 | Ga0501042_0028841 | 3300049578 | Bacteria | 3913 |
| 506 | Ga0501042_0106265 | 3300049578 | Bacteria | 2020 |
| 507 | Ga0501043_0015445 | 3300049579 | Bacteria | 5980 |
| 508 | Ga0501043_0185785 | 3300049579 | Bacteria | 1618 |
| 509 | Ga0501043_0374225 | 3300049579 | Bacteria | 1079 |
| 510 | Ga0501043_0599528 | 3300049579 | Bacteria | 814 |
| 511 | Ga0501046_0002882 | 3300049580 | Bacteria | 15943 |
| 512 | Ga0501046_0008435 | 3300049580 | Bacteria | 8989 |
| 513 | Ga0501046_0099102 | 3300049580 | Bacteria | 2237 |
| 514 | Ga0501047_0001101 | 3300049581 | Bacteria | 26872 |
| 515 | Ga0501047_0005206 | 3300049581 | Bacteria | 12210 |
| 516 | Ga0501048_0003317 | 3300049582 | Bacteria | 12262 |
| 517 | Ga0501048_0010765 | 3300049582 | Bacteria | 6819 |
| 518 | Ga0501048_0020446 | 3300049582 | Bacteria | 4851 |
| 519 | Ga0501067_0003258 | 3300049583 | Bacteria | 8938 |
| 520 | Ga0501067_0040560 | 3300049583 | Bacteria | 2585 |
| 521 | Ga0501068_0006107 | 3300049584 | Bacteria | 6621 |
| 522 | Ga0501069_0006328 | 3300049585 | Bacteria | 6190 |
| 523 | Ga0501070_0011764 | 3300049586 | Bacteria | 7391 |
| 524 | Ga0501071_0002381 | 3300049587 | Bacteria | 11387 |
| 525 | Ga0501071_0037241 | 3300049587 | Bacteria | 3472 |
| 526 | Ga0501071_0041996 | 3300049587 | Bacteria | 3275 |
| 527 | Ga0501071_0617818 | 3300049587 | Bacteria | 833 |
| 528 | Ga0501072_0000272 | 3300049588 | Bacteria | 37385 |
| 529 | Ga0501072_0003741 | 3300049588 | Bacteria | 11483 |
| 530 | Ga0501073_0034060 | 3300049589 | Bacteria | 3625 |
| 531 | Ga0501074_0032418 | 3300049590 | Bacteria | 3785 |
| 532 | Ga0501074_0146433 | 3300049590 | Bacteria | 1689 |
| 533 | Ga0501075_0002860 | 3300049591 | Bacteria | 11571 |
| 534 | Ga0501075_0518965 | 3300049591 | Bacteria | 909 |
| 535 | Ga0501076_0012191 | 3300049592 | Bacteria | 6427 |
| 536 | Ga0501076_0013200 | 3300049592 | Bacteria | 6190 |
| 537 | Ga0501076_0029246 | 3300049592 | Bacteria | 4284 |
| 538 | Ga0501076_0307900 | 3300049592 | Bacteria | 1299 |
| 539 | Ga0501077_0050145 | 3300049593 | Bacteria | 2653 |
| 540 | Ga0501077_0129884 | 3300049593 | Bacteria | 1597 |
| 541 | Ga0501079_0002499 | 3300049741 | Bacteria | 13354 |
| 542 | Ga0501079_0027019 | 3300049741 | Bacteria | 4399 |
| 543 | Ga0501080_0071086 | 3300049742 | Bacteria | 3236 |
| 544 | Ga0501080_0469812 | 3300049742 | Bacteria | 1126 |
| 545 | Ga0501081_0077251 | 3300049743 | Bacteria | 2326 |
| 546 | Ga0501081_0176867 | 3300049743 | Bacteria | 1542 |
| 547 | Ga0501083_0042679 | 3300049744 | Bacteria | 3073 |
| 548 | Ga0501083_0332887 | 3300049744 | Bacteria | 987 |
| 549 | Ga0501035_0020790 | 3300049822 | Bacteria | 6031 |
| 550 | Ga0501035_0053265 | 3300049822 | Bacteria | 3619 |
| 551 | Ga0501035_0069700 | 3300049822 | Bacteria | 3115 |
| 552 | Ga0501044_0009255 | 3300049823 | Bacteria | 10759 |
| 553 | Ga0501044_0030386 | 3300049823 | Bacteria | 5695 |
| 554 | Ga0501044_0087970 | 3300049823 | Bacteria | 3137 |
| 555 | Ga0501045_0001668 | 3300049824 | Bacteria | 14924 |
| 556 | Ga0501045_0024516 | 3300049824 | Bacteria | 4332 |
| 557 | Ga0501045_0028168 | 3300049824 | Bacteria | 4051 |
| 558 | nmdc:mga03n38_370031_c1 | 3300050490 | Bacteria | 783 |
| 559 | nmdc:mga00v17_61728_c1 | 3300050491 | Bacteria | 2304 |
| 560 | nmdc:mga0yw44_189887_c1 | 3300050492 | Bacteria | 1355 |
| 561 | Ga0495595_0046370 | 3300053084 | Bacteria | 2002 |
| 562 | Ga0495595_0150089 | 3300053084 | Bacteria | 1147 |
| 563 | Ga0495619_0130822 | 3300053085 | Bacteria | 1725 |
| 564 | Ga0495619_0192119 | 3300053085 | Bacteria | 1413 |
| 565 | Ga0500616_0000322 | 3300053153 | Bacteria | 68577 |
| 566 | Ga0500620_137430 | 3300053155 | Bacteria | 854 |
| 567 | Ga0501084_0036974 | 3300054114 | Bacteria | 4079 |
| 568 | Ga0501084_0424727 | 3300054114 | Bacteria | 1123 |
| 569 | Ga0501084_0550152 | 3300054114 | Bacteria | 975 |
| 570 | Ga0587090_011029 | 3300059510 | Bacteria | 1264 |
| 571 | Ga0587106_024304 | 3300059605 | Bacteria | 926 |
| 572 | Ga0587106_026765 | 3300059605 | Bacteria | 898 |
| 573 | Ga0587101_024205 | 3300059623 | Bacteria | 900 |
| 574 | Ga0587072_021749 | 3300059643 | Bacteria | 1141 |
| 575 | Ga0587072_066928 | 3300059643 | Bacteria | 752 |
| 576 | Ga0587079_058739 | 3300059647 | Bacteria | 828 |
| 577 | Ga0587110_006682 | 3300059654 | Bacteria | 1075 |
| 578 | Ga0587119_038615 | 3300059658 | Bacteria | 677 |
| 579 | Ga0501082_0020021 | 3300060353 | Bacteria | 5765 |
| 580 | Ga0501082_0020703 | 3300060353 | Bacteria | 5670 |
| 581 | Ga0501082_0087340 | 3300060353 | Bacteria | 2690 |
| 582 | Ga0501082_0363846 | 3300060353 | Bacteria | 1262 |
| 583 | Ga0530510_0004600 | 3300061734 | Bacteria | 9542 |
| 584 | Ga0530510_0066133 | 3300061734 | Bacteria | 2620 |
| 585 | Ga0530510_0587734 | 3300061734 | Bacteria | 847 |
| 586 | 2812365671 | 2811994880 | Bacteria | 4147780 |
| 587 | 2537898470 | 2537561592 | Bacteria | 4348607 |
| 588 | 2585301919 | 2582581312 | Bacteria | 7308206 |
| 589 | 2616899898 | 2616644941 | Bacteria | 8510691 |
| 590 | 2643759770 | 2643221548 | Bacteria | 8053412 |
| 591 | 2643853459 | 2643221567 | Bacteria | 4163945 |
| 592 | 2643897895 | 2643221578 | Bacteria | 9213798 |
| 593 | 2643944667 | 2643221587 | Bacteria | 7586415 |
| 594 | 2644137419 | 2643221624 | Bacteria | 4384879 |
| 595 | 2644385410 | 2643221670 | Bacteria | 6497041 |
| 596 | 2644409040 | 2643221673 | Bacteria | 9196637 |
| 597 | 2644431565 | 2643221677 | Bacteria | 7584031 |
| 598 | 2644444656 | 2643221679 | Bacteria | 3839507 |
| 599 | 2644462811 | 2643221682 | Bacteria | 6743283 |
| 600 | 2644506679 | 2643221690 | Bacteria | 4654705 |
| 601 | 2644526415 | 2643221694 | Bacteria | 4392972 |
| 602 | 2644611450 | 2643221711 | Bacteria | 4865335 |
| 603 | 2644671081 | 2643221722 | Bacteria | 4247614 |
| 604 | 2738692607 | 2738541272 | Bacteria | 6848551 |
| 605 | 2739323684 | 2738543027 | Bacteria | 6409078 |
| 606 | 2808874872 | 2808606365 | Bacteria | 4301966 |
| 607 | 2811848289 | 2808606982 | Bacteria | 7791042 |
| 608 | 2812375421 | 2811994882 | Bacteria | 4688362 |
| 609 | 2819428153 | 2818991318 | Bacteria | 5266538 |
| 610 | 2819668294 | 2818991458 | Bacteria | 4794049 |
| 611 | 2819692144 | 2818991462 | Bacteria | 4320267 |
| 612 | 2819693660 | 2818991463 | Bacteria | 7948711 |
| 613 | 2819729885 | 2818991469 | Bacteria | 4644110 |
| 614 | 2835191115 | 2835188231 | Bacteria | 3476928 |
| 615 | 2848551784 | 2848551377 | Bacteria | 3720646 |
| 616 | 2857480945 | 2857479173 | Bacteria | 2469263 |
| 617 | 2857633497 | 2857632687 | Bacteria | 2448521 |
| 618 | 2862184881 | 2862178590 | Bacteria | 8583590 |
| 619 | 2862579987 | 2862574272 | Bacteria | 10567477 |
| 620 | 2870802665 | 2870801768 | Bacteria | 2710986 |
| 621 | 2870804745 | 2870804320 | Bacteria | 2552467 |
| 622 | 2873156544 | 2873151551 | Bacteria | 8625867 |
| 623 | 2875393806 | 2875391855 | Bacteria | 7600475 |
| 624 | 2884994952 | 2884994152 | Bacteria | 4492978 |
| 625 | 2887443840 | 2887443736 | Bacteria | 4426037 |
| 626 | 2912725007 | 2912723979 | Bacteria | 8557534 |
| 627 | 2918503837 | 2918501144 | Bacteria | 8668083 |
| 628 | 2919447229 | 2919446982 | Bacteria | 3994487 |
| 629 | 2935392292 | 2935390628 | Bacteria | 7043367 |
| 630 | 2946050846 | 2946045630 | Bacteria | 8527308 |
| 631 | 2947230329 | 2947224130 | Bacteria | 9938529 |
| 632 | 2966603272 | 2966598605 | Bacteria | 7676064 |
| 633 | 3001891867 | 3001889506 | Bacteria | 2975194 |
| 634 | 3002998783 | 3002998708 | Bacteria | 11715108 |
| 635 | 3006321816 | 3006321560 | Bacteria | 8247479 |
| 636 | 3006493232 | 3006486233 | Bacteria | 8157040 |
| 637 | JGI24740J21852_10017617 | |||
| 638 | JGI24735J21928_10057845 | |||
| 639 | Ga0006778J45830_1054830 | |||
| 640 | JGI25406J46586_10024934 | |||
| 641 | Ga0006562J51391_1016339 | |||
| 642 | Ga0006562J51391_1037323 | |||
| 643 | Ga0058863_10168630 | |||
| 644 | Ga0070658_10204293 | |||
| 645 | Ga0070658_10651637 | |||
| 646 | Ga0070683_100081608 | |||
| 647 | Ga0070683_100282242 | |||
| 648 | Ga0070680_100144028 | |||
| 649 | Ga0070680_100224560 | |||
| 650 | Ga0070682_100041162 | |||
| 651 | Ga0070682_100107696 | |||
| 652 | Ga0070682_100534371 | |||
| 653 | Ga0070660_100114343 | |||
| 654 | Ga0070660_100474291 | |||
| 655 | Ga0070687_100181945 | |||
| 656 | Ga0070674_100051183 | |||
| 657 | Ga0070659_100320024 | |||
| 658 | Ga0070714_100001789 | |||
| 659 | Ga0070705_100013976 | |||
| 660 | Ga0070663_100104701 | |||
| 661 | Ga0070663_100693915 | |||
| 662 | Ga0070678_100051769 | |||
| 663 | Ga0070678_100129343 | |||
| 664 | Ga0070678_100341564 | |||
| 665 | Ga0070678_100608265 | |||
| 666 | Ga0070681_10187459 | |||
| 667 | Ga0070681_10584564 | |||
| 668 | Ga0068867_100157664 | |||
| 669 | Ga0070706_100397046 | |||
| 670 | Ga0070698_100756395 | |||
| 671 | Ga0070679_100020810 | |||
| 672 | Ga0070679_100189952 | |||
| 673 | Ga0070672_100365210 | |||
| 674 | Ga0070693_100006536 | |||
| 675 | Ga0070693_100210615 | |||
| 676 | Ga0070664_100328578 | |||
| 677 | Ga0070702_100015855 | |||
| 678 | Ga0070702_100234662 | |||
| 679 | Ga0068852_100094066 | |||
| 680 | Ga0068866_10333866 | |||
| 681 | Ga0068863_101173746 | |||
| 682 | Ga0081539_10001179 | |||
| 683 | Ga0070717_10625685 | |||
| 684 | Ga0075365_10158595 | |||
| 685 | Ga0075432_10003166 | |||
| 686 | Ga0070716_100185000 | |||
| 687 | Ga0075366_10314461 | |||
| 688 | Ga0068871_100729616 | |||
| 689 | Ga0068865_100277989 | |||
| 690 | Ga0105245_10055442 | |||
| 691 | Ga0105243_10132481 | |||
| 692 | Ga0105243_10165517 | |||
| 693 | Ga0105243_10650097 | |||
| 694 | Ga0105243_10734834 | |||
| 695 | Ga0105241_10388127 | |||
| 696 | Ga0105242_10188981 | |||
| 697 | Ga0105242_10415271 | |||
| 698 | Ga0105248_10206342 | |||
| 699 | Ga0105248_10485604 | |||
| 700 | Ga0105237_10514327 | |||
| 701 | Ga0105237_10775195 | |||
| 702 | Ga0105238_10102242 | |||
| 703 | Ga0105238_10881050 | |||
| 704 | Ga0105249_10071139 | |||
| 705 | Ga0105239_10231793 | |||
| 706 | Ga0105239_10884637 | |||
| 707 | Ga0105239_11177803 | |||
| 708 | Ga0105246_10095584 | |||
| 709 | Ga0105246_10123820 | |||
| 710 | Ga0157371_10181062 | |||
| 711 | Ga0157369_10030211 | |||
| 712 | Ga0157369_10241212 | |||
| 713 | Ga0157378_10602161 | |||
| 714 | Ga0163162_10619986 | |||
| 715 | Ga0163162_10879194 | |||
| 716 | Ga0157372_10157021 | |||
| 717 | Ga0157372_10181282 | |||
| 718 | Ga0157372_10468554 | |||
| 719 | Ga0157375_10075073 | |||
| 720 | Ga0157375_10215058 | |||
| 721 | Ga0163161_10278534 | |||
| 722 | Ga0163161_10877791 | |||
| 723 | Ga0206355_1062385 | |||
| 724 | Ga0206355_1376753 | |||
| 725 | Ga0206350_10422469 | |||
| 726 | Ga0206350_10467590 | |||
| 727 | Ga0206353_10276985 | |||
| 728 | Ga0224712_10198473 | |||
| 729 | Ga0207692_10078502 | |||
| 730 | Ga0207647_10008541 | |||
| 731 | Ga0207705_10281721 | |||
| 732 | Ga0207684_10499509 | |||
| 733 | Ga0207693_10093794 | |||
| 734 | Ga0207660_10290159 | |||
| 735 | Ga0207657_10513344 | |||
| 736 | Ga0207652_10019476 | |||
| 737 | Ga0207681_10330444 | |||
| 738 | Ga0207694_10155871 | |||
| 739 | Ga0207694_10268909 | |||
| 740 | Ga0207687_10183871 | |||
| 741 | Ga0207687_10218582 | |||
| 742 | Ga0207664_10025995 | |||
| 743 | Ga0207664_10151673 | |||
| 744 | Ga0207709_10060703 | |||
| 745 | Ga0207709_10157579 | |||
| 746 | Ga0207709_10192356 | |||
| 747 | Ga0207669_10376442 | |||
| 748 | Ga0207704_10013477 | |||
| 749 | Ga0207691_10136639 | |||
| 750 | Ga0207691_10392597 | |||
| 751 | Ga0207661_10215847 | |||
| 752 | Ga0207661_10259201 | |||
| 753 | Ga0207703_10365812 | |||
| 754 | Ga0207678_10149348 | |||
| 755 | Ga0207678_10215220 | |||
| 756 | Ga0207678_10470458 | |||
| 757 | Ga0207678_10511187 | |||
| 758 | Ga0207708_10107229 | |||
| 759 | Ga0207702_10888915 | |||
| 760 | Ga0207641_10293283 | |||
| 761 | Ga0207648_10063684 | |||
| 762 | Ga0207676_10460592 | |||
| 763 | Ga0207675_100318820 | |||
| 764 | Ga0207683_10021001 | |||
| 765 | Ga0207683_10066226 | |||
| 766 | Ga0207683_10120427 | |||
| 767 | Ga0207683_10197797 | |||
| 768 | Ga0207683_10376529 | |||
| 769 | Ga0207698_10077589 | |||
| 770 | Ga0207698_10428121 | |||
| 771 | Ga0207698_10457734 | |||
| 772 | Ga0268264_10391043 | |||
| 773 | Ga0265327_10205154 | |||
| 774 | Ga0307514_10210324 | |||
| 775 | Ga0316575_10000110 | |||
| 776 | Ga0316575_10021877 | |||
| 777 | Ga0316575_10034532 | |||
| 778 | Ga0316579_10003025 | |||
| 779 | Ga0316579_10024138 | |||
| 780 | Ga0316579_10149810 | |||
| 781 | Ga0316576_10032724 | |||
| 782 | Ga0316576_10040200 | |||
| 783 | Ga0316576_10234769 | |||
| 784 | Ga0316576_10442841 | |||
| 785 | Ga0316578_10000866 | |||
| 786 | Ga0316578_10057638 | |||
| 787 | Ga0316578_10080439 | |||
| 788 | Ga0307405_10069842 | |||
| 789 | Ga0307405_10365861 | |||
| 790 | Ga0307405_10638937 | |||
| 791 | Ga0316577_10005539 | |||
| 792 | Ga0316577_10151235 | |||
| 793 | Ga0307413_10083565 | |||
| 794 | Ga0307413_10093935 | |||
| 795 | Ga0307413_10548302 | |||
| 796 | Ga0307413_10613463 | |||
| 797 | Ga0307410_10000904 | |||
| 798 | Ga0307410_10013185 | |||
| 799 | Ga0307410_10086142 | |||
| 800 | Ga0307410_10140530 | |||
| 801 | Ga0307406_10193850 | |||
| 802 | Ga0307407_10035928 | |||
| 803 | Ga0307407_10153920 | |||
| 804 | Ga0307407_10165928 | |||
| 805 | Ga0307412_10067669 | |||
| 806 | Ga0307409_100011105 | |||
| 807 | Ga0307409_100033653 | |||
| 808 | Ga0307409_100073070 | |||
| 809 | Ga0307409_100113904 | |||
| 810 | Ga0307409_100320672 | |||
| 811 | Ga0307416_100018744 | |||
| 812 | Ga0307416_100025077 | |||
| 813 | Ga0307416_100116719 | |||
| 814 | Ga0307416_100162832 | |||
| 815 | Ga0307416_100337054 | |||
| 816 | Ga0307416_100339213 | |||
| 817 | Ga0307411_10127409 | |||
| 818 | Ga0307411_10261954 | |||
| 819 | Ga0316583_10032635 | |||
| 820 | Ga0316583_10034824 | |||
| 821 | Ga0316585_10010464 | |||
| 822 | Ga0316585_10017658 | |||
| 823 | Ga0316580_10009328 | |||
| 824 | Ga0316580_10018842 | |||
| 825 | Ga0316580_10081558 | |||
| 826 | Ga0316593_10011608 | |||
| 827 | Ga0316593_10033899 | |||
| 828 | Ga0316592_1012981 | |||
| 829 | Ga0316592_1018983 | |||
| 830 | Ga0316588_1023421 | |||
| 831 | Ga0316596_1016716 | |||
| 832 | Ga0316596_1029083 | |||
| 833 | Ga0373934_0054323 | |||
| 834 | Ga0373936_0005616 | |||
| 835 | Ga0373957_0011556 | |||
| 836 | Ga0373943_0076684 | |||
| 837 | Ga0373955_0103755 | |||
| 838 | Ga0316574_0004218 | |||
| 839 | Ga0316574_0014758 | |||
| 840 | Ga0316574_0019250 | |||
| 841 | Ga0316574_0342208 | |||
| 842 | Ga0373924_0059723 | |||
| 843 | Ga0373931_0259884 | |||
| 844 | Ga0373933_0008290 | |||
| 845 | Ga0373937_0038156 | |||
| 846 | Ga0265778_005353 | |||
| 847 | Ga0316582_0008420 | |||
| 848 | Ga0316582_0028696 | |||
| 849 | Ga0316584_0003768 | |||
| 850 | Ga0316584_0011467 | |||
| 851 | Ga0316584_0077362 | |||
| 852 | Ga0316584_0495335 | |||
| 853 | Ga0395900_0034125 | |||
| 854 | Ga0395898_0030371 | |||
| 855 | Ga0395898_0259204 | |||
| 856 | Ga0395905_0029015 | |||
| 857 | Ga0395905_0139852 | |||
| 858 | Ga0395901_0037105 | |||
| 859 | Ga0395901_0048393 | |||
| 860 | Ga0395901_0183072 | |||
| 861 | Ga0395901_0313536 | |||
| 862 | Ga0395901_0893106 | |||
| 863 | Ga0400485_11442 | |||
| 864 | Ga0400486_30354 | |||
| 865 | Ga0436363_1538985 | |||
| 866 | Ga0436362_0346297 | |||
| 867 | Ga0439436_0013087 | |||
| 868 | Ga0439436_0016804 | |||
| 869 | Ga0439436_0081075 | |||
| 870 | Ga0439438_006435 | |||
| 871 | Ga0439438_046453 | |||
| 872 | Ga0439439_0000385 | |||
| 873 | Ga0439447_016195 | |||
| 874 | Ga0439447_027150 | |||
| 875 | Ga0439461_0009321 | |||
| 876 | Ga0439466_0002897 | |||
| 877 | Ga0439465_0084365 | |||
| 878 | Ga0451791_0326913 | |||
| 879 | Ga0451793_0215134 | |||
| 880 | Ga0451797_0495029 | |||
| 881 | Ga0451797_1029940 | |||
| 882 | Ga0451802_0226522 | |||
| 883 | Ga0451807_0001797 | |||
| 884 | Ga0451833_0450366 | |||
| 885 | Ga0451837_0259585 | |||
| 886 | Ga0451849_0359593 | |||
| 887 | Ga0451843_0765211 | |||
| 888 | Ga0451853_1980724 | |||
| 889 | Ga0439433_0000411 | |||
| 890 | Ga0439433_0000904 | |||
| 891 | Ga0439442_021836 | |||
| 892 | Ga0439432_028835 | |||
| 893 | Ga0439432_044806 | |||
| 894 | Ga0439449_0000879 | |||
| 895 | Ga0439449_0025193 | |||
| 896 | Ga0439452_002345 | |||
| 897 | Ga0439457_003049 | |||
| 898 | Ga0439462_0016900 | |||
| 899 | Ga0439462_0022181 | |||
| 900 | Ga0439462_0064009 | |||
| 901 | Ga0450919_004567 | |||
| 902 | Ga0450920_001738 | |||
| 903 | Ga0450900_014169 | |||
| 904 | Ga0450910_011533 | |||
| 905 | Ga0439446_0000569 | |||
| 906 | Ga0439434_0002125 | |||
| 907 | Ga0439434_0018392 | |||
| 908 | Ga0439460_0112154 | |||
| 909 | Ga0450918_002295 | |||
| 910 | Ga0450901_016597 | |||
| 911 | Ga0466965_0016847 | |||
| 912 | Ga0466960_0018942 | |||
| 913 | Ga0466960_0149145 | |||
| 914 | Ga0466958_0042912 | |||
| 915 | Ga0466967_0311693 | |||
| 916 | Ga0495592_0358786 | |||
| 917 | Ga0495603_0168357 | |||
| 918 | Ga0495629_0024271 | |||
| 919 | Ga0495641_0081627 | |||
| 920 | Ga0495651_0036045 | |||
| 921 | Ga0495653_0011041 | |||
| 922 | Ga0495653_0081953 | |||
| 923 | Ga0495653_0416997 | |||
| 924 | Ga0495582_0352327 | |||
| 925 | Ga0495664_0151898 | |||
| 926 | Ga0495585_0012050 | |||
| 927 | Ga0495585_0078252 | |||
| 928 | Ga0495594_0015192 | |||
| 929 | Ga0495607_0149540 | |||
| 930 | Ga0495620_0073825 | |||
| 931 | Ga0495628_0224778 | |||
| 932 | Ga0495631_0168884 | |||
| 933 | Ga0495648_0241317 | |||
| 934 | Ga0495666_0173516 | |||
| 935 | Ga0495665_0357243 | |||
| 936 | Ga0495640_0167030 | |||
| 937 | Ga0495640_0178999 | |||
| 938 | Ga0495640_0280039 | |||
| 939 | Ga0495587_0131288 | |||
| 940 | Ga0495645_0330123 | |||
| 941 | Ga0495622_0007761 | |||
| 942 | Ga0495667_0002317 | |||
| 943 | Ga0495667_0113642 | |||
| 944 | Ga0495656_0243595 | |||
| 945 | Ga0495611_0026629 | |||
| 946 | Ga0495625_0100062 | |||
| 947 | Ga0495625_0256158 | |||
| 948 | Ga0495635_0010704 | |||
| 949 | Ga0495635_0379937 | |||
| 950 | Ga0495635_0489021 | |||
| 951 | Ga0495588_0012319 | |||
| 952 | Ga0495588_0118071 | |||
| 953 | Ga0495657_0174647 | |||
| 954 | Ga0495623_0074204 | |||
| 955 | Ga0495646_0026169 | |||
| 956 | Ga0495646_0278368 | |||
| 957 | Ga0495658_0089870 | |||
| 958 | Ga0495613_0000533 | |||
| 959 | Ga0495624_0411133 | |||
| 960 | Ga0495649_0120794 | |||
| 961 | Ga0495589_0036718 | |||
| 962 | Ga0495600_0155279 | |||
| 963 | Ga0495581_0057699 | |||
| 964 | Ga0495581_0264880 | |||
| 965 | Ga0495604_0176869 | |||
| 966 | Ga0495636_0019555 | |||
| 967 | Ga0495636_0166347 | |||
| 968 | Ga0495674_0410585 | |||
| 969 | Ga0495676_0004789 | |||
| 970 | Ga0495676_0072644 | |||
| 971 | Ga0495676_0165604 | |||
| 972 | Ga0495676_0300912 | |||
| 973 | Ga0495680_0039019 | |||
| 974 | Ga0495680_0619197 | |||
| 975 | Ga0495675_0197625 | |||
| 976 | Ga0495684_0037735 | |||
| 977 | Ga0495593_0130935 | |||
| 978 | Ga0495593_0173614 | |||
| 979 | Ga0495614_0004809 | |||
| 980 | Ga0495614_0023284 | |||
| 981 | Ga0496100_0255735 | |||
| 982 | Ga0496100_0279775 | |||
| 983 | Ga0496100_0401377 | |||
| 984 | Ga0496100_0794841 | |||
| 985 | Ga0496101_0033137 | |||
| 986 | Ga0496101_0121286 | |||
| 987 | Ga0496101_0156336 | |||
| 988 | Ga0496101_0168283 | |||
| 989 | Ga0496101_0294793 | |||
| 990 | Ga0496101_0395340 | |||
| 991 | Ga0496102_0002600 | |||
| 992 | Ga0496102_0062548 | |||
| 993 | Ga0496102_0083055 | |||
| 994 | Ga0496102_0185161 | |||
| 995 | Ga0496102_0189069 | |||
| 996 | Ga0496102_0634561 | |||
| 997 | Ga0496103_0030356 | |||
| 998 | Ga0496103_0043837 | |||
| 999 | Ga0496103_0050247 | |||
| 1000 | Ga0496104_0010288 | |||
| 1001 | Ga0496104_0088185 | |||
| 1002 | Ga0496104_0100415 | |||
| 1003 | Ga0496104_0203065 | |||
| 1004 | Ga0496104_0225201 | |||
| 1005 | Ga0496104_0232225 | |||
| 1006 | Ga0496104_0286174 | |||
| 1007 | Ga0496104_0325222 | |||
| 1008 | Ga0496104_0349470 | |||
| 1009 | Ga0496105_0000828 | |||
| 1010 | Ga0496105_0096997 | |||
| 1011 | Ga0496105_0159610 | |||
| 1012 | Ga0496105_0487207 | |||
| 1013 | Ga0496105_0549371 | |||
| 1014 | Ga0496106_0064977 | |||
| 1015 | Ga0496106_0204155 | |||
| 1016 | Ga0496106_0297572 | |||
| 1017 | Ga0496107_0089273 | |||
| 1018 | Ga0496107_0091736 | |||
| 1019 | Ga0496107_0267775 | |||
| 1020 | Ga0496108_0074897 | |||
| 1021 | Ga0496108_0249133 | |||
| 1022 | Ga0496108_0644275 | |||
| 1023 | Ga0496109_0055975 | |||
| 1024 | Ga0496109_0280545 | |||
| 1025 | Ga0496109_0374598 | |||
| 1026 | Ga0496110_0051176 | |||
| 1027 | Ga0496110_0070348 | |||
| 1028 | Ga0496110_0108648 | |||
| 1029 | Ga0496111_0068418 | |||
| 1030 | Ga0496111_0078278 | |||
| 1031 | Ga0496111_0088231 | |||
| 1032 | Ga0496111_0133156 | |||
| 1033 | Ga0496111_0159139 | |||
| 1034 | Ga0496111_0701701 | |||
| 1035 | Ga0496113_0219459 | |||
| 1036 | Ga0496113_0293870 | |||
| 1037 | Ga0496113_0460595 | |||
| 1038 | Ga0496114_0045246 | |||
| 1039 | Ga0496114_0061484 | |||
| 1040 | Ga0496114_0115947 | |||
| 1041 | Ga0496114_0117401 | |||
| 1042 | Ga0496114_0156235 | |||
| 1043 | Ga0496114_0246599 | |||
| 1044 | Ga0496114_0619441 | |||
| 1045 | Ga0496114_0682859 | |||
| 1046 | Ga0496115_0038896 | |||
| 1047 | Ga0496115_0043528 | |||
| 1048 | Ga0496115_0185808 | |||
| 1049 | Ga0496115_0275668 | |||
| 1050 | Ga0496115_0398000 | |||
| 1051 | Ga0496118_0089381 | |||
| 1052 | Ga0496118_0227595 | |||
| 1053 | Ga0496119_0026366 | |||
| 1054 | Ga0496122_0001714 | |||
| 1055 | Ga0496122_0004828 | |||
| 1056 | Ga0496123_0000800 | |||
| 1057 | Ga0496124_0001400 | |||
| 1058 | Ga0496124_0034703 | |||
| 1059 | Ga0496125_0000079 | |||
| 1060 | Ga0496125_0000350 | |||
| 1061 | Ga0496126_0011797 | |||
| 1062 | Ga0496126_0131423 | |||
| 1063 | Ga0501306_000430 | |||
| 1064 | Ga0501308_007801 | |||
| 1065 | Ga0501309_001111 | |||
| 1066 | Ga0501309_008157 | |||
| 1067 | Ga0501305_000363 | |||
| 1068 | Ga0501305_010472 | |||
| 1069 | Ga0501305_038652 | |||
| 1070 | Ga0501311_005412 | |||
| 1071 | Ga0501311_010285 | |||
| 1072 | Ga0501311_020480 | |||
| 1073 | Ga0501312_006972 | |||
| 1074 | Ga0501312_016926 | |||
| 1075 | Ga0501313_014693 | |||
| 1076 | Ga0501313_021089 | |||
| 1077 | Ga0501314_003014 | |||
| 1078 | Ga0501315_005366 | |||
| 1079 | Ga0501315_027225 | |||
| 1080 | Ga0501316_000806 | |||
| 1081 | Ga0501316_006681 | |||
| 1082 | Ga0501316_008287 | |||
| 1083 | Ga0501317_000791 | |||
| 1084 | Ga0501317_001278 | |||
| 1085 | Ga0501317_004846 | |||
| 1086 | Ga0501317_006012 | |||
| 1087 | Ga0501317_010085 | |||
| 1088 | Ga0501317_011545 | |||
| 1089 | Ga0501318_000267 | |||
| 1090 | Ga0501318_006099 | |||
| 1091 | Ga0501318_010137 | |||
| 1092 | Ga0501318_011249 | |||
| 1093 | Ga0501318_025807 | |||
| 1094 | Ga0501318_039139 | |||
| 1095 | Ga0501319_005838 | |||
| 1096 | Ga0501319_009547 | |||
| 1097 | Ga0501320_017617 | |||
| 1098 | Ga0501321_003348 | |||
| 1099 | Ga0501321_003647 | |||
| 1100 | Ga0501321_003710 | |||
| 1101 | Ga0501321_009074 | |||
| 1102 | Ga0501323_008812 | |||
| 1103 | Ga0501323_020556 | |||
| 1104 | Ga0501324_016024 | |||
| 1105 | Ga0501325_001524 | |||
| 1106 | Ga0501325_003713 | |||
| 1107 | Ga0501325_005751 | |||
| 1108 | Ga0501328_03360 | |||
| 1109 | Ga0501330_000989 | |||
| 1110 | Ga0501332_07784 | |||
| 1111 | Ga0501336_002196 | |||
| 1112 | Ga0501336_012196 | |||
| 1113 | Ga0501337_002535 | |||
| 1114 | Ga0501031_0000642 | |||
| 1115 | Ga0501031_0001578 | |||
| 1116 | Ga0501032_0003050 | |||
| 1117 | Ga0501032_0065939 | |||
| 1118 | Ga0501032_0125790 | |||
| 1119 | Ga0501033_0011827 | |||
| 1120 | Ga0501033_0141404 | |||
| 1121 | Ga0501033_0226017 | |||
| 1122 | Ga0501034_0074597 | |||
| 1123 | Ga0501034_0094356 | |||
| 1124 | Ga0501036_0009923 | |||
| 1125 | Ga0501036_0036436 | |||
| 1126 | Ga0501037_0000644 | |||
| 1127 | Ga0501037_0127659 | |||
| 1128 | Ga0501037_0169662 | |||
| 1129 | Ga0501038_0002939 | |||
| 1130 | Ga0501038_0008626 | |||
| 1131 | Ga0501039_0004517 | |||
| 1132 | Ga0501039_0012029 | |||
| 1133 | Ga0501039_0436160 | |||
| 1134 | Ga0501040_0000683 | |||
| 1135 | Ga0501040_0015785 | |||
| 1136 | Ga0501041_0003388 | |||
| 1137 | Ga0501041_0026224 | |||
| 1138 | Ga0501041_0037023 | |||
| 1139 | Ga0501041_0161646 | |||
| 1140 | Ga0501041_0516041 | |||
| 1141 | Ga0501042_0028841 | |||
| 1142 | Ga0501042_0106265 | |||
| 1143 | Ga0501043_0015445 | |||
| 1144 | Ga0501043_0185785 | |||
| 1145 | Ga0501043_0374225 | |||
| 1146 | Ga0501043_0599528 | |||
| 1147 | Ga0501046_0002882 | |||
| 1148 | Ga0501046_0008435 | |||
| 1149 | Ga0501046_0099102 | |||
| 1150 | Ga0501047_0001101 | |||
| 1151 | Ga0501047_0005206 | |||
| 1152 | Ga0501048_0003317 | |||
| 1153 | Ga0501048_0010765 | |||
| 1154 | Ga0501048_0020446 | |||
| 1155 | Ga0501067_0003258 | |||
| 1156 | Ga0501067_0040560 | |||
| 1157 | Ga0501068_0006107 | |||
| 1158 | Ga0501069_0006328 | |||
| 1159 | Ga0501070_0011764 | |||
| 1160 | Ga0501071_0002381 | |||
| 1161 | Ga0501071_0037241 | |||
| 1162 | Ga0501071_0041996 | |||
| 1163 | Ga0501071_0617818 | |||
| 1164 | Ga0501072_0000272 | |||
| 1165 | Ga0501072_0003741 | |||
| 1166 | Ga0501073_0034060 | |||
| 1167 | Ga0501074_0032418 | |||
| 1168 | Ga0501074_0146433 | |||
| 1169 | Ga0501075_0002860 | |||
| 1170 | Ga0501075_0518965 | |||
| 1171 | Ga0501076_0012191 | |||
| 1172 | Ga0501076_0013200 | |||
| 1173 | Ga0501076_0029246 | |||
| 1174 | Ga0501076_0307900 | |||
| 1175 | Ga0501077_0050145 | |||
| 1176 | Ga0501077_0129884 | |||
| 1177 | Ga0501079_0002499 | |||
| 1178 | Ga0501079_0027019 | |||
| 1179 | Ga0501080_0071086 | |||
| 1180 | Ga0501080_0469812 | |||
| 1181 | Ga0501081_0077251 | |||
| 1182 | Ga0501081_0176867 | |||
| 1183 | Ga0501083_0042679 | |||
| 1184 | Ga0501083_0332887 | |||
| 1185 | Ga0501035_0020790 | |||
| 1186 | Ga0501035_0053265 | |||
| 1187 | Ga0501035_0069700 | |||
| 1188 | Ga0501044_0009255 | |||
| 1189 | Ga0501044_0030386 | |||
| 1190 | Ga0501044_0087970 | |||
| 1191 | Ga0501045_0001668 | |||
| 1192 | Ga0501045_0024516 | |||
| 1193 | Ga0501045_0028168 | |||
| 1194 | nmdc:mga03n38_370031_c1 | |||
| 1195 | nmdc:mga00v17_61728_c1 | |||
| 1196 | nmdc:mga0yw44_189887_c1 | |||
| 1197 | Ga0495595_0046370 | |||
| 1198 | Ga0495595_0150089 | |||
| 1199 | Ga0495619_0130822 | |||
| 1200 | Ga0495619_0192119 | |||
| 1201 | Ga0500616_0000322 | |||
| 1202 | Ga0500620_137430 | |||
| 1203 | Ga0501084_0036974 | |||
| 1204 | Ga0501084_0424727 | |||
| 1205 | Ga0501084_0550152 | |||
| 1206 | Ga0587090_011029 | |||
| 1207 | Ga0587106_024304 | |||
| 1208 | Ga0587106_026765 | |||
| 1209 | Ga0587101_024205 | |||
| 1210 | Ga0587072_021749 | |||
| 1211 | Ga0587072_066928 | |||
| 1212 | Ga0587079_058739 | |||
| 1213 | Ga0587110_006682 | |||
| 1214 | Ga0587119_038615 | |||
| 1215 | Ga0501082_0020021 | |||
| 1216 | Ga0501082_0020703 | |||
| 1217 | Ga0501082_0087340 | |||
| 1218 | Ga0501082_0363846 | |||
| 1219 | Ga0530510_0004600 | |||
| 1220 | Ga0530510_0066133 | |||
| 1221 | Ga0530510_0587734 | |||
| 1222 | 2812365671 | |||
| 1223 | 2537898470 | |||
| 1224 | 2585301919 | |||
| 1225 | 2616899898 | |||
| 1226 | 2643759770 | |||
| 1227 | 2643853459 | |||
| 1228 | 2643897895 | |||
| 1229 | 2643944667 | |||
| 1230 | 2644137419 | |||
| 1231 | 2644385410 | |||
| 1232 | 2644409040 | |||
| 1233 | 2644431565 | |||
| 1234 | 2644444656 | |||
| 1235 | 2644462811 | |||
| 1236 | 2644506679 | |||
| 1237 | 2644526415 | |||
| 1238 | 2644611450 | |||
| 1239 | 2644671081 | |||
| 1240 | 2738692607 | |||
| 1241 | 2739323684 | |||
| 1242 | 2808874872 | |||
| 1243 | 2811848289 | |||
| 1244 | 2812375421 | |||
| 1245 | 2819428153 | |||
| 1246 | 2819668294 | |||
| 1247 | 2819692144 | |||
| 1248 | 2819693660 | |||
| 1249 | 2819729885 | |||
| 1250 | 2835191115 | |||
| 1251 | 2848551784 | |||
| 1252 | 2857480945 | |||
| 1253 | 2857633497 | |||
| 1254 | 2862184881 | |||
| 1255 | 2862579987 | |||
| 1256 | 2870802665 | |||
| 1257 | 2870804745 | |||
| 1258 | 2873156544 | |||
| 1259 | 2875393806 | |||
| 1260 | 2884994952 | |||
| 1261 | 2887443840 | |||
| 1262 | 2912725007 | |||
| 1263 | 2918503837 | |||
| 1264 | 2919447229 | |||
| 1265 | 2935392292 | |||
| 1266 | 2946050846 | |||
| 1267 | 2947230329 | |||
| 1268 | 2966603272 | |||
| 1269 | 3001891867 | |||
| 1270 | 3002998783 | |||
| 1271 | 3006321816 | |||
| 1272 | 3006493232 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p81-assembly2.cif.gz_R | crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) | 0.988 | 14 | 185 |
| 7p81-assembly2.cif.gz_T | crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) | 0.9866 | 14 | 185 |
| 7p81-assembly1.cif.gz_K | crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) | 0.986 | 14 | 185 |
| 3hln-assembly2.cif.gz_T | crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds | 0.9851 | 14 | 186 |
| 6hwn-assembly1.cif.gz_A | structure of thermus thermophilus clpp in complex with a tripeptide. | 0.9822 | 14 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yg8S00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9733 | 14 | 186 | 3.90.226.10 |
| af_P9WPC3_1_214_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9627 | 15 | 184 | 3.90.226.10 |
| 4u0hE00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9386 | 8 | 187 | 3.90.226.10 |
| 1yg8S00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9362 | 14 | 186 | 3.90.226.10 |
| 1y7oA00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9331 | 8 | 186 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G6R668-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.9938 | 71 | 189 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |
| AF-A0A199VE53-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 0.9918 | 94 | 184 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0009536 GO:0051117 |
| AF-A0A1M3LVE2-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92) (Endopeptidase Clp) | 0.9893 | 15 | 186 |
GO:0004176
GO:0004252 GO:0005737 GO:0006515 GO:0009368 GO:0051117 |
| AF-A0A2V7JB18-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92) | 0.9891 | 14 | 122 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0016020 GO:0051117 |
| AF-N6WC57-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92) (Endopeptidase Clp) | 0.9882 | 12 | 191 |
GO:0004176
GO:0004252 GO:0005737 GO:0006515 GO:0009368 GO:0051117 |