F471382

General Info

Members Datasets Scaffolds Average Seq Length
636 269 1272 208

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0031007|Ga0501033_0031007_906_1664
Length 252
Sequence MTFDIVNAENRKVGSVELKDEVFGGRVNSGLIWSSVVHANAAERRGTHATKNRALVSGSGRKPWRQKGTGRARVGEIRNPLWRKGGTVFGPQPRSYDYPLPRKTELGALRAAIAQRAQDGALVIVDSLDVPDGKTKSAAELLNRLGAGDKTLLVEVTPGEMLTRAVRNLPGVNLVMAGRVRARDVMNTTRVIASSAAIERLQEALVPGAAAKAPSRVDEASRSQANEAPSKVAGKSGRPRKQASAPKARGKK

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
175 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 3.14
Rhizosphere 94.5
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0031007 3300049570 Bacteria 4019
2 Ga0058863_11588510 3300004799 Bacteria 1409
3 Ga0058863_11625439 3300004799 Bacteria 1977
4 Ga0058860_11966461 3300004801 Bacteria 1522
5 Ga0058862_12419053 3300004803 Bacteria 1940
6 Ga0065704_10102280 3300005289 Bacteria 2210
7 Ga0065712_10001248 3300005290 Bacteria 11167
8 Ga0065712_10085862 3300005290 Bacteria 2666
9 Ga0065712_10101257 3300005290 Bacteria 2040
10 Ga0065712_10162352 3300005290 Bacteria 1265
11 Ga0065715_10008392 3300005293 Bacteria 2483
12 Ga0065715_10010383 3300005293 Bacteria 3726
13 Ga0065715_10016873 3300005293 Bacteria 2123
14 Ga0065715_10055187 3300005293 Bacteria 948
15 Ga0065707_10385383 3300005295 Bacteria 871
16 Ga0070676_10027141 3300005328 Bacteria 3245
17 Ga0070676_10046078 3300005328 Bacteria 2541
18 Ga0070676_10119028 3300005328 Bacteria 1655
19 Ga0070676_10125499 3300005328 Bacteria 1616
20 Ga0070683_100544885 3300005329 Unclassified 1109
21 Ga0070690_100024114 3300005330 Bacteria 3740
22 Ga0070670_100019040 3300005331 Bacteria 5886
23 Ga0070670_100021447 3300005331 Bacteria 5557
24 Ga0070670_100050331 3300005331 Bacteria 3580
25 Ga0070670_100397351 3300005331 Bacteria 1216
26 Ga0070677_10014195 3300005333 Bacteria 2799
27 Ga0070677_10028050 3300005333 Bacteria 2124
28 Ga0068869_100037386 3300005334 Bacteria 3451
29 Ga0070666_10036918 3300005335 Bacteria 3246
30 Ga0070666_10190971 3300005335 Bacteria 1439
31 Ga0070680_100154707 3300005336 Bacteria 1926
32 Ga0070689_100063350 3300005340 Bacteria 2877
33 Ga0070689_100132175 3300005340 Bacteria 2002
34 Ga0070691_10049428 3300005341 Bacteria 2003
35 Ga0070687_100068909 3300005343 Bacteria 1893
36 Ga0070687_100091031 3300005343 Bacteria 1687
37 Ga0070661_100166374 3300005344 Bacteria 1673
38 Ga0070661_100611988 3300005344 Bacteria 882
39 Ga0070668_100041626 3300005347 Bacteria 3520
40 Ga0070668_100314381 3300005347 Bacteria 1317
41 Ga0070668_100463242 3300005347 Bacteria 1092
42 Ga0070669_100054214 3300005353 Bacteria 2936
43 Ga0070669_100152909 3300005353 Bacteria 1787
44 Ga0070669_100275060 3300005353 Bacteria 1348
45 Ga0070669_100511144 3300005353 Bacteria 997
46 Ga0070675_100061239 3300005354 Bacteria 3107
47 Ga0070675_100145573 3300005354 Bacteria 2028
48 Ga0070675_100173808 3300005354 Bacteria 1859
49 Ga0070675_100194769 3300005354 Bacteria 1757
50 Ga0070675_100487536 3300005354 Bacteria 1109
51 Ga0070675_100643767 3300005354 Bacteria 963
52 Ga0070674_100031049 3300005356 Bacteria 3536
53 Ga0070673_100069060 3300005364 Bacteria 2831
54 Ga0070688_100003817 3300005365 Bacteria 7811
55 Ga0070688_100146880 3300005365 Bacteria 1608
56 Ga0070688_100258610 3300005365 Bacteria 1242
57 Ga0070659_100115995 3300005366 Bacteria 2165
58 Ga0070667_100047616 3300005367 Bacteria 3607
59 Ga0070703_10039292 3300005406 Bacteria 1466
60 Ga0070701_10070331 3300005438 Bacteria 1870
61 Ga0070700_100206269 3300005441 Bacteria 1384
62 Ga0070708_100169660 3300005445 Bacteria 2036
63 Ga0070708_100319312 3300005445 Bacteria 1463
64 Ga0070678_100004485 3300005456 Bacteria 7921
65 Ga0070678_100062889 3300005456 Bacteria 2743
66 Ga0070678_100330712 3300005456 Bacteria 1304
67 Ga0070678_100367323 3300005456 Bacteria 1241
68 Ga0070678_100415174 3300005456 Bacteria 1172
69 Ga0070662_100026522 3300005457 Bacteria 4014
70 Ga0070662_100052666 3300005457 Bacteria 2943
71 Ga0070662_100311266 3300005457 Bacteria 1282
72 Ga0070681_10070220 3300005458 Bacteria 3468
73 Ga0070681_10245381 3300005458 Bacteria 1704
74 Ga0068867_100116828 3300005459 Bacteria 2056
75 Ga0068867_100352534 3300005459 Bacteria 1228
76 Ga0070685_10033631 3300005466 Bacteria 2882
77 Ga0070698_100665540 3300005471 Bacteria 983
78 Ga0070679_100077915 3300005530 Bacteria 3304
79 Ga0070679_100295888 3300005530 Bacteria 1570
80 Ga0070684_100241704 3300005535 Bacteria 1650
81 Ga0070672_100010895 3300005543 Bacteria 6323
82 Ga0070672_100370536 3300005543 Bacteria 1223
83 Ga0070672_100504422 3300005543 Bacteria 1047
84 Ga0070686_100033093 3300005544 Bacteria 3174
85 Ga0070686_100208538 3300005544 Bacteria 1405
86 Ga0070686_100410129 3300005544 Bacteria 1032
87 Ga0070665_100149247 3300005548 Bacteria 2341
88 Ga0070704_100085020 3300005549 Bacteria 2340
89 Ga0068855_100930001 3300005563 Bacteria 917
90 Ga0070664_100049119 3300005564 Bacteria 3567
91 Ga0070664_100964855 3300005564 Bacteria 801
92 Ga0068857_100599683 3300005577 Bacteria 1041
93 Ga0068857_100932179 3300005577 Bacteria 834
94 Ga0068856_100999857 3300005614 Bacteria 855
95 Ga0068852_100011754 3300005616 Bacteria 6610
96 Ga0068852_100224761 3300005616 Bacteria 1787
97 Ga0068859_100149632 3300005617 Bacteria 2410
98 Ga0068859_100163281 3300005617 Bacteria 2306
99 Ga0068859_100794066 3300005617 Bacteria 1034
100 Ga0068864_100101893 3300005618 Bacteria 2547
101 Ga0068864_100159840 3300005618 Bacteria 2047
102 Ga0068864_100177479 3300005618 Bacteria 1945
103 Ga0068864_100524054 3300005618 Bacteria 1143
104 Ga0068866_10053298 3300005718 Bacteria 2068
105 Ga0068866_10421793 3300005718 Bacteria 866
106 Ga0068861_100154579 3300005719 Bacteria 1885
107 Ga0068870_10061412 3300005840 Bacteria 2020
108 Ga0068870_10209083 3300005840 Bacteria 1187
109 Ga0068863_100042134 3300005841 Bacteria 4338
110 Ga0068863_100185165 3300005841 Bacteria 2000
111 Ga0068863_100639387 3300005841 Bacteria 1055
112 Ga0068858_100116908 3300005842 Bacteria 2492
113 Ga0068858_100153869 3300005842 Bacteria 2163
114 Ga0068858_100166008 3300005842 Bacteria 2080
115 Ga0068858_100275499 3300005842 Bacteria 1601
116 Ga0068860_100100645 3300005843 Bacteria 2757
117 Ga0068862_100005694 3300005844 Bacteria 10395
118 Ga0068862_100105656 3300005844 Bacteria 2468
119 Ga0068862_100152765 3300005844 Bacteria 2056
120 Ga0075365_10004021 3300006038 Bacteria 7709
121 Ga0075365_10173703 3300006038 Bacteria 1505
122 Ga0075368_10049697 3300006042 Bacteria 1664
123 Ga0075364_10064006 3300006051 Bacteria 2414
124 Ga0070716_100478490 3300006173 Bacteria 914
125 Ga0075367_10078966 3300006178 Bacteria 1988
126 Ga0097621_100010444 3300006237 Bacteria 6799
127 Ga0097621_100112023 3300006237 Bacteria 2306
128 Ga0068871_100016445 3300006358 Bacteria 5571
129 Ga0068871_100171110 3300006358 Bacteria 1862
130 Ga0068871_100198358 3300006358 Bacteria 1732
131 Ga0075428_100133812 3300006844 Bacteria 2696
132 Ga0075428_100187525 3300006844 Bacteria 2237
133 Ga0075428_100331934 3300006844 Bacteria 1633
134 Ga0075428_101096150 3300006844 Bacteria 841
135 Ga0075428_101187082 3300006844 Bacteria 805
136 Ga0075430_100003218 3300006846 Bacteria 13675
137 Ga0075430_100004914 3300006846 Bacteria 11243
138 Ga0075430_100035323 3300006846 Bacteria 4240
139 Ga0075430_100071540 3300006846 Bacteria 2909
140 Ga0075431_100003301 3300006847 Bacteria 15626
141 Ga0075431_100061368 3300006847 Bacteria 3879
142 Ga0075431_100134485 3300006847 Bacteria 2549
143 Ga0075431_100192367 3300006847 Bacteria 2090
144 Ga0075431_100275923 3300006847 Bacteria 1703
145 Ga0075431_100307918 3300006847 Bacteria 1599
146 Ga0075431_100342053 3300006847 Bacteria 1505
147 Ga0075431_100693063 3300006847 Bacteria 997
148 Ga0075431_100923585 3300006847 Bacteria 842
149 Ga0075433_10007511 3300006852 Bacteria 8653
150 Ga0075433_10049363 3300006852 Bacteria 3661
151 Ga0075433_10199161 3300006852 Bacteria 1781
152 Ga0075433_10201036 3300006852 Bacteria 1771
153 Ga0075434_100016140 3300006871 Bacteria 7176
154 Ga0075434_100049229 3300006871 Bacteria 4184
155 Ga0075434_100178264 3300006871 Bacteria 2145
156 Ga0075434_100209501 3300006871 Bacteria 1969
157 Ga0075434_100431190 3300006871 Unclassified 1339
158 Ga0075434_100499184 3300006871 Bacteria 1238
159 Ga0075429_100094173 3300006880 Bacteria 2612
160 Ga0075429_100094990 3300006880 Bacteria 2600
161 Ga0075429_100103496 3300006880 Bacteria 2486
162 Ga0075429_100236863 3300006880 Bacteria 1599
163 Ga0075429_100452907 3300006880 Bacteria 1124
164 Ga0068865_100111995 3300006881 Bacteria 2015
165 Ga0075436_100190114 3300006914 Bacteria 1452
166 Ga0097620_100149647 3300006931 Bacteria 2410
167 Ga0097620_100163282 3300006931 Bacteria 2306
168 Ga0097620_100256933 3300006931 Bacteria 1838
169 Ga0097620_100794067 3300006931 Bacteria 1034
170 Ga0075435_100001248 3300007076 Bacteria 16274
171 Ga0075435_100048440 3300007076 Bacteria 3414
172 Ga0075435_100156777 3300007076 Bacteria 1916
173 Ga0075435_100218065 3300007076 Bacteria 1620
174 Ga0105240_10152727 3300009093 Bacteria 2748
175 Ga0111539_10124915 3300009094 Bacteria 3016
176 Ga0111539_10262214 3300009094 Bacteria 2011
177 Ga0111539_10283542 3300009094 Bacteria 1928
178 Ga0111539_10357746 3300009094 Bacteria 1699
179 Ga0111539_10722108 3300009094 Unclassified 1160
180 Ga0111539_10782706 3300009094 Bacteria 1110
181 Ga0111539_11595136 3300009094 Bacteria 757
182 Ga0105245_10537089 3300009098 Bacteria 1190
183 Ga0114129_10000897 3300009147 Bacteria 38727
184 Ga0114129_10006820 3300009147 Bacteria 16221
185 Ga0114129_10085526 3300009147 Bacteria 4375
186 Ga0114129_10127914 3300009147 Bacteria 3491
187 Ga0114129_10276154 3300009147 Bacteria 2246
188 Ga0114129_10570723 3300009147 Bacteria 1469
189 Ga0114129_11332568 3300009147 Bacteria 888
190 Ga0105243_10051443 3300009148 Bacteria 3258
191 Ga0105243_10088970 3300009148 Bacteria 2538
192 Ga0105248_10110094 3300009177 Bacteria 3106
193 Ga0105248_10267172 3300009177 Bacteria 1926
194 Ga0105248_10503950 3300009177 Bacteria 1365
195 Ga0105249_10883895 3300009553 Bacteria 960
196 Ga0105239_11063075 3300010375 Bacteria 931
197 Ga0105246_10031115 3300011119 Bacteria 3529
198 Ga0157342_1019125 3300012507 Bacteria 782
199 Ga0157371_10074911 3300013102 Bacteria 2397
200 Ga0157371_10327001 3300013102 Bacteria 1113
201 Ga0157370_10156531 3300013104 Bacteria 2120
202 Ga0157374_10060640 3300013296 Bacteria 3541
203 Ga0157378_10116014 3300013297 Bacteria 2461
204 Ga0157378_10663228 3300013297 Unclassified 1060
205 Ga0163162_10007697 3300013306 Bacteria 10494
206 Ga0157372_10222762 3300013307 Bacteria 2186
207 Ga0157372_10326106 3300013307 Bacteria 1788
208 Ga0157375_10045218 3300013308 Bacteria 4285
209 Ga0157375_10089263 3300013308 Bacteria 3138
210 Ga0157375_10118795 3300013308 Bacteria 2751
211 Ga0157375_10355292 3300013308 Bacteria 1631
212 Ga0163163_10151677 3300014325 Bacteria 2361
213 Ga0163163_10280293 3300014325 Bacteria 1718
214 Ga0163163_10453672 3300014325 Bacteria 1342
215 Ga0163163_10593019 3300014325 Bacteria 1171
216 Ga0157380_10196477 3300014326 Bacteria 1786
217 Ga0157380_10487817 3300014326 Bacteria 1193
218 Ga0157377_10063624 3300014745 Bacteria 2113
219 Ga0157376_10328075 3300014969 Bacteria 1457
220 Ga0157376_11121962 3300014969 Bacteria 813
221 Ga0163161_10036682 3300017792 Bacteria 3511
222 Ga0163161_10043217 3300017792 Bacteria 3244
223 Ga0206356_11377960 3300020070 Bacteria 1295
224 Ga0207697_10024907 3300025315 Bacteria 2447
225 Ga0207697_10111855 3300025315 Bacteria 1170
226 Ga0207653_10047496 3300025885 Bacteria 1422
227 Ga0207682_10039691 3300025893 Bacteria 1915
228 Ga0207642_10079968 3300025899 Bacteria 1584
229 Ga0207710_10147293 3300025900 Bacteria 1140
230 Ga0207688_10021891 3300025901 Bacteria 3496
231 Ga0207688_10174485 3300025901 Bacteria 1279
232 Ga0207680_10036371 3300025903 Bacteria 2835
233 Ga0207680_10092111 3300025903 Bacteria 1930
234 Ga0207645_10025084 3300025907 Bacteria 3860
235 Ga0207645_10209092 3300025907 Bacteria 1285
236 Ga0207645_10330515 3300025907 Bacteria 1018
237 Ga0207643_10000779 3300025908 Bacteria 19421
238 Ga0207643_10006374 3300025908 Bacteria 6319
239 Ga0207707_10142949 3300025912 Bacteria 2092
240 Ga0207707_10615377 3300025912 Bacteria 918
241 Ga0207663_10068407 3300025916 Bacteria 2280
242 Ga0207660_10128567 3300025917 Bacteria 1926
243 Ga0207662_10000335 3300025918 Bacteria 21250
244 Ga0207662_10026096 3300025918 Bacteria 3369
245 Ga0207657_10092862 3300025919 Bacteria 2514
246 Ga0207649_10202158 3300025920 Bacteria 1404
247 Ga0207649_10268185 3300025920 Bacteria 1236
248 Ga0207652_10049237 3300025921 Bacteria 3607
249 Ga0207652_10253234 3300025921 Bacteria 1588
250 Ga0207652_10445457 3300025921 Bacteria 1167
251 Ga0207650_10016401 3300025925 Bacteria 5177
252 Ga0207650_10033864 3300025925 Bacteria 3703
253 Ga0207650_10052550 3300025925 Bacteria 3018
254 Ga0207650_10191412 3300025925 Bacteria 1635
255 Ga0207650_10798159 3300025925 Bacteria 800
256 Ga0207659_10031139 3300025926 Bacteria 3649
257 Ga0207659_10052166 3300025926 Bacteria 2912
258 Ga0207659_10052678 3300025926 Bacteria 2900
259 Ga0207659_10244038 3300025926 Bacteria 1454
260 Ga0207659_10545222 3300025926 Bacteria 985
261 Ga0207644_10057562 3300025931 Bacteria 2807
262 Ga0207690_10056308 3300025932 Bacteria 2652
263 Ga0207690_10103374 3300025932 Bacteria 2039
264 Ga0207690_10380451 3300025932 Bacteria 1122
265 Ga0207706_10037142 3300025933 Bacteria 4326
266 Ga0207706_10065085 3300025933 Bacteria 3210
267 Ga0207706_10117070 3300025933 Bacteria 2344
268 Ga0207706_10133405 3300025933 Bacteria 2184
269 Ga0207706_10347113 3300025933 Bacteria 1291
270 Ga0207686_10051320 3300025934 Bacteria 2569
271 Ga0207670_10095121 3300025936 Bacteria 2115
272 Ga0207669_10012705 3300025937 Bacteria 4150
273 Ga0207669_10137738 3300025937 Bacteria 1689
274 Ga0207691_10008380 3300025940 Bacteria 9933
275 Ga0207691_10063187 3300025940 Bacteria 3358
276 Ga0207691_10153761 3300025940 Bacteria 2022
277 Ga0207691_11026291 3300025940 Bacteria 688
278 Ga0207711_10079895 3300025941 Bacteria 2855
279 Ga0207711_10611903 3300025941 Bacteria 1016
280 Ga0207689_10003297 3300025942 Bacteria 14779
281 Ga0207689_10234522 3300025942 Bacteria 1517
282 Ga0207689_10351151 3300025942 Bacteria 1226
283 Ga0207679_10412275 3300025945 Bacteria 1190
284 Ga0207651_10007911 3300025960 Bacteria 5695
285 Ga0207651_10164989 3300025960 Bacteria 1740
286 Ga0207651_10471945 3300025960 Bacteria 1080
287 Ga0207712_10165953 3300025961 Bacteria 1721
288 Ga0207668_10104977 3300025972 Bacteria 2108
289 Ga0207668_10108496 3300025972 Bacteria 2078
290 Ga0207658_10074721 3300025986 Bacteria 2576
291 Ga0207677_10533210 3300026023 Bacteria 1020
292 Ga0207677_10600265 3300026023 Bacteria 966
293 Ga0207703_10040180 3300026035 Bacteria 3742
294 Ga0207703_10077400 3300026035 Bacteria 2761
295 Ga0207703_10216693 3300026035 Bacteria 1710
296 Ga0207703_10319117 3300026035 Bacteria 1422
297 Ga0207639_10687107 3300026041 Bacteria 949
298 Ga0207678_10164710 3300026067 Bacteria 1893
299 Ga0207678_10472066 3300026067 Bacteria 1092
300 Ga0207708_10166913 3300026075 Bacteria 1741
301 Ga0207708_10169967 3300026075 Bacteria 1726
302 Ga0207708_10379498 3300026075 Bacteria 1165
303 Ga0207641_10018378 3300026088 Bacteria 5731
304 Ga0207641_10339217 3300026088 Bacteria 1430
305 Ga0207648_10031574 3300026089 Bacteria 4683
306 Ga0207648_10067961 3300026089 Bacteria 3106
307 Ga0207648_10406326 3300026089 Bacteria 1235
308 Ga0207648_10909066 3300026089 Unclassified 822
309 Ga0207676_10051943 3300026095 Bacteria 3202
310 Ga0207676_10148585 3300026095 Bacteria 2015
311 Ga0207676_10243702 3300026095 Bacteria 1614
312 Ga0207676_10353862 3300026095 Bacteria 1359
313 Ga0207674_10569712 3300026116 Bacteria 1094
314 Ga0207675_100200600 3300026118 Bacteria 1916
315 Ga0207675_100716882 3300026118 Bacteria 1010
316 Ga0207683_10016841 3300026121 Bacteria 6219
317 Ga0207683_10020132 3300026121 Bacteria 5704
318 Ga0207683_10033980 3300026121 Bacteria 4430
319 Ga0207683_10690998 3300026121 Bacteria 946
320 Ga0207698_10243638 3300026142 Bacteria 1640
321 Ga0207698_10377435 3300026142 Bacteria 1347
322 Ga0209813_10002964 3300027866 Bacteria 3931
323 Ga0207428_10000570 3300027907 Bacteria 43701
324 Ga0207428_10002655 3300027907 Bacteria 17812
325 Ga0207428_10044772 3300027907 Bacteria 3568
326 Ga0207428_10128212 3300027907 Bacteria 1942
327 Ga0207428_10405793 3300027907 Unclassified 997
328 Ga0268266_10067360 3300028379 Bacteria 3099
329 Ga0268266_10615405 3300028379 Bacteria 1044
330 Ga0268265_10113986 3300028380 Bacteria 2213
331 Ga0268265_10250137 3300028380 Bacteria 1569
332 Ga0268264_10275056 3300028381 Bacteria 1575
333 Ga0307408_100216527 3300031548 Bacteria 1560
334 Ga0307408_100362801 3300031548 Bacteria 1233
335 Ga0307405_10107432 3300031731 Bacteria 1884
336 Ga0307405_10303126 3300031731 Bacteria 1213
337 Ga0307413_10187723 3300031824 Bacteria 1481
338 Ga0307412_10291875 3300031911 Bacteria 1285
339 Ga0307409_100374875 3300031995 Bacteria 1351
340 Ga0307409_100461087 3300031995 Bacteria 1229
341 Ga0307416_100040037 3300032002 Bacteria 3636
342 Ga0307416_100145482 3300032002 Bacteria 2163
343 Ga0307416_100540786 3300032002 Bacteria 1237
344 Ga0307416_101008117 3300032002 Bacteria 936
345 Ga0307415_100261300 3300032126 Bacteria 1413
346 Ga0373938_0022643 3300034957 Bacteria 1285
347 Ga0373929_0000739 3300035085 Bacteria 6326
348 Ga0373940_0001699 3300035088 Bacteria 4069
349 Ga0373940_0004488 3300035088 Bacteria 2951
350 Ga0373944_0121692 3300035089 Bacteria 900
351 Ga0373949_0029410 3300035090 Bacteria 1301
352 Ga0373939_0070622 3300035114 Bacteria 1136
353 Ga0373960_0020782 3300035121 Bacteria 1739
354 Ga0373943_0066909 3300035170 Bacteria 1811
355 Ga0373943_0123308 3300035170 Bacteria 1379
356 Ga0373946_0018399 3300035171 Bacteria 2683
357 Ga0373955_0056889 3300035172 Bacteria 2147
358 Ga0373961_0134791 3300035241 Bacteria 830
359 Ga0373962_0068032 3300035242 Bacteria 1058
360 Ga0373931_0034256 3300035691 Bacteria 2635
361 Ga0373931_0102003 3300035691 Bacteria 1615
362 Ga0373931_0568873 3300035691 Bacteria 738
363 Ga0373935_0082801 3300035692 Bacteria 2088
364 Ga0373935_0320438 3300035692 Bacteria 1100
365 Ga0373933_0497101 3300035724 Bacteria 799
366 Ga0373947_0106620 3300035725 Bacteria 1766
367 Ga0373947_0183506 3300035725 Bacteria 1363
368 Ga0373937_0071721 3300036401 Bacteria 3194
369 Ga0373937_0106842 3300036401 Bacteria 2602
370 Ga0373937_0165911 3300036401 Bacteria 2071
371 Ga0373925_0265459 3300037068 Bacteria 1380
372 Ga0395905_0558702 3300037471 Bacteria 1046
373 Ga0439439_0044926 3300041406 Bacteria 1151
374 Ga0439433_0020128 3300041999 Bacteria 1489
375 Ga0439455_0090185 3300042012 Bacteria 840
376 Ga0450897_012592 3300042128 Bacteria 836
377 Ga0439446_0032225 3300042156 Bacteria 1519
378 Ga0439446_0051868 3300042156 Bacteria 1227
379 Ga0439464_0021383 3300042439 Bacteria 1776
380 Ga0439464_0030409 3300042439 Bacteria 1512
381 Ga0439460_0056298 3300042461 Bacteria 1191
382 Ga0439460_0059508 3300042461 Bacteria 1163
383 Ga0451576_0033830 3300045051 Bacteria 5431
384 Ga0451576_0565407 3300045051 Bacteria 1195
385 Ga0495592_0325563 3300046454 Bacteria 992
386 Ga0495603_0009826 3300046455 Bacteria 5790
387 Ga0495629_0067049 3300046459 Bacteria 2505
388 Ga0495653_0555530 3300046463 Bacteria 710
389 Ga0495639_0064146 3300046475 Bacteria 1688
390 Ga0495608_0207656 3300046511 Bacteria 1232
391 Ga0495628_0121648 3300046516 Bacteria 2002
392 Ga0495652_0648868 3300046529 Bacteria 715
393 Ga0495640_0239347 3300046533 Bacteria 1140
394 Ga0495586_0315763 3300046535 Bacteria 896
395 Ga0495656_0070512 3300046615 Bacteria 1551
396 Ga0495634_0030778 3300046642 Bacteria 3703
397 Ga0495623_0017278 3300046679 Bacteria 4661
398 Ga0495658_0060835 3300046683 Bacteria 2167
399 Ga0495658_0067609 3300046683 Bacteria 2067
400 Ga0495658_0370108 3300046683 Bacteria 912
401 Ga0495613_0202773 3300046689 Bacteria 1398
402 Ga0495600_0078578 3300046809 Bacteria 2155
403 Ga0495680_0183904 3300047322 Bacteria 1507
404 Ga0496100_0310859 3300048903 Bacteria 1182
405 Ga0496101_0033269 3300048904 Bacteria 3635
406 Ga0496101_0169358 3300048904 Bacteria 1678
407 Ga0496102_0072515 3300048905 Bacteria 3165
408 Ga0496103_0353124 3300048906 Bacteria 945
409 Ga0496104_0157268 3300048907 Bacteria 2181
410 Ga0496105_0047912 3300048908 Bacteria 3527
411 Ga0496106_0076733 3300048909 Bacteria 2562
412 Ga0496107_0211279 3300048910 Bacteria 1443
413 Ga0496108_0205736 3300048911 Bacteria 1708
414 Ga0496109_0552213 3300048912 Bacteria 1087
415 Ga0496110_0138491 3300048913 Bacteria 2200
416 Ga0496110_0981310 3300048913 Bacteria 752
417 Ga0496111_0621780 3300048914 Bacteria 790
418 Ga0496112_0138763 3300048915 Bacteria 2401
419 Ga0496112_0385469 3300048915 Bacteria 1342
420 Ga0496112_0473769 3300048915 Bacteria 1189
421 Ga0496114_0069854 3300048917 Bacteria 2949
422 Ga0496114_0072770 3300048917 Bacteria 2891
423 Ga0496115_0045799 3300048918 Bacteria 3493
424 Ga0501032_0004614 3300049569 Bacteria 10362
425 Ga0501032_0097666 3300049569 Bacteria 1946
426 Ga0501033_0016362 3300049570 Bacteria 5616
427 Ga0501033_0088983 3300049570 Bacteria 2258
428 Ga0501033_0285415 3300049570 Bacteria 1165
429 Ga0501034_0002859 3300049571 Bacteria 20118
430 Ga0501034_0027678 3300049571 Bacteria 5764
431 Ga0501034_0045422 3300049571 Bacteria 4438
432 Ga0501034_0205584 3300049571 Bacteria 1925
433 Ga0501036_0035646 3300049572 Bacteria 4209
434 Ga0501036_0050456 3300049572 Bacteria 3523
435 Ga0501036_0061909 3300049572 Bacteria 3170
436 Ga0501036_0119633 3300049572 Unclassified 2224
437 Ga0501036_0323003 3300049572 Unclassified 1289
438 Ga0501037_0127199 3300049573 Bacteria 1828
439 Ga0501037_0196503 3300049573 Bacteria 1426
440 Ga0501037_0278173 3300049573 Bacteria 1166
441 Ga0501038_0091578 3300049574 Bacteria 2547
442 Ga0501038_0226322 3300049574 Bacteria 1490
443 Ga0501038_0372108 3300049574 Bacteria 1109
444 Ga0501039_0048668 3300049575 Bacteria 3277
445 Ga0501039_0352049 3300049575 Bacteria 1157
446 Ga0501040_0001636 3300049576 Bacteria 14281
447 Ga0501040_0021954 3300049576 Bacteria 4268
448 Ga0501040_0165818 3300049576 Bacteria 1563
449 Ga0501040_0259711 3300049576 Bacteria 1240
450 Ga0501040_0587579 3300049576 Bacteria 804
451 Ga0501041_0000867 3300049577 Bacteria 16319
452 Ga0501042_0014342 3300049578 Bacteria 5408
453 Ga0501042_0014364 3300049578 Bacteria 5405
454 Ga0501042_0048980 3300049578 Bacteria 3013
455 Ga0501042_0093789 3300049578 Bacteria 2156
456 Ga0501042_0145672 3300049578 Bacteria 1707
457 Ga0501042_0249364 3300049578 Bacteria 1281
458 Ga0501042_0618778 3300049578 Unclassified 787
459 Ga0501043_0044028 3300049579 Bacteria 3508
460 Ga0501043_0238640 3300049579 Bacteria 1402
461 Ga0501043_0258621 3300049579 Bacteria 1340
462 Ga0501043_0310915 3300049579 Bacteria 1203
463 Ga0501043_0353748 3300049579 Bacteria 1116
464 Ga0501043_0816314 3300049579 Bacteria 674
465 Ga0501046_0008765 3300049580 Bacteria 8785
466 Ga0501046_0080851 3300049580 Bacteria 2510
467 Ga0501046_0232209 3300049580 Bacteria 1362
468 Ga0501047_0008209 3300049581 Bacteria 9860
469 Ga0501047_0074722 3300049581 Bacteria 3262
470 Ga0501047_0097883 3300049581 Bacteria 2812
471 Ga0501047_0783600 3300049581 Bacteria 768
472 Ga0501048_0057217 3300049582 Bacteria 2765
473 Ga0501048_0071135 3300049582 Bacteria 2456
474 Ga0501048_0115244 3300049582 Bacteria 1898
475 Ga0501048_0184359 3300049582 Bacteria 1479
476 Ga0501067_0135834 3300049583 Bacteria 1369
477 Ga0501067_0186107 3300049583 Bacteria 1156
478 Ga0501069_0005714 3300049585 Bacteria 6482
479 Ga0501070_0068084 3300049586 Bacteria 2947
480 Ga0501070_0347845 3300049586 Bacteria 1203
481 Ga0501071_0044459 3300049587 Bacteria 3185
482 Ga0501071_0314532 3300049587 Unclassified 1188
483 Ga0501071_0352972 3300049587 Bacteria 1119
484 Ga0501071_0378351 3300049587 Bacteria 1079
485 Ga0501071_0621903 3300049587 Bacteria 830
486 Ga0501072_0012080 3300049588 Bacteria 6597
487 Ga0501072_0081681 3300049588 Bacteria 2562
488 Ga0501072_0144597 3300049588 Bacteria 1896
489 Ga0501072_0262226 3300049588 Unclassified 1375
490 Ga0501073_0028887 3300049589 Bacteria 3962
491 Ga0501073_0051646 3300049589 Bacteria 2879
492 Ga0501073_0196646 3300049589 Bacteria 1394
493 Ga0501073_0420628 3300049589 Bacteria 923
494 Ga0501073_0646693 3300049589 Bacteria 730
495 Ga0501074_0024381 3300049590 Bacteria 4397
496 Ga0501074_0164982 3300049590 Bacteria 1581
497 Ga0501074_0189734 3300049590 Bacteria 1466
498 Ga0501074_0189910 3300049590 Bacteria 1465
499 Ga0501074_0697548 3300049590 Bacteria 716
500 Ga0501075_0006939 3300049591 Bacteria 7825
501 Ga0501075_0015646 3300049591 Bacteria 5447
502 Ga0501075_0126440 3300049591 Bacteria 1946
503 Ga0501075_0165032 3300049591 Bacteria 1690
504 Ga0501075_0385664 3300049591 Unclassified 1068
505 Ga0501076_0005213 3300049592 Bacteria 9313
506 Ga0501076_0096285 3300049592 Bacteria 2384
507 Ga0501076_0097039 3300049592 Bacteria 2374
508 Ga0501076_0164134 3300049592 Bacteria 1810
509 Ga0501076_0431544 3300049592 Unclassified 1084
510 Ga0501076_0510536 3300049592 Unclassified 991
511 Ga0501077_0179051 3300049593 Unclassified 1347
512 Ga0501079_0008549 3300049741 Bacteria 7765
513 Ga0501079_0017355 3300049741 Bacteria 5497
514 Ga0501079_0054292 3300049741 Bacteria 3090
515 Ga0501079_0147016 3300049741 Bacteria 1837
516 Ga0501079_0147067 3300049741 Bacteria 1836
517 Ga0501079_0283054 3300049741 Bacteria 1296
518 Ga0501080_0128403 3300049742 Bacteria 2347
519 Ga0501080_0203118 3300049742 Bacteria 1819
520 Ga0501080_0342494 3300049742 Bacteria 1351
521 Ga0501080_0465943 3300049742 Bacteria 1131
522 Ga0501080_0492137 3300049742 Bacteria 1097
523 Ga0501081_0001521 3300049743 Bacteria 14247
524 Ga0501081_0043611 3300049743 Bacteria 3077
525 Ga0501081_0383803 3300049743 Bacteria 1038
526 Ga0501081_0417742 3300049743 Bacteria 994
527 Ga0501081_0505931 3300049743 Bacteria 900
528 Ga0501083_0001641 3300049744 Bacteria 15288
529 Ga0501083_0178433 3300049744 Bacteria 1387
530 Ga0501083_0188651 3300049744 Bacteria 1345
531 Ga0501083_0303524 3300049744 Bacteria 1038
532 Ga0501083_0522098 3300049744 Bacteria 773
533 Ga0501035_0048739 3300049822 Bacteria 3798
534 Ga0501035_0093385 3300049822 Bacteria 2647
535 Ga0501035_0274345 3300049822 Bacteria 1426
536 Ga0501035_0278474 3300049822 Bacteria 1414
537 Ga0501035_0322134 3300049822 Bacteria 1298
538 Ga0501044_0074317 3300049823 Bacteria 3453
539 Ga0501044_0481852 3300049823 Bacteria 1143
540 Ga0501045_0017302 3300049824 Bacteria 5117
541 Ga0501045_0023487 3300049824 Bacteria 4421
542 Ga0501045_0139544 3300049824 Bacteria 1802
543 Ga0501045_0173855 3300049824 Bacteria 1604
544 Ga0501045_0174745 3300049824 Bacteria 1600
545 nmdc:mga00v17_37489_c1 3300050491 Bacteria 2896
546 nmdc:mga00v17_547999_c1 3300050491 Bacteria 748
547 nmdc:mga0yw44_3081_c1 3300050492 Bacteria 7303
548 nmdc:mga0yw44_63176_c1 3300050492 Bacteria 2276
549 nmdc:mga0k408_43588_c1 3300050493 Bacteria 2586
550 nmdc:mga06z11_93135_c1 3300050494 Bacteria 1640
551 nmdc:mga04h51_13004_c1 3300050495 Bacteria 2349
552 nmdc:mga07m45_5892_c2 3300050496 Bacteria 4412
553 nmdc:mga05p37_119159_c1 3300050507 Bacteria 3243
554 nmdc:mga05p37_119379_c1 3300050507 Bacteria 3240
555 nmdc:mga05p37_17386_c1 3300050507 Bacteria 8676
556 nmdc:mga05p37_2129_c1 3300050507 Bacteria 23128
557 nmdc:mga05p37_41377_c1 3300050507 Bacteria 5657
558 nmdc:mga05p37_566091_c1 3300050507 Bacteria 1290
559 nmdc:mga05p37_65_c1 3300050507 Bacteria 48888
560 nmdc:mga05p37_9234_c1 3300050507 Bacteria 11652
561 nmdc:mga09592_113091_c1 3300050508 Bacteria 2330
562 nmdc:mga09592_149452_c1 3300050508 Bacteria 2015
563 nmdc:mga09592_293316_c1 3300050508 Unclassified 1410
564 nmdc:mga09592_62189_c1 3300050508 Bacteria 3158
565 nmdc:mga09592_99625_c1 3300050508 Bacteria 2488
566 nmdc:mga0qj67_102337_c1 3300050509 Bacteria 2310
567 nmdc:mga0qj67_13764_c1 3300050509 Bacteria 6106
568 nmdc:mga0qj67_17403_c1 3300050509 Bacteria 5464
569 nmdc:mga0qj67_21781_c1 3300050509 Bacteria 4917
570 nmdc:mga0qj67_2372_c1 3300050509 Bacteria 13411
571 nmdc:mga06r32_1023823_c1 3300050510 Bacteria 778
572 nmdc:mga06r32_17327_c1 3300050510 Bacteria 6576
573 nmdc:mga06r32_188071_c1 3300050510 Bacteria 2052
574 nmdc:mga06r32_336233_c1 3300050510 Unclassified 1495
575 nmdc:mga06r32_363545_c1 3300050510 Bacteria 1431
576 nmdc:mga06r32_437214_c1 3300050510 Bacteria 1289
577 nmdc:mga06r32_445620_c1 3300050510 Bacteria 1275
578 nmdc:mga06r32_525720_c1 3300050510 Bacteria 1158
579 nmdc:mga06r32_890667_c1 3300050510 Bacteria 847
580 nmdc:mga08y16_1206017_c1 3300050511 Unclassified 727
581 nmdc:mga08y16_141921_c1 3300050511 Bacteria 2497
582 nmdc:mga08y16_143136_c1 3300050511 Bacteria 2486
583 nmdc:mga08y16_167513_c1 3300050511 Bacteria 2283
584 nmdc:mga08y16_173592_c1 3300050511 Bacteria 2238
585 nmdc:mga08y16_340750_c1 3300050511 Bacteria 1541
586 nmdc:mga08y16_54114_c1 3300050511 Bacteria 4194
587 nmdc:mga08y16_647801_c1 3300050511 Bacteria 1061
588 nmdc:mga08y16_849879_c1 3300050511 Unclassified 902
589 nmdc:mga0n895_145328_c1 3300050512 Bacteria 2401
590 nmdc:mga0n895_179407_c1 3300050512 Bacteria 2149
591 nmdc:mga0n895_18506_c1 3300050512 Bacteria 6447
592 nmdc:mga0n895_218465_c1 3300050512 Bacteria 1935
593 nmdc:mga0n895_24941_c1 3300050512 Bacteria 5643
594 nmdc:mga0n895_25766_c1 3300050512 Bacteria 5561
595 nmdc:mga0n895_267883_c1 3300050512 Bacteria 1733
596 nmdc:mga0n895_26927_c1 3300050512 Bacteria 5454
597 nmdc:mga0n895_274062_c1 3300050512 Bacteria 1711
598 nmdc:mga0n895_315409_c1 3300050512 Bacteria 1584
599 nmdc:mga0n895_623095_c1 3300050512 Bacteria 1079
600 nmdc:mga0rr50_2263_c1 3300050513 Bacteria 10796
601 nmdc:mga0rr50_424076_c1 3300050513 Bacteria 1126
602 nmdc:mga08x19_257154_c1 3300050514 Bacteria 1207
603 nmdc:mga08x19_53872_c1 3300050514 Bacteria 2589
604 nmdc:mga0a205_173984_c1 3300050515 Bacteria 2049
605 nmdc:mga0a205_3001_c1 3300050515 Bacteria 14958
606 nmdc:mga0a205_3048_c1 3300050515 Bacteria 14858
607 nmdc:mga0a205_427652_c1 3300050515 Bacteria 1186
608 Ga0495601_0056839 3300053077 Bacteria 2478
609 Ga0495601_0085783 3300053077 Bacteria 2023
610 Ga0495612_0097778 3300053078 Bacteria 1248
611 Ga0495595_0020969 3300053084 Bacteria 2850
612 Ga0495619_0050104 3300053085 Bacteria 2755
613 Ga0501084_0003872 3300054114 Bacteria 12184
614 Ga0501084_0075237 3300054114 Bacteria 2829
615 Ga0501084_0102474 3300054114 Bacteria 2404
616 Ga0501084_0124500 3300054114 Bacteria 2168
617 Ga0501084_0238513 3300054114 Bacteria 1535
618 Ga0501084_0260968 3300054114 Bacteria 1463
619 Ga0501084_0343213 3300054114 Bacteria 1261
620 Ga0501084_0406598 3300054114 Bacteria 1150
621 Ga0501084_0931400 3300054114 Bacteria 730
622 Ga0590071_000004 3300059421 Bacteria 63957
623 Ga0590074_009027 3300059423 Bacteria 1661
624 Ga0590075_000034 3300059424 Bacteria 36053
625 Ga0590077_000015 3300059426 Bacteria 38773
626 Ga0590077_002118 3300059426 Bacteria 4343
627 Ga0501082_0000274 3300060353 Bacteria 45495
628 Ga0501082_0063675 3300060353 Bacteria 3175
629 Ga0501082_0081907 3300060353 Bacteria 2785
630 Ga0501082_0281830 3300060353 Bacteria 1446
631 Ga0501082_0360377 3300060353 Bacteria 1268
632 Ga0530510_0017310 3300061734 Bacteria 5106
633 Ga0530510_0029564 3300061734 Bacteria 3934
634 Ga0530510_0044899 3300061734 Bacteria 3194
635 Ga0530510_0058329 3300061734 Bacteria 2791
636 Ga0530510_0211647 3300061734 Bacteria 1440
637 Ga0501033_0031007
638 Ga0058863_11588510
639 Ga0058863_11625439
640 Ga0058860_11966461
641 Ga0058862_12419053
642 Ga0065704_10102280
643 Ga0065712_10001248
644 Ga0065712_10085862
645 Ga0065712_10101257
646 Ga0065712_10162352
647 Ga0065715_10008392
648 Ga0065715_10010383
649 Ga0065715_10016873
650 Ga0065715_10055187
651 Ga0065707_10385383
652 Ga0070676_10027141
653 Ga0070676_10046078
654 Ga0070676_10119028
655 Ga0070676_10125499
656 Ga0070683_100544885
657 Ga0070690_100024114
658 Ga0070670_100019040
659 Ga0070670_100021447
660 Ga0070670_100050331
661 Ga0070670_100397351
662 Ga0070677_10014195
663 Ga0070677_10028050
664 Ga0068869_100037386
665 Ga0070666_10036918
666 Ga0070666_10190971
667 Ga0070680_100154707
668 Ga0070689_100063350
669 Ga0070689_100132175
670 Ga0070691_10049428
671 Ga0070687_100068909
672 Ga0070687_100091031
673 Ga0070661_100166374
674 Ga0070661_100611988
675 Ga0070668_100041626
676 Ga0070668_100314381
677 Ga0070668_100463242
678 Ga0070669_100054214
679 Ga0070669_100152909
680 Ga0070669_100275060
681 Ga0070669_100511144
682 Ga0070675_100061239
683 Ga0070675_100145573
684 Ga0070675_100173808
685 Ga0070675_100194769
686 Ga0070675_100487536
687 Ga0070675_100643767
688 Ga0070674_100031049
689 Ga0070673_100069060
690 Ga0070688_100003817
691 Ga0070688_100146880
692 Ga0070688_100258610
693 Ga0070659_100115995
694 Ga0070667_100047616
695 Ga0070703_10039292
696 Ga0070701_10070331
697 Ga0070700_100206269
698 Ga0070708_100169660
699 Ga0070708_100319312
700 Ga0070678_100004485
701 Ga0070678_100062889
702 Ga0070678_100330712
703 Ga0070678_100367323
704 Ga0070678_100415174
705 Ga0070662_100026522
706 Ga0070662_100052666
707 Ga0070662_100311266
708 Ga0070681_10070220
709 Ga0070681_10245381
710 Ga0068867_100116828
711 Ga0068867_100352534
712 Ga0070685_10033631
713 Ga0070698_100665540
714 Ga0070679_100077915
715 Ga0070679_100295888
716 Ga0070684_100241704
717 Ga0070672_100010895
718 Ga0070672_100370536
719 Ga0070672_100504422
720 Ga0070686_100033093
721 Ga0070686_100208538
722 Ga0070686_100410129
723 Ga0070665_100149247
724 Ga0070704_100085020
725 Ga0068855_100930001
726 Ga0070664_100049119
727 Ga0070664_100964855
728 Ga0068857_100599683
729 Ga0068857_100932179
730 Ga0068856_100999857
731 Ga0068852_100011754
732 Ga0068852_100224761
733 Ga0068859_100149632
734 Ga0068859_100163281
735 Ga0068859_100794066
736 Ga0068864_100101893
737 Ga0068864_100159840
738 Ga0068864_100177479
739 Ga0068864_100524054
740 Ga0068866_10053298
741 Ga0068866_10421793
742 Ga0068861_100154579
743 Ga0068870_10061412
744 Ga0068870_10209083
745 Ga0068863_100042134
746 Ga0068863_100185165
747 Ga0068863_100639387
748 Ga0068858_100116908
749 Ga0068858_100153869
750 Ga0068858_100166008
751 Ga0068858_100275499
752 Ga0068860_100100645
753 Ga0068862_100005694
754 Ga0068862_100105656
755 Ga0068862_100152765
756 Ga0075365_10004021
757 Ga0075365_10173703
758 Ga0075368_10049697
759 Ga0075364_10064006
760 Ga0070716_100478490
761 Ga0075367_10078966
762 Ga0097621_100010444
763 Ga0097621_100112023
764 Ga0068871_100016445
765 Ga0068871_100171110
766 Ga0068871_100198358
767 Ga0075428_100133812
768 Ga0075428_100187525
769 Ga0075428_100331934
770 Ga0075428_101096150
771 Ga0075428_101187082
772 Ga0075430_100003218
773 Ga0075430_100004914
774 Ga0075430_100035323
775 Ga0075430_100071540
776 Ga0075431_100003301
777 Ga0075431_100061368
778 Ga0075431_100134485
779 Ga0075431_100192367
780 Ga0075431_100275923
781 Ga0075431_100307918
782 Ga0075431_100342053
783 Ga0075431_100693063
784 Ga0075431_100923585
785 Ga0075433_10007511
786 Ga0075433_10049363
787 Ga0075433_10199161
788 Ga0075433_10201036
789 Ga0075434_100016140
790 Ga0075434_100049229
791 Ga0075434_100178264
792 Ga0075434_100209501
793 Ga0075434_100431190
794 Ga0075434_100499184
795 Ga0075429_100094173
796 Ga0075429_100094990
797 Ga0075429_100103496
798 Ga0075429_100236863
799 Ga0075429_100452907
800 Ga0068865_100111995
801 Ga0075436_100190114
802 Ga0097620_100149647
803 Ga0097620_100163282
804 Ga0097620_100256933
805 Ga0097620_100794067
806 Ga0075435_100001248
807 Ga0075435_100048440
808 Ga0075435_100156777
809 Ga0075435_100218065
810 Ga0105240_10152727
811 Ga0111539_10124915
812 Ga0111539_10262214
813 Ga0111539_10283542
814 Ga0111539_10357746
815 Ga0111539_10722108
816 Ga0111539_10782706
817 Ga0111539_11595136
818 Ga0105245_10537089
819 Ga0114129_10000897
820 Ga0114129_10006820
821 Ga0114129_10085526
822 Ga0114129_10127914
823 Ga0114129_10276154
824 Ga0114129_10570723
825 Ga0114129_11332568
826 Ga0105243_10051443
827 Ga0105243_10088970
828 Ga0105248_10110094
829 Ga0105248_10267172
830 Ga0105248_10503950
831 Ga0105249_10883895
832 Ga0105239_11063075
833 Ga0105246_10031115
834 Ga0157342_1019125
835 Ga0157371_10074911
836 Ga0157371_10327001
837 Ga0157370_10156531
838 Ga0157374_10060640
839 Ga0157378_10116014
840 Ga0157378_10663228
841 Ga0163162_10007697
842 Ga0157372_10222762
843 Ga0157372_10326106
844 Ga0157375_10045218
845 Ga0157375_10089263
846 Ga0157375_10118795
847 Ga0157375_10355292
848 Ga0163163_10151677
849 Ga0163163_10280293
850 Ga0163163_10453672
851 Ga0163163_10593019
852 Ga0157380_10196477
853 Ga0157380_10487817
854 Ga0157377_10063624
855 Ga0157376_10328075
856 Ga0157376_11121962
857 Ga0163161_10036682
858 Ga0163161_10043217
859 Ga0206356_11377960
860 Ga0207697_10024907
861 Ga0207697_10111855
862 Ga0207653_10047496
863 Ga0207682_10039691
864 Ga0207642_10079968
865 Ga0207710_10147293
866 Ga0207688_10021891
867 Ga0207688_10174485
868 Ga0207680_10036371
869 Ga0207680_10092111
870 Ga0207645_10025084
871 Ga0207645_10209092
872 Ga0207645_10330515
873 Ga0207643_10000779
874 Ga0207643_10006374
875 Ga0207707_10142949
876 Ga0207707_10615377
877 Ga0207663_10068407
878 Ga0207660_10128567
879 Ga0207662_10000335
880 Ga0207662_10026096
881 Ga0207657_10092862
882 Ga0207649_10202158
883 Ga0207649_10268185
884 Ga0207652_10049237
885 Ga0207652_10253234
886 Ga0207652_10445457
887 Ga0207650_10016401
888 Ga0207650_10033864
889 Ga0207650_10052550
890 Ga0207650_10191412
891 Ga0207650_10798159
892 Ga0207659_10031139
893 Ga0207659_10052166
894 Ga0207659_10052678
895 Ga0207659_10244038
896 Ga0207659_10545222
897 Ga0207644_10057562
898 Ga0207690_10056308
899 Ga0207690_10103374
900 Ga0207690_10380451
901 Ga0207706_10037142
902 Ga0207706_10065085
903 Ga0207706_10117070
904 Ga0207706_10133405
905 Ga0207706_10347113
906 Ga0207686_10051320
907 Ga0207670_10095121
908 Ga0207669_10012705
909 Ga0207669_10137738
910 Ga0207691_10008380
911 Ga0207691_10063187
912 Ga0207691_10153761
913 Ga0207691_11026291
914 Ga0207711_10079895
915 Ga0207711_10611903
916 Ga0207689_10003297
917 Ga0207689_10234522
918 Ga0207689_10351151
919 Ga0207679_10412275
920 Ga0207651_10007911
921 Ga0207651_10164989
922 Ga0207651_10471945
923 Ga0207712_10165953
924 Ga0207668_10104977
925 Ga0207668_10108496
926 Ga0207658_10074721
927 Ga0207677_10533210
928 Ga0207677_10600265
929 Ga0207703_10040180
930 Ga0207703_10077400
931 Ga0207703_10216693
932 Ga0207703_10319117
933 Ga0207639_10687107
934 Ga0207678_10164710
935 Ga0207678_10472066
936 Ga0207708_10166913
937 Ga0207708_10169967
938 Ga0207708_10379498
939 Ga0207641_10018378
940 Ga0207641_10339217
941 Ga0207648_10031574
942 Ga0207648_10067961
943 Ga0207648_10406326
944 Ga0207648_10909066
945 Ga0207676_10051943
946 Ga0207676_10148585
947 Ga0207676_10243702
948 Ga0207676_10353862
949 Ga0207674_10569712
950 Ga0207675_100200600
951 Ga0207675_100716882
952 Ga0207683_10016841
953 Ga0207683_10020132
954 Ga0207683_10033980
955 Ga0207683_10690998
956 Ga0207698_10243638
957 Ga0207698_10377435
958 Ga0209813_10002964
959 Ga0207428_10000570
960 Ga0207428_10002655
961 Ga0207428_10044772
962 Ga0207428_10128212
963 Ga0207428_10405793
964 Ga0268266_10067360
965 Ga0268266_10615405
966 Ga0268265_10113986
967 Ga0268265_10250137
968 Ga0268264_10275056
969 Ga0307408_100216527
970 Ga0307408_100362801
971 Ga0307405_10107432
972 Ga0307405_10303126
973 Ga0307413_10187723
974 Ga0307412_10291875
975 Ga0307409_100374875
976 Ga0307409_100461087
977 Ga0307416_100040037
978 Ga0307416_100145482
979 Ga0307416_100540786
980 Ga0307416_101008117
981 Ga0307415_100261300
982 Ga0373938_0022643
983 Ga0373929_0000739
984 Ga0373940_0001699
985 Ga0373940_0004488
986 Ga0373944_0121692
987 Ga0373949_0029410
988 Ga0373939_0070622
989 Ga0373960_0020782
990 Ga0373943_0066909
991 Ga0373943_0123308
992 Ga0373946_0018399
993 Ga0373955_0056889
994 Ga0373961_0134791
995 Ga0373962_0068032
996 Ga0373931_0034256
997 Ga0373931_0102003
998 Ga0373931_0568873
999 Ga0373935_0082801
1000 Ga0373935_0320438
1001 Ga0373933_0497101
1002 Ga0373947_0106620
1003 Ga0373947_0183506
1004 Ga0373937_0071721
1005 Ga0373937_0106842
1006 Ga0373937_0165911
1007 Ga0373925_0265459
1008 Ga0395905_0558702
1009 Ga0439439_0044926
1010 Ga0439433_0020128
1011 Ga0439455_0090185
1012 Ga0450897_012592
1013 Ga0439446_0032225
1014 Ga0439446_0051868
1015 Ga0439464_0021383
1016 Ga0439464_0030409
1017 Ga0439460_0056298
1018 Ga0439460_0059508
1019 Ga0451576_0033830
1020 Ga0451576_0565407
1021 Ga0495592_0325563
1022 Ga0495603_0009826
1023 Ga0495629_0067049
1024 Ga0495653_0555530
1025 Ga0495639_0064146
1026 Ga0495608_0207656
1027 Ga0495628_0121648
1028 Ga0495652_0648868
1029 Ga0495640_0239347
1030 Ga0495586_0315763
1031 Ga0495656_0070512
1032 Ga0495634_0030778
1033 Ga0495623_0017278
1034 Ga0495658_0060835
1035 Ga0495658_0067609
1036 Ga0495658_0370108
1037 Ga0495613_0202773
1038 Ga0495600_0078578
1039 Ga0495680_0183904
1040 Ga0496100_0310859
1041 Ga0496101_0033269
1042 Ga0496101_0169358
1043 Ga0496102_0072515
1044 Ga0496103_0353124
1045 Ga0496104_0157268
1046 Ga0496105_0047912
1047 Ga0496106_0076733
1048 Ga0496107_0211279
1049 Ga0496108_0205736
1050 Ga0496109_0552213
1051 Ga0496110_0138491
1052 Ga0496110_0981310
1053 Ga0496111_0621780
1054 Ga0496112_0138763
1055 Ga0496112_0385469
1056 Ga0496112_0473769
1057 Ga0496114_0069854
1058 Ga0496114_0072770
1059 Ga0496115_0045799
1060 Ga0501032_0004614
1061 Ga0501032_0097666
1062 Ga0501033_0016362
1063 Ga0501033_0088983
1064 Ga0501033_0285415
1065 Ga0501034_0002859
1066 Ga0501034_0027678
1067 Ga0501034_0045422
1068 Ga0501034_0205584
1069 Ga0501036_0035646
1070 Ga0501036_0050456
1071 Ga0501036_0061909
1072 Ga0501036_0119633
1073 Ga0501036_0323003
1074 Ga0501037_0127199
1075 Ga0501037_0196503
1076 Ga0501037_0278173
1077 Ga0501038_0091578
1078 Ga0501038_0226322
1079 Ga0501038_0372108
1080 Ga0501039_0048668
1081 Ga0501039_0352049
1082 Ga0501040_0001636
1083 Ga0501040_0021954
1084 Ga0501040_0165818
1085 Ga0501040_0259711
1086 Ga0501040_0587579
1087 Ga0501041_0000867
1088 Ga0501042_0014342
1089 Ga0501042_0014364
1090 Ga0501042_0048980
1091 Ga0501042_0093789
1092 Ga0501042_0145672
1093 Ga0501042_0249364
1094 Ga0501042_0618778
1095 Ga0501043_0044028
1096 Ga0501043_0238640
1097 Ga0501043_0258621
1098 Ga0501043_0310915
1099 Ga0501043_0353748
1100 Ga0501043_0816314
1101 Ga0501046_0008765
1102 Ga0501046_0080851
1103 Ga0501046_0232209
1104 Ga0501047_0008209
1105 Ga0501047_0074722
1106 Ga0501047_0097883
1107 Ga0501047_0783600
1108 Ga0501048_0057217
1109 Ga0501048_0071135
1110 Ga0501048_0115244
1111 Ga0501048_0184359
1112 Ga0501067_0135834
1113 Ga0501067_0186107
1114 Ga0501069_0005714
1115 Ga0501070_0068084
1116 Ga0501070_0347845
1117 Ga0501071_0044459
1118 Ga0501071_0314532
1119 Ga0501071_0352972
1120 Ga0501071_0378351
1121 Ga0501071_0621903
1122 Ga0501072_0012080
1123 Ga0501072_0081681
1124 Ga0501072_0144597
1125 Ga0501072_0262226
1126 Ga0501073_0028887
1127 Ga0501073_0051646
1128 Ga0501073_0196646
1129 Ga0501073_0420628
1130 Ga0501073_0646693
1131 Ga0501074_0024381
1132 Ga0501074_0164982
1133 Ga0501074_0189734
1134 Ga0501074_0189910
1135 Ga0501074_0697548
1136 Ga0501075_0006939
1137 Ga0501075_0015646
1138 Ga0501075_0126440
1139 Ga0501075_0165032
1140 Ga0501075_0385664
1141 Ga0501076_0005213
1142 Ga0501076_0096285
1143 Ga0501076_0097039
1144 Ga0501076_0164134
1145 Ga0501076_0431544
1146 Ga0501076_0510536
1147 Ga0501077_0179051
1148 Ga0501079_0008549
1149 Ga0501079_0017355
1150 Ga0501079_0054292
1151 Ga0501079_0147016
1152 Ga0501079_0147067
1153 Ga0501079_0283054
1154 Ga0501080_0128403
1155 Ga0501080_0203118
1156 Ga0501080_0342494
1157 Ga0501080_0465943
1158 Ga0501080_0492137
1159 Ga0501081_0001521
1160 Ga0501081_0043611
1161 Ga0501081_0383803
1162 Ga0501081_0417742
1163 Ga0501081_0505931
1164 Ga0501083_0001641
1165 Ga0501083_0178433
1166 Ga0501083_0188651
1167 Ga0501083_0303524
1168 Ga0501083_0522098
1169 Ga0501035_0048739
1170 Ga0501035_0093385
1171 Ga0501035_0274345
1172 Ga0501035_0278474
1173 Ga0501035_0322134
1174 Ga0501044_0074317
1175 Ga0501044_0481852
1176 Ga0501045_0017302
1177 Ga0501045_0023487
1178 Ga0501045_0139544
1179 Ga0501045_0173855
1180 Ga0501045_0174745
1181 nmdc:mga00v17_37489_c1
1182 nmdc:mga00v17_547999_c1
1183 nmdc:mga0yw44_3081_c1
1184 nmdc:mga0yw44_63176_c1
1185 nmdc:mga0k408_43588_c1
1186 nmdc:mga06z11_93135_c1
1187 nmdc:mga04h51_13004_c1
1188 nmdc:mga07m45_5892_c2
1189 nmdc:mga05p37_119159_c1
1190 nmdc:mga05p37_119379_c1
1191 nmdc:mga05p37_17386_c1
1192 nmdc:mga05p37_2129_c1
1193 nmdc:mga05p37_41377_c1
1194 nmdc:mga05p37_566091_c1
1195 nmdc:mga05p37_65_c1
1196 nmdc:mga05p37_9234_c1
1197 nmdc:mga09592_113091_c1
1198 nmdc:mga09592_149452_c1
1199 nmdc:mga09592_293316_c1
1200 nmdc:mga09592_62189_c1
1201 nmdc:mga09592_99625_c1
1202 nmdc:mga0qj67_102337_c1
1203 nmdc:mga0qj67_13764_c1
1204 nmdc:mga0qj67_17403_c1
1205 nmdc:mga0qj67_21781_c1
1206 nmdc:mga0qj67_2372_c1
1207 nmdc:mga06r32_1023823_c1
1208 nmdc:mga06r32_17327_c1
1209 nmdc:mga06r32_188071_c1
1210 nmdc:mga06r32_336233_c1
1211 nmdc:mga06r32_363545_c1
1212 nmdc:mga06r32_437214_c1
1213 nmdc:mga06r32_445620_c1
1214 nmdc:mga06r32_525720_c1
1215 nmdc:mga06r32_890667_c1
1216 nmdc:mga08y16_1206017_c1
1217 nmdc:mga08y16_141921_c1
1218 nmdc:mga08y16_143136_c1
1219 nmdc:mga08y16_167513_c1
1220 nmdc:mga08y16_173592_c1
1221 nmdc:mga08y16_340750_c1
1222 nmdc:mga08y16_54114_c1
1223 nmdc:mga08y16_647801_c1
1224 nmdc:mga08y16_849879_c1
1225 nmdc:mga0n895_145328_c1
1226 nmdc:mga0n895_179407_c1
1227 nmdc:mga0n895_18506_c1
1228 nmdc:mga0n895_218465_c1
1229 nmdc:mga0n895_24941_c1
1230 nmdc:mga0n895_25766_c1
1231 nmdc:mga0n895_267883_c1
1232 nmdc:mga0n895_26927_c1
1233 nmdc:mga0n895_274062_c1
1234 nmdc:mga0n895_315409_c1
1235 nmdc:mga0n895_623095_c1
1236 nmdc:mga0rr50_2263_c1
1237 nmdc:mga0rr50_424076_c1
1238 nmdc:mga08x19_257154_c1
1239 nmdc:mga08x19_53872_c1
1240 nmdc:mga0a205_173984_c1
1241 nmdc:mga0a205_3001_c1
1242 nmdc:mga0a205_3048_c1
1243 nmdc:mga0a205_427652_c1
1244 Ga0495601_0056839
1245 Ga0495601_0085783
1246 Ga0495612_0097778
1247 Ga0495595_0020969
1248 Ga0495619_0050104
1249 Ga0501084_0003872
1250 Ga0501084_0075237
1251 Ga0501084_0102474
1252 Ga0501084_0124500
1253 Ga0501084_0238513
1254 Ga0501084_0260968
1255 Ga0501084_0343213
1256 Ga0501084_0406598
1257 Ga0501084_0931400
1258 Ga0590071_000004
1259 Ga0590074_009027
1260 Ga0590075_000034
1261 Ga0590077_000015
1262 Ga0590077_002118
1263 Ga0501082_0000274
1264 Ga0501082_0063675
1265 Ga0501082_0081907
1266 Ga0501082_0281830
1267 Ga0501082_0360377
1268 Ga0530510_0017310
1269 Ga0530510_0029564
1270 Ga0530510_0044899
1271 Ga0530510_0058329
1272 Ga0530510_0211647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

16

204

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9303 14 206
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9271 17 206
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.919 15 206
7ode-assembly1.cif.gz_M e. coli 50s ribosome licl core particle 0.9063 15 206
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8883 14 206
ID Description Score Start End Superfamily
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7874 2 205 3.40.1370.10
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7852 2 206 3.40.1370.10
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7818 2 208 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7803 2 205 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.778 2 206 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A645G5W3-F1-model_v4 50S ribosomal protein L4 0.9686 107 206 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A536U9H5-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9655 101 206 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7Y8S3F3-F1-model_v4 deleted 0.9632 100 206
AF-A0A1F4VHK8-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9631 100 205 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1Q6X306-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9622 100 206 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map